--RGD OBO FILE GENERATOR -- build 2023-05-30 -- 07:03:2026 20:13 experimental_condition_ontology 1.2 jrsmith definition has_alternative_id has_broad_synonym database_cross_reference has_exact_synonym has_narrow_synonym has_obo_format_version has_obo_namespace has_related_synonym shorthand BFO:0000050 experimental_condition_ontology part_of part_of part_of JSmith 2014-03-07T11:32:23Z BFO:0000051 experimental_condition_ontology has_part has_part has_part JSmith 2014-03-07T11:34:22Z RO:0002211 experimental_condition_ontology has_component has_component has_component true true true true true true true true A state of being, an external or environmental factor or a treatment observed or administered prior to or concurrent with an investigative procedure such as an assessment of a morphological or physiological state or property in a single individual or sample or in a group of individuals or samples, especially a state, factor or treatment which has the potential to influence the outcome of such an assessment. experimental_condition_ontology XCO:0000000 experimental condition A state of being, an external or environmental factor or a treatment observed or administered prior to or concurrent with an investigative procedure such as an assessment of a morphological or physiological state or property in a single individual or sample or in a group of individuals or samples, especially a state, factor or treatment which has the potential to influence the outcome of such an assessment. PMID:22654893 http://www.thefreedictionary.com/ The state of being involved in some action, either physical or mental. experimental_condition_ontology XCO:0000001 activity The state of being involved in some action, either physical or mental. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A state in which the organism is not exhibiting any physical exertion. experimental_condition_ontology XCO:0000002 resting A state in which the organism is not exhibiting any physical exertion. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A state in which the organism is on an non-operating exercise machine in which there is an endless belt that moves when operational so that the organism can walk or run in place. experimental_condition_ontology XCO:0000003 resting on treadmill A state in which the organism is on an non-operating exercise machine in which there is an endless belt that moves when operational so that the organism can walk or run in place. Encarta:Encarta_World_English_Dictionary The action of ambulation on an exercise apparatus with an endless moving belt on which the organism can walk in place. experimental_condition_ontology XCO:0000004 walking on treadmill The action of ambulation on an exercise apparatus with an endless moving belt on which the organism can walk in place. Encarta:Encarta_World_English_Dictionary The act of rapidly moving the feet on an exercise apparatus with an endless belt that allows the user to perform the action of running in place. experimental_condition_ontology XCO:0000005 running on treadmill The act of rapidly moving the feet on an exercise apparatus with an endless belt that allows the user to perform the action of running in place. Encarta:Encarta_World_English_Dictionary This is any condition in which the main influencing factor is swimming, the action of a subject moving it's appendages to propel itself through water. experimental_condition_ontology XCO:0000006 swimming This is any condition in which the main influencing factor is swimming, the action of a subject moving it's appendages to propel itself through water. Encarta:Encarta_World_English_Dictionary This is any condition in which the main influencing factor is walking, the act of ambulation, moving oneself forward on legs or on an exercise apparatus. experimental_condition_ontology XCO:0000007 walking This is any condition in which the main influencing factor is walking, the act of ambulation, moving oneself forward on legs or on an exercise apparatus. Encarta:Encarta_World_English_Dictionary This is any condition in which the main influencing factor is running, the action of rapid movement of feet that propels the organism forward or is done on an exercise machine so that the organism performs the activity in place. experimental_condition_ontology XCO:0000008 running This is any condition in which the main influencing factor is running, the action of rapid movement of feet that propels the organism forward or is done on an exercise machine so that the organism performs the activity in place. Encarta:Encarta_World_English_Dictionary This is any condition in which the main influencing factor is control of the amount of one or more of the gases or particles which make up or are found in the air surrounding an organism during the time course of some biological measurement. controlled atmosphere composition controlled atmospheric composition experimental_condition_ontology Not4Curation XCO:0000009 controlled air content This is any condition in which the main influencing factor is control of the amount of one or more of the gases or particles which make up or are found in the air surrounding an organism during the time course of some biological measurement. ISBN:978-1416049982 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is controlled air oxygen content surrounding an organism or breathed by the organism as part of the experiment. air oxygen content controlled air O2 content controlled airdioxygen content experimental_condition_ontology XCO:0000010 controlled air oxygen content This is any condition in which the main influencing factor is controlled air oxygen content surrounding an organism or breathed by the organism as part of the experiment. RGD:MS The degree of heat or cold of the air surrounding an organism. experimental_condition_ontology XCO:0000011 air temperature The degree of heat or cold of the air surrounding an organism. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition in which the main influencing factor is controlled air carbon dioxide content surrounding an organism or breathed by the organism as part of the experiment. air carbon dioxide content experimental_condition_ontology XCO:0000012 controlled air carbon dioxide content This is any condition in which the main influencing factor is controlled air carbon dioxide content surrounding an organism or breathed by the organism as part of the experiment. RGD:MS The food and drink consumed by an organism day to day. experimental_condition_ontology XCO:0000013 diet The food and drink consumed by an organism day to day. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A regimen of solid food in which the amount of one or more elements of the diet are controlled. experimental_condition_ontology XCO:0000014 controlled content diet A regimen of solid food in which the amount of one or more elements of the diet are controlled. RGD:MS A regimen of solid food in which the number of calories consumed is controlled. experimental_condition_ontology XCO:0000015 controlled calorie content diet A regimen of solid food in which the number of calories consumed is controlled. RGD:MS This is any condition in which the main influencing factor is standard rat chow, a laboratory foodstuff which typically has 380-390 kcal/100 g with 9-10% of calories derived from fat, 70-80% of calories derived from carbohydrate, and 10-15% of calories derived from protein. standard rodent chow experimental_condition_ontology XCO:0000016 standard rat chow This is any condition in which the main influencing factor is standard rat chow, a laboratory foodstuff which typically has 380-390 kcal/100 g with 9-10% of calories derived from fat, 70-80% of calories derived from carbohydrate, and 10-15% of calories derived from protein. PMID:36386439 https://www.zeiglerfeed.com/research-diets/rodent-nih-31-open-formula-auto/ Surgical removal of kidney. mshimoyama 2011-11-02T02:06:00Z experimental_condition_ontology XCO:0000017 nephrectomy Surgical removal of kidney. RGD:MS Surgical removal of both kidneys. mshimoyama 2011-11-02T02:07:13Z experimental_condition_ontology XCO:0000018 bilateral nephrectomy Surgical removal of both kidneys. RGD:MS The solid food that is consumed by an organism. experimental_condition_ontology XCO:0000019 solid diet The solid food that is consumed by an organism. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A liquid consumed by an organism. experimental_condition_ontology XCO:0000020 drink A liquid consumed by an organism. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition in which the main influencing factor is water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Water may be used for drinking, as a solvent, or as an environmental component. H2O experimental_condition_ontology XCO:0000021 water This is any condition in which the main influencing factor is water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Water may be used for drinking, as a solvent, or as an environmental component. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://www.yourdictionary.com/drink A regimen of solid food in which the amount of sodium consumed is controlled. experimental_condition_ontology XCO:0000022 controlled sodium content diet A regimen of solid food in which the amount of sodium consumed is controlled. RGD:MS A drink made up of water and a specified amount of ethanol, the alcohol with chemical formula CH3-CH2-OH obtained from the fermentation of sugars and starches or by chemical synthesis which is the intoxicating ingredient of alcoholic beverages, for consumption by an organism in an experiment. experimental_condition_ontology XCO:0000023 controlled ethanol content drinking water A drink made up of water and a specified amount of ethanol, the alcohol with chemical formula CH3-CH2-OH obtained from the fermentation of sugars and starches or by chemical synthesis which is the intoxicating ingredient of alcoholic beverages, for consumption by an organism in an experiment. American_Heritage:The_American_Heritage_Science_Dictionary_2005 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A regimen of solid food in which the amount of iron consumed is controlled. controlled Fe content diet experimental_condition_ontology XCO:0000024 controlled iron content diet A regimen of solid food in which the amount of iron consumed is controlled. ISBN-13:9780781733908 https://www.merriam-webster.com A regimen of solid food in which the amount of fat consumed is controlled. experimental_condition_ontology XCO:0000025 controlled fat content diet A regimen of solid food in which the amount of fat consumed is controlled. RGD:MS The process of ablating or extracting all or part of an organ, gland or other body part from an organism as a medical or experimental procedure. experimental_condition_ontology XCO:0000026 surgical removal The process of ablating or extracting all or part of an organ, gland or other body part from an organism as a medical or experimental procedure. http://www.thefreedictionary.com/ Any insertion of a tissue, material or device into the body using a procedure involving incision into the body. experimental_condition_ontology XCO:0000027 surgical implantation Any insertion of a tissue, material or device into the body using a procedure involving incision into the body. Collins:Collins_Online_English_Dictionary Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A drink containing caffeine, one of the methylxanthines soluble in water and alcohol and obtainable from coffee, tea, guarana and mate. experimental_condition_ontology XCO:0000028 caffeinated drink A drink containing caffeine, one of the methylxanthines soluble in water and alcohol and obtainable from coffee, tea, guarana and mate. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A regimen of solid food in which the amount of carbohydrates consumed is controlled. experimental_condition_ontology XCO:0000029 controlled carbohydrate content diet A regimen of solid food in which the amount of carbohydrates consumed is controlled. RGD:MS A regimen of solid food in which the amount of protein consumed is controlled. experimental_condition_ontology XCO:0000030 controlled protein content diet A regimen of solid food in which the amount of protein consumed is controlled. RGD:MS A regimen of solid food in which the amount of calcium consumed is controlled. experimental_condition_ontology XCO:0000031 controlled calcium content diet A regimen of solid food in which the amount of calcium consumed is controlled. RGD:MS A regimen of solid food in which the amount of potassium consumed is controlled. experimental_condition_ontology XCO:0000032 controlled potassium content diet A regimen of solid food in which the amount of potassium consumed is controlled. RGD:MS experimental_condition_ontology XCO:0000033 housing condition experimental_condition_ontology XCO:0000034 individual housing experimental_condition_ontology XCO:0000035 housing in pairs experimental_condition_ontology XCO:0000036 housing with socially dominant partner experimental_condition_ontology XCO:0000037 housing with socially subordinate partner The condition of being subjected to any type of energy transmitted by waves through space or through some medium or to a stream of particles, such as electrons or alpha particles. experimental_condition_ontology XCO:0000038 radiation exposure The condition of being subjected to any type of energy transmitted by waves through space or through some medium or to a stream of particles, such as electrons or alpha particles. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 The condition of being subjected to transmitted energy composed of particles that individually carry enough kinetic energy to liberate an electron from an atom or molecule. experimental_condition_ontology XCO:0000039 ionizing radiation exposure The condition of being subjected to transmitted energy composed of particles that individually carry enough kinetic energy to liberate an electron from an atom or molecule. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Ionizing_radiation The condition of being subjected to high frequency, high energy electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components. Gamma radiation is traditionally considered to have wavelengths less than 0.01 nm and are generally emitted by nuclei rather than by electrons. gamma radiation exposure experimental_condition_ontology XCO:0000040 gamma ray exposure The condition of being subjected to high frequency, high energy electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components. Gamma radiation is traditionally considered to have wavelengths less than 0.01 nm and are generally emitted by nuclei rather than by electrons. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Gamma_ray The condition of being subjected to transmitted energy from the gaseous radioactive element radon, atomic number 86, resulting from decay of radium. Such radiation is composed of particles that individually carry enough kinetic energy to liberate an electron from an atom or molecule. alpha, beta, and gamma rays are released during the radioactive decay of radon. experimental_condition_ontology XCO:0000041 radon exposure The condition of being subjected to transmitted energy from the gaseous radioactive element radon, atomic number 86, resulting from decay of radium. Such radiation is composed of particles that individually carry enough kinetic energy to liberate an electron from an atom or molecule. alpha, beta, and gamma rays are released during the radioactive decay of radon. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Ionizing_radiation The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, in the part of the electromagnetic spectrum with wavelengths between about 10 and 400 nm. Ultraviolet radiation can be ionizing or non-ionizing depending on the wavelength. UV radiation exposure experimental_condition_ontology XCO:0000042 ultraviolet ray exposure The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, in the part of the electromagnetic spectrum with wavelengths between about 10 and 400 nm. Ultraviolet radiation can be ionizing or non-ionizing depending on the wavelength. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Electromagnetic_Radiation The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths between approximately 0.01 and 10 nm. X-radiation exposure roentgen radiation exposure experimental_condition_ontology XCO:0000043 X-ray exposure The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths between approximately 0.01 and 10 nm. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed http://en.wikipedia.org/wiki/Electromagnetic_Radiation The condition of being subjected to transmitted energy that does not carry enough energy per quantum to completely remove an electron from an atom or molecule. Such radiation has sufficient energy only for excitation, the movement of an electron to a higher energy state. experimental_condition_ontology XCO:0000044 non-ionizing radiation exposure The condition of being subjected to transmitted energy that does not carry enough energy per quantum to completely remove an electron from an atom or molecule. Such radiation has sufficient energy only for excitation, the movement of an electron to a higher energy state. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Non-ionizing_radiation The condition of being subjected to energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components. Electromagnetic radiation includes, in order of decreasing wavelength, radio waves, microwaves, infrared, visible, and ultraviolet light, x-rays, gamma rays, and cosmic rays. experimental_condition_ontology XCO:0000045 electromagnetic radiation exposure The condition of being subjected to energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components. Electromagnetic radiation includes, in order of decreasing wavelength, radio waves, microwaves, infrared, visible, and ultraviolet light, x-rays, gamma rays, and cosmic rays. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Electromagnetic_Radiation The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths longer than those of visible light, i.e. from approximately 750 to 2500 nm. IR radiation exposure experimental_condition_ontology XCO:0000046 infrared radiation exposure The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths longer than those of visible light, i.e. from approximately 750 to 2500 nm. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 http://en.wikipedia.org/wiki/Electromagnetic_Radiation An action or condition designed to cause the registration or perception of a stimulus and the voyage made by incoming nerve impulses from the sense organs to the nerve centers. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. experimental_condition_ontology XCO:0000047 sensory stimulus An action or condition designed to cause the registration or perception of a stimulus and the voyage made by incoming nerve impulses from the sense organs to the nerve centers. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://www.medterms.com Any action or condition designed to cause the registration or perception of a stimulus by organs and receptors involved in the sense of hearing. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. audible sound stimulus experimental_condition_ontology XCO:0000048 auditory stimulus Any action or condition designed to cause the registration or perception of a stimulus by organs and receptors involved in the sense of hearing. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed Any action or condition designed to cause the registration or perception of a stimulus by the optical sense organs. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. experimental_condition_ontology XCO:0000049 visual stimulus Any action or condition designed to cause the registration or perception of a stimulus by the optical sense organs. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed Any action or condition designed to cause the registration or perception of a stimulus, by organs or receptors involved in the sense of smell. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. experimental_condition_ontology XCO:0000050 olfactory stimulus Any action or condition designed to cause the registration or perception of a stimulus, by organs or receptors involved in the sense of smell. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed Any action or condition designed to cause the registration or perception of a stimulus by the gustatory receptors in the tongue. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. experimental_condition_ontology XCO:0000051 taste stimulus Any action or condition designed to cause the registration or perception of a stimulus by the gustatory receptors in the tongue. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed Any action or condition designed to cause the registration or perception of a stimulus by organs and receptors involved in the sense of touch, that is, the physiological sense by which external objects or forces are perceived through contact with the body. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. experimental_condition_ontology XCO:0000052 tactile stimulus Any action or condition designed to cause the registration or perception of a stimulus by organs and receptors involved in the sense of touch, that is, the physiological sense by which external objects or forces are perceived through contact with the body. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed An activity or condition involving a high temperature directed toward a particular part of an organism's body. heat exposure, targeted experimental_condition_ontology XCO:0000053 targeted heat exposure An activity or condition involving a high temperature directed toward a particular part of an organism's body. Collins:Collins_Online_English_Dictionary An activity or condition involving a low temperature directed toward a particular part of an organism's body. cold exposure, targeted experimental_condition_ontology XCO:0000054 targeted cold exposure An activity or condition involving a low temperature directed toward a particular part of an organism's body. Collins:Collins_Online_English_Dictionary This is any condition in which the main influencing factor is the stimulation of nerves involved in the physiological sense by which external objects or forces are perceived through contact with the body via application of an electric current. experimental_condition_ontology foot shock XCO:0000055 tactile electric shock exposure This is any condition in which the main influencing factor is the stimulation of nerves involved in the physiological sense by which external objects or forces are perceived through contact with the body via application of an electric current. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A baseline condition in which none of the experimental manipulations are performed. experimental_condition_ontology standard control condition XCO:0000056 naive control condition true A baseline condition in which none of the experimental manipulations are performed. RGD:MS This is any experimental condition in which the main influencing factor is rebreathed air, air which has been exhaled and breathed in again. mshimoyama 2009-12-17T01:47:13Z experimental_condition_ontology XCO:0000057 rebreathed air This is any experimental condition in which the main influencing factor is rebreathed air, air which has been exhaled and breathed in again. Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed The temperature of the air surrounding an organism which is considered the most common level for the facility. For humans the temperature considered most comfortable for a room is between 18 and 27 degrees celsius. mshimoyama 2009-12-17T01:49:34Z experimental_condition_ontology XCO:0000058 room temperature The temperature of the air surrounding an organism which is considered the most common level for the facility. For humans the temperature considered most comfortable for a room is between 18 and 27 degrees celsius. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Action in which a part of the body or whole body is involved in movement. mshimoyama 2009-12-17T01:50:15Z experimental_condition_ontology XCO:0000059 physical activity Action in which a part of the body or whole body is involved in movement. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Being in a state of action within the mind often involving manipulation of words or numbers. mshimoyama 2009-12-17T01:50:54Z experimental_condition_ontology XCO:0000060 mental activity Being in a state of action within the mind often involving manipulation of words or numbers. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 An activity in which a person starts with a number and deducts a specified number from that and then deducts the same number from the remainder of the first computation, without using a calculator or pencil and paper. mshimoyama 2009-12-17T01:51:15Z experimental_condition_ontology XCO:0000061 serial subtraction exercise An activity in which a person starts with a number and deducts a specified number from that and then deducts the same number from the remainder of the first computation, without using a calculator or pencil and paper. Encarta:Encarta_World_English_Dictionary The action of riding on a stationary or moving vehicle with wheels that is propelled by the movement of a person's legs. mshimoyama 2009-12-17T01:51:51Z experimental_condition_ontology XCO:0000062 cycling The action of riding on a stationary or moving vehicle with wheels that is propelled by the movement of a person's legs. RGD:MS The act of propelling the wheel or wheels of a fixed exercise machine through the action of one's legs. mshimoyama 2009-12-17T01:52:04Z experimental_condition_ontology XCO:0000063 cycling, stationary The act of propelling the wheel or wheels of a fixed exercise machine through the action of one's legs. RGD:MS The action of propelling a two wheeled vehicle by the movement of a person's legs. mshimoyama 2009-12-17T01:52:17Z experimental_condition_ontology XCO:0000064 cycling, non-stationary The action of propelling a two wheeled vehicle by the movement of a person's legs. Encarta:Encarta_World_English_Dictionary The action of squeezing an apparatus that measures the muscular contraction of the hand, used as a condition of exertion in experiments measuring other physiological functions. mshimoyama 2009-12-17T01:52:57Z experimental_condition_ontology XCO:0000065 hand dynamometer activity The action of squeezing an apparatus that measures the muscular contraction of the hand, used as a condition of exertion in experiments measuring other physiological functions. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Change in position or attitude of body as part of the experiment in which measurements are taken before, during and/or after the change. mshimoyama 2009-12-17T01:53:24Z experimental_condition_ontology XCO:0000066 body position change Change in position or attitude of body as part of the experiment in which measurements are taken before, during and/or after the change. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 mshimoyama 2009-12-17T01:53:35Z experimental_condition_ontology XCO:0000067 body position change, seated to standing mshimoyama 2009-12-17T01:53:58Z experimental_condition_ontology XCO:0000068 body position change, supine to standing mshimoyama 2009-12-17T01:56:44Z experimental_condition_ontology XCO:0000069 standard diet A drink containing ethanol, a transparent, colorless, volatile, flammable liquid, which is formed by microbial fermentation of carbohydrates. mshimoyama 2010-01-05T03:10:55Z experimental_condition_ontology ethanol XCO:0000070 alcoholic drink A drink containing ethanol, a transparent, colorless, volatile, flammable liquid, which is formed by microbial fermentation of carbohydrates. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 An alcoholic drink brewed by fermenting malt with sugar and yeast and flavored with hops. mshimoyama 2010-01-05T03:11:11Z experimental_condition_ontology XCO:0000071 beer An alcoholic drink brewed by fermenting malt with sugar and yeast and flavored with hops. Encarta:Encarta_World_English_Dictionary Alcoholic drink made by fermenting the juice of grapes. mshimoyama 2010-01-05T03:11:23Z experimental_condition_ontology XCO:0000072 wine Alcoholic drink made by fermenting the juice of grapes. Encarta:Encarta_World_English_Dictionary Alcoholic beverage produced by distillation. mshimoyama 2010-01-05T03:11:33Z experimental_condition_ontology XCO:0000073 liquor Alcoholic beverage produced by distillation. Encarta:Encarta_World_English_Dictionary A drink made up of water and a specified amount of caffeine consumed by an organism as part of an experiment. Caffeine is a xanthine alkaloid that acts primarily as a central nervous system and metabolic stimulant, and also as a mild vasoconstrictor, diuretic, and bronchodilator. mshimoyama 2010-01-05T03:15:30Z experimental_condition_ontology XCO:0000074 controlled caffeine content drinking water A drink made up of water and a specified amount of caffeine consumed by an organism as part of an experiment. Caffeine is a xanthine alkaloid that acts primarily as a central nervous system and metabolic stimulant, and also as a mild vasoconstrictor, diuretic, and bronchodilator. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Caffeine mshimoyama 2010-01-05T03:15:42Z experimental_condition_ontology XCO:0000075 tea A drink made of the decoction or infusion of the dried, roasted sees of Coffea arabica or Coffea canephora. mshimoyama 2010-01-05T03:15:55Z experimental_condition_ontology XCO:0000076 coffee A drink made of the decoction or infusion of the dried, roasted sees of Coffea arabica or Coffea canephora. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 The use of any product made for human consumption from Nicotiana tabacum. mshimoyama 2010-01-05T03:17:37Z experimental_condition_ontology XCO:0000077 tobacco use The use of any product made for human consumption from Nicotiana tabacum. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 The action of smoking, inhalation of the gases and hydrocarbon vapors generated by burning a cigar, a rolled cylinder of tobacco wrapped in tobacco leaves. mshimoyama 2010-01-05T03:17:52Z experimental_condition_ontology Cigar Smoking NCI Thesaurus XCO:0000078 cigar smoking The action of smoking, inhalation of the gases and hydrocarbon vapors generated by burning a cigar, a rolled cylinder of tobacco wrapped in tobacco leaves. http://medical-dictionary.thefreedictionary.com Cigar Smoking NCI Thesaurus NCI:C19702 The action of smoking, inhalation of the gases and hydrocarbon vapors generated by burning a cigarette, a small roll of finely cut tobacco enclosed in a wrapper of thin paper. mshimoyama 2010-01-05T03:18:03Z experimental_condition_ontology Cigarette Smoking_NCI Thesaurus XCO:0000079 cigarette smoking The action of smoking, inhalation of the gases and hydrocarbon vapors generated by burning a cigarette, a small roll of finely cut tobacco enclosed in a wrapper of thin paper. http://medical-dictionary.thefreedictionary.com Cigarette Smoking_NCI Thesaurus NCI:C18270 Mastication of a form of the prepared leaves of Nicotiana tabacum that is chewed. mshimoyama 2010-01-05T03:18:13Z experimental_condition_ontology XCO:0000080 tobacco chewing Mastication of a form of the prepared leaves of Nicotiana tabacum that is chewed. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 The attitude or posture of the body. mshimoyama 2010-03-04T09:05:26Z experimental_condition_ontology posture XCO:0000081 body position The attitude or posture of the body. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A position of rest in which the weight is largely supported by the buttocks, usually with the body vertical. mshimoyama 2010-03-04T09:06:36Z experimental_condition_ontology seated XCO:0000082 sitting position A position of rest in which the weight is largely supported by the buttocks, usually with the body vertical. Encarta:Encarta_World_English_Dictionary A position in which an organism is upright balanced on two legs for bipedal organisms or four legs for quadrapedal organisms. mshimoyama 2010-03-04T09:06:49Z experimental_condition_ontology XCO:0000083 standing position A position in which an organism is upright balanced on two legs for bipedal organisms or four legs for quadrapedal organisms. RGD:MS A position in which the organism is lying face up. mshimoyama 2010-03-04T09:07:12Z experimental_condition_ontology XCO:0000084 supine position A position in which the organism is lying face up. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 mshimoyama 2010-03-04T01:56:42Z experimental_condition_ontology XCO:0000085 stationary bicycle dynamometer A fixed series of exercises or body movements repeated at intervals over a specified period of time as part of a program to improve strength, aerobic capacity or other elements of fitness. mshimoyama 2010-03-04T02:09:06Z experimental_condition_ontology XCO:0000086 exercise training program A fixed series of exercises or body movements repeated at intervals over a specified period of time as part of a program to improve strength, aerobic capacity or other elements of fitness. RGD:MS A standard living condition with the absence of a resident pathogen, a biological agent that causes disease, especially a microorganism such as a bacterium, virus, or fungus. mshimoyama 2010-06-29T03:35:43Z experimental_condition_ontology XCO:0000087 specific pathogen-free condition A standard living condition with the absence of a resident pathogen, a biological agent that causes disease, especially a microorganism such as a bacterium, virus, or fungus. https://www.dictionary.com https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a compound or substance that has been purified or prepared, especially artificially. mshimoyama 2010-11-01T01:00:51Z experimental_condition_ontology XCO:0000088 chemical This is any condition in which the main influencing factor is a compound or substance that has been purified or prepared, especially artificially. https://languages.oup.com/google-dictionary-en/ Any condition in which the main influencing factor is a chemical, i.e., a substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules, which has the capacity to promote the formation of neoplasms, new and abnormal growths, specifically those in which cell multiplication is uncontrolled and progressive. mshimoyama 2010-11-01T01:01:08Z neoplasm inducing agent cancer inducing agent carcinogen carcinogenic agent experimental_condition_ontology XCO:0000089 neoplasm-inducing chemical Any condition in which the main influencing factor is a chemical, i.e., a substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules, which has the capacity to promote the formation of neoplasms, new and abnormal growths, specifically those in which cell multiplication is uncontrolled and progressive. American_Heritage:The_American_Heritage_Science_Dictionary_2005 Collins:Collins_Online_English_Dictionary Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A tetraphene having methyl substituents at the 7- and 12- positions. It is a potent carcinogen and is present in tobacco smoke. mshimoyama 2010-11-01T01:01:46Z CHEBI:254496 CID:6001 MESH:D015127 7,12-DMBA experimental_condition_ontology 7,12-DMBA 7,12-dimethylbenzo[a]anthracene 9,10-Dimethyl-1,2-benzanthracene DMBA XCO:0000090 7,12-dimethyltetraphene Any condition in which the main influencing factor is a naturally occurring compound or related synthetic analog with a molecular structure based on the cyclopenta[a]phenanthrene carbon skeleton, that is, a phenanthrene, to the a side of which a three-carbon fragment is fused. According to the definition at the Chemical Entities of Biological Importance (ChEBI) database, 'By extension, one or more bond scissions, ring expansions and/or ring contractions of the skeleton may have occurred' which expands the class to include molecules based on but not containing the cannonical arrangement of four fused cycloalkane rings. mshimoyama 2010-11-01T01:03:53Z CHEBI:35341 experimental_condition_ontology XCO:0000091 steroid Any condition in which the main influencing factor is a naturally occurring compound or related synthetic analog with a molecular structure based on the cyclopenta[a]phenanthrene carbon skeleton, that is, a phenanthrene, to the a side of which a three-carbon fragment is fused. According to the definition at the Chemical Entities of Biological Importance (ChEBI) database, 'By extension, one or more bond scissions, ring expansions and/or ring contractions of the skeleton may have occurred' which expands the class to include molecules based on but not containing the cannonical arrangement of four fused cycloalkane rings. http://en.wikipedia.org/wiki/Steroid http://www.medilexicon.com/medicaldictionary.php?t=22261 The predominant circulating form of estrogen, the female sex hormone. mshimoyama 2010-11-01T01:04:03Z CHEBI:16469 experimental_condition_ontology CO47085 E2 beta-estradiol estradiol XCO:0000092 17 beta-estradiol The predominant circulating form of estrogen, the female sex hormone. http://en.wikipedia.org/wiki/Estradiol Any organic compound whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, and whose carbon atoms form continuous or closed chains linked by alternating double and single bonds that may be represented graphically by multiple interlinking circular or triangular forms. mshimoyama 2010-11-01T01:07:01Z CHEBI:33848 experimental_condition_ontology polycyclic aromatic hydrocarbon XCO:0000093 polycyclic arene Any organic compound whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, and whose carbon atoms form continuous or closed chains linked by alternating double and single bonds that may be represented graphically by multiple interlinking circular or triangular forms. http://www.thefreedictionary.com/ The removal of one or both ovaries, the female gonads, from an organism. mshimoyama 2010-11-02T01:28:36Z experimental_condition_ontology oophorectomy XCO:0000094 ovariectomy The removal of one or both ovaries, the female gonads, from an organism. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Surgical removal of both ovaries. mshimoyama 2010-11-02T01:29:19Z experimental_condition_ontology XCO:0000095 bilateral ovariectomy Surgical removal of both ovaries. RGD:MS Surgical removal of a single ovary. mshimoyama 2010-11-02T01:29:34Z experimental_condition_ontology XCO:0000096 unilateral ovariectomy Surgical removal of a single ovary. RGD:MS Surgical removal of the right ovary. mshimoyama 2010-11-02T01:29:48Z experimental_condition_ontology XCO:0000097 right ovariectomy Surgical removal of the right ovary. RGD:MS Surgical removal of the left ovary. mshimoyama 2010-11-02T01:30:01Z experimental_condition_ontology XCO:0000098 left ovariectomy Surgical removal of the left ovary. RGD:MS This is any condition in which the major influencing factor is a uniform set of parameters accepted as normal or average and used by general consent as a basis of comparison. It is a baseline condition in which none of the experimental manipulations are performed. mshimoyama 2010-11-02T02:06:02Z XCO:0000056 XCO:0000791 naive control condition standard condition standard control condition experimental_condition_ontology XCO:0000099 control condition This is any condition in which the major influencing factor is a uniform set of parameters accepted as normal or average and used by general consent as a basis of comparison. It is a baseline condition in which none of the experimental manipulations are performed. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A surgical treatment or procedure that is performed as a control and that is similar to but omits a key therapeutic element of the treatment or procedure under investigation. mshimoyama 2010-11-02T02:06:46Z placebo surgery sham surgery experimental_condition_ontology XCO:0000100 sham surgical control condition A surgical treatment or procedure that is performed as a control and that is similar to but omits a key therapeutic element of the treatment or procedure under investigation. Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed A treatment used as a control in which a saline or other solution is administered in the same manner as the experimental solution minus the key element of the experimental solution. mshimoyama 2010-11-02T02:07:02Z PMID:28928461 experimental_condition_ontology vehicle control diet XCO:0000101 vehicle control condition A treatment used as a control in which a saline or other solution is administered in the same manner as the experimental solution minus the key element of the experimental solution. ISBN-13:9780781733908 https://www.merriam-webster.com/ Abstaining from the consumption of food, often for a specified period of time. mshimoyama 2010-11-08T09:37:31Z experimental_condition_ontology XCO:0000102 fasting Abstaining from the consumption of food, often for a specified period of time. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A mixture in which molecules of glucose, the monosaccharide sugar (C6H12O6) which is the end product of carbohydrate metabolism, and the chief source of energy for living organisms, are distributed uniformly throughout another substance (the solvent), usually water, so that the mixture is homogeneous at the molecular level. mshimoyama 2010-11-08T09:40:03Z experimental_condition_ontology dextrose solution XCO:0000103 glucose solution A mixture in which molecules of glucose, the monosaccharide sugar (C6H12O6) which is the end product of carbohydrate metabolism, and the chief source of energy for living organisms, are distributed uniformly throughout another substance (the solvent), usually water, so that the mixture is homogeneous at the molecular level. American_Heritage:The_American_Heritage_Science_Dictionary_2005 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A mixture in which 2.8 moles of glucose, the monosaccharide sugar (C6H12O6) which is the end product of carbohydrate metabolism, and the chief source of energy for living organisms, are distributed uniformly throughout a sufficient volume of another substance (the solvent), usually water, so that the mixture is homogeneous at the molecular level and the final volume is one liter. mshimoyama 2010-11-08T09:40:19Z experimental_condition_ontology XCO:0000104 glucose solution, 2.8M A mixture in which 2.8 moles of glucose, the monosaccharide sugar (C6H12O6) which is the end product of carbohydrate metabolism, and the chief source of energy for living organisms, are distributed uniformly throughout a sufficient volume of another substance (the solvent), usually water, so that the mixture is homogeneous at the molecular level and the final volume is one liter. American_Heritage:The_American_Heritage_Science_Dictionary_2005 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Surgical removal of part or all of the pancreas, the combined endocrine/exocrine gland situated transversely behind the stomach, between the spleen and the duodenum. mshimoyama 2010-11-10T02:19:58Z experimental_condition_ontology XCO:0000105 pancreatectomy Surgical removal of part or all of the pancreas, the combined endocrine/exocrine gland situated transversely behind the stomach, between the spleen and the duodenum. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition in which the main influencing factor is a drug or agent used to reduce or eliminate pain or sensation. mshimoyama 2011-01-21T09:44:08Z experimental_condition_ontology Not4Curation XCO:0000106 anesthetic/analgesic This is any condition in which the main influencing factor is a drug or agent used to reduce or eliminate pain or sensation. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Short to intermediate acting barbiturate used as a sedative and hypnotic. mshimoyama 2011-01-21T09:45:03Z experimental_condition_ontology XCO:0000107 pentobarbital Short to intermediate acting barbiturate used as a sedative and hypnotic. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Sodium salt of pentobarbital, a short to intermediate acting barbiturate used as a sedative and hypnotic. mshimoyama 2011-01-21T09:46:40Z experimental_condition_ontology XCO:0000108 pentobarbital, sodium Sodium salt of pentobarbital, a short to intermediate acting barbiturate used as a sedative and hypnotic. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Potent inhalational anesthetic. mshimoyama 2011-01-21T09:48:47Z experimental_condition_ontology XCO:0000109 isoflurane Potent inhalational anesthetic. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A position in which the organism is lying face down. mshimoyama 2011-02-07T01:44:52Z experimental_condition_ontology XCO:0000110 prone position A position in which the organism is lying face down. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 mshimoyama 2011-02-08T02:22:15Z experimental_condition_ontology XCO:0000111 temperature exposure Surgical removal of a single kidney. mshimoyama 2011-11-02T02:08:41Z experimental_condition_ontology XCO:0000112 unilateral nephrectomy Surgical removal of a single kidney. RGD:MS Surgical removal of the right kidney. mshimoyama 2011-11-02T02:11:31Z experimental_condition_ontology XCO:0000113 right nephrectomy Surgical removal of the right kidney. RGD:MS Surgical removal of the left kidney. mshimoyama 2011-11-02T02:12:44Z experimental_condition_ontology XCO:0000114 left nephrectomy Surgical removal of the left kidney. RGD:MS Any fluid which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel. mshimoyama 2012-01-09T01:29:00Z experimental_condition_ontology XCO:0000115 perfusate Any fluid which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A buffered, aqueous solution usually containing the cations sodium, potassium, calcium and magnesium, and anions chloride, sulfate, bicarbonate and phosphate and often including glucose as an energy source which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel. mshimoyama 2012-01-09T01:29:11Z experimental_condition_ontology Krebs-Henseleit buffer perfusate Krebs-Henseleit solution perfusate Krebs-Ringer buffer perfusate Krebs-Ringer solution perfusate XCO:0000116 Kreb's solution perfusate A buffered, aqueous solution usually containing the cations sodium, potassium, calcium and magnesium, and anions chloride, sulfate, bicarbonate and phosphate and often including glucose as an energy source which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://www.sigmaaldrich.com/etc/medialib/docs/Sigma/Product_Information_Sheet/1/k3753pis.Par.0001.File.tmp/k3753pis.pdf A fluid containing a specified amount of a chemical salt, for example sodium chloride, which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel. mshimoyama 2012-01-09T01:29:28Z experimental_condition_ontology XCO:0000117 saline solution perfusate A fluid containing a specified amount of a chemical salt, for example sodium chloride, which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel. Collins:Collins_Online_English_Dictionary Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which a fluid which has been injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel, remains in but is no longer actively passed through the organ or tissue for a specified period of time. mshimoyama 2012-01-09T01:29:47Z experimental_condition_ontology XCO:0000118 perfusate suspended A condition in which a fluid which has been injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel, remains in but is no longer actively passed through the organ or tissue for a specified period of time. Collins:Collins_Online_English_Dictionary Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition in which the main influencing factor is an amino acid, any naturally occurring or synthetic organic compound containing an amino group, a carboxylic acid group and a side chain. An amino acid may be administered as a nutritional supplement or as a drug. JSmith 2012-02-16T12:55:34Z CHEBI:33709 MESH:D000596 amino acids experimental_condition_ontology XCO:0000119 amino acid This is any condition in which the main influencing factor is an amino acid, any naturally occurring or synthetic organic compound containing an amino group, a carboxylic acid group and a side chain. An amino acid may be administered as a nutritional supplement or as a drug. https://en.wikipedia.org/wiki/Amino_acid https://www.merriam-webster.com/ A substance or compound which interferes with a chemical reaction or a molecular or physiological process or activity. JSmith 2012-02-16T01:09:21Z experimental_condition_ontology XCO:0000120 inhibitor A substance or compound which interferes with a chemical reaction or a molecular or physiological process or activity. RGD:JRS http://medical-dictionary.thefreedictionary.com/inhibitor A basic amino acid, commonly known as L-NAME, used as a non-selective inhibitor of nitric oxide synthase. JSmith 2012-02-16T01:15:20Z CAS:51298-62-5 MESH:D019331 chembl.compound:CHEMBL7890 pubchem.compound:39836 L-NAME experimental_condition_ontology XCO:0000121 NG-nitroarginine methyl ester A basic amino acid, commonly known as L-NAME, used as a non-selective inhibitor of nitric oxide synthase. MESH:D019331 A chemical which tends to increase the excretion of urine. JSmith 2012-02-16T01:51:41Z experimental_condition_ontology XCO:0000122 diuretic A chemical which tends to increase the excretion of urine. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A compound containing a sulfonamide functional group. A sulfonamide functional group contains sulfonyl connected to an amine group and has the general structure R-S(=O)2-NH2. Sulfonamide also refers to several classes of drugs which include antimicrobial 'sulfa drugs', anticonvulsants and the sulfonylureas and thiazide diuretics. JSmith 2012-02-16T01:52:39Z CHEBI:35358 experimental_condition_ontology XCO:0000123 sulfonamide A compound containing a sulfonamide functional group. A sulfonamide functional group contains sulfonyl connected to an amine group and has the general structure R-S(=O)2-NH2. Sulfonamide also refers to several classes of drugs which include antimicrobial 'sulfa drugs', anticonvulsants and the sulfonylureas and thiazide diuretics. http://en.eikipedia.org/wiki/ This is any condition whose main influencing factor is furosemide, a diuretic drug which inhibits Nkcc2 (Slc12a1), one of the Na-K symporters and reduces the reabsorption of sodium chloride. Furosemide is used experimentally for sodium depletion. JSmith 2012-02-16T01:53:25Z CHEBI:47426 CID:3440 4-chloro-2-{[(furan-2-yl)methyl]amino}-5-sulfamoylbenzoic acid experimental_condition_ontology Frusemide Lasix XCO:0000124 furosemide This is any condition whose main influencing factor is furosemide, a diuretic drug which inhibits Nkcc2 (Slc12a1), one of the Na-K symporters and reduces the reabsorption of sodium chloride. Furosemide is used experimentally for sodium depletion. http://en.eikipedia.org/wiki/ A chemical substance which in its endogenous state is produced by an organ, cells of an organ or scattered cells, having a specific regulatory affect on the activity of an organ or tissue. JSmith 2012-02-16T02:54:55Z experimental_condition_ontology XCO:0000125 hormone A chemical substance which in its endogenous state is produced by an organ, cells of an organ or scattered cells, having a specific regulatory affect on the activity of an organ or tissue. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A peptide hormone which increases blood pressure by causing blood vessel constriction. Part of the renin-angiotensin system. JSmith 2012-02-16T03:00:38Z experimental_condition_ontology XCO:0000126 angiotensin A peptide hormone which increases blood pressure by causing blood vessel constriction. Part of the renin-angiotensin system. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A catecholamine neurotransmitter and stress hormone with multiple physiological roles including affects on heart rate, blood pressure and vascular tone. JSmith 2012-02-16T03:01:05Z noradrenaline experimental_condition_ontology XCO:0000127 norepinephrine A catecholamine neurotransmitter and stress hormone with multiple physiological roles including affects on heart rate, blood pressure and vascular tone. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 JSmith 2012-02-16T03:23:23Z experimental_condition_ontology XCO:0000128 drink with chemical additive true Drinking water with a specified concentration of NG-Nitroarginine Methyl Ester (L-NAME) added to it. L-NAME is used as a non-selective inhibitor of nitric oxide synthase. JSmith 2012-02-16T03:23:57Z water with L-NAME experimental_condition_ontology XCO:0000129 water with NG-Nitroarginine Methyl Ester true Drinking water with a specified concentration of NG-Nitroarginine Methyl Ester (L-NAME) added to it. L-NAME is used as a non-selective inhibitor of nitric oxide synthase. PGA:Renal_protocol An analgesic and anesthetic which functions as a noncompetitive NMDA receptor (NMDAR) antagonist, binding to the allosteric site of the NMDA receptor and effectively inhibiting its channel. JSmith 2012-03-15T07:33:06Z CHEBI:6121 pubchem.compound:3821 experimental_condition_ontology XCO:0000130 ketamine An analgesic and anesthetic which functions as a noncompetitive NMDA receptor (NMDAR) antagonist, binding to the allosteric site of the NMDA receptor and effectively inhibiting its channel. http://en.wikipedia.org/wiki/Ketamine An alpha2-adrenergic receptor agonist used for sedation, anesthesia, muscle relaxation, and analgesia in animals. JSmith 2012-03-15T07:34:39Z CHEBI:165540 chembl.compound:CHEMBL297362 pubchem.compound:5707 experimental_condition_ontology XCO:0000131 xylazine An alpha2-adrenergic receptor agonist used for sedation, anesthesia, muscle relaxation, and analgesia in animals. http://en.wikipedia.org/wiki/Xylazine A phenothiazine-derivative antipsychotic drug used in animals as a sedative and antiemetic and which can also cause peripheral vasodilation. JSmith 2012-03-15T07:39:01Z CHEBI:44932 CID:6077 experimental_condition_ontology XCO:0000132 acepromazine A phenothiazine-derivative antipsychotic drug used in animals as a sedative and antiemetic and which can also cause peripheral vasodilation. http://en.wikipedia.org/wiki/Acepromazine A condition in which the major influencing factor is a chemical compound to which the body can mount a specific localized or systemic immune reaction, e.g. a T cell or B cell response. JSmith 2012-03-15T07:42:13Z experimental_condition_ontology XCO:0000133 antigen A condition in which the major influencing factor is a chemical compound to which the body can mount a specific localized or systemic immune reaction, e.g. a T cell or B cell response. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed RGD:JRS A synthetic choline ester that acts as a non-selective muscarinic receptor agonist, that is, a chemical which when bound to the receptor produces a physiologic reaction typical of the naturally occurring ligand, in the parasympathetic nervous system. JSmith 2012-03-15T07:45:00Z CHEBI:6804 experimental_condition_ontology XCO:0000134 methacholine A synthetic choline ester that acts as a non-selective muscarinic receptor agonist, that is, a chemical which when bound to the receptor produces a physiologic reaction typical of the naturally occurring ligand, in the parasympathetic nervous system. http://en.wikipedia.org/wiki/Methacholine A drug or other chemical that can combine with a receptor to produce a physiologic reaction typical of a naturally occurring substance. A receptor is a molecule on the surface or within a cell that recognizes and binds with specific molecules, producing a specific effect in the cell. JSmith 2012-03-15T07:46:38Z experimental_condition_ontology XCO:0000135 receptor agonist A drug or other chemical that can combine with a receptor to produce a physiologic reaction typical of a naturally occurring substance. A receptor is a molecule on the surface or within a cell that recognizes and binds with specific molecules, producing a specific effect in the cell. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 JSmith 2012-03-15T07:48:19Z experimental_condition_ontology XCO:0000136 enzyme substrate An oligopeptide substrate for continuous spectrophotometric assay of angiotensin converting enzyme (ACE) which hydrolyzes FAPGG to furylacryloylphenylalanine (FAP) and glycylglycine with a resulting decrease in absorbance at 340 nm. JSmith 2012-03-15T07:48:41Z CAS:64566-61-6 pubchem.compound:6438387 3-(2-FurylAcryloyl)-L-PHE-GLY-GLY FurylAcrylolPhenylalanylGlycylGlycine experimental_condition_ontology XCO:0000137 FAPGG An oligopeptide substrate for continuous spectrophotometric assay of angiotensin converting enzyme (ACE) which hydrolyzes FAPGG to furylacryloylphenylalanine (FAP) and glycylglycine with a resulting decrease in absorbance at 340 nm. http://www.sigmaaldrich.com/catalog/product/sigma/f7131?lang=en&region=US http://www.trinitybiotech.com/Product%20Documents/305-10-29%20EN.pdf Methylene blue is monoamine oxidase inhibitor and nitric oxide synthase inhibitor, as well as a cationic dye used as a redox indicator. JSmith 2012-03-15T07:51:22Z CHEBI:6872 pubchem.compound:6099 methylthioninium chloride experimental_condition_ontology XCO:0000138 methylene blue Methylene blue is monoamine oxidase inhibitor and nitric oxide synthase inhibitor, as well as a cationic dye used as a redox indicator. RGD:SL A condition in which the main influencing factor is a molecule that directly or indirectly acts upon blood vessels to cause constriction or dilation. JSmith 2012-03-15T07:53:30Z experimental_condition_ontology XCO:0000139 vasoactive chemical A condition in which the main influencing factor is a molecule that directly or indirectly acts upon blood vessels to cause constriction or dilation. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 A condition in which the main influencing factor is a molecule that functions to dilate or increase the interior diameter of blood vessels. JSmith 2012-03-15T07:55:13Z experimental_condition_ontology XCO:0000140 vasodilator A condition in which the main influencing factor is a molecule that functions to dilate or increase the interior diameter of blood vessels. Gale:Gale_Encyclopedia_of_Medicine A condition in which the main influencing factor is a molecule that acts to constrict or reduce the interior diameter of blood vessels. JSmith 2012-03-15T07:56:15Z experimental_condition_ontology vasopressor XCO:0000141 vasoconstrictor A condition in which the main influencing factor is a molecule that acts to constrict or reduce the interior diameter of blood vessels. Mosby:Mosbys_Medical_Dictionary--8th_Ed This is any condition in which the main influencing factor is sodium nitroprusside, the red-colored inorganic salt with the formula Na2[Fe(CN)5NO]?2H2O used as a potent vasodilator. JSmith 2012-03-15T07:58:24Z CHEBI:29321 CID:11953895 MESH:D009599 SNP disodium pentacyanonitrosylferrate(2-) dehydrate nitroprusside nitroprusside disodium dihydrate sodium nitroferricyanide(III) dihydrate sodium pentacyanidonitrosylferrate(2-) sodium pentacyanidonitrosylferrate(III) experimental_condition_ontology XCO:0000142 sodium nitroprusside This is any condition in which the main influencing factor is sodium nitroprusside, the red-colored inorganic salt with the formula Na2[Fe(CN)5NO]?2H2O used as a potent vasodilator. http://en.wikipedia.org/wiki/Sodium_nitroprusside An organic, polyatomic cation, formed as an ester of acetic acid and choline, that acts as a neurotransmitter in both the peripheral nervous system (PNS) and central nervous system (CNS) in many organisms. JSmith 2012-03-15T08:00:34Z CHEBI:15355 pubchem.compound:187 experimental_condition_ontology XCO:0000143 acetylcholine An organic, polyatomic cation, formed as an ester of acetic acid and choline, that acts as a neurotransmitter in both the peripheral nervous system (PNS) and central nervous system (CNS) in many organisms. http://en.wikipedia.org/wiki/Acetylcholine JSmith 2012-03-15T08:01:41Z experimental_condition_ontology XCO:0000144 neurotransmitter A selective alpha1-adrenergic receptor agonist used primarily as a decongestant, as an agent to dilate the pupil, and as a vasoconstrictor. JSmith 2012-03-15T08:02:39Z CHEBI:8093 pubchem.compound:6041 experimental_condition_ontology XCO:0000145 phenylephrine A selective alpha1-adrenergic receptor agonist used primarily as a decongestant, as an agent to dilate the pupil, and as a vasoconstrictor. http://en.wikipedia.org/wiki/Phenylephrine A buffered, aqueous solution usually containing the cations sodium, potassium, calcium and magnesium, and anions chloride, sulfate, bicarbonate and phosphate and often including glucose as an energy source in which a specified amount of the tasteless, odorless, colorless gas essential for aerobic respiration with atomic number 8 has been dissolved, which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel. JSmith 2012-03-21T02:07:15Z experimental_condition_ontology controlled oxygen content Krebs-Henseleit buffer perfusate controlled oxygen content Krebs-Henseleit solution perfusate controlled oxygen content Krebs-Ringer buffer perfusate controlled oxygen content Krebs-Ringer solution perfusate XCO:0000146 controlled oxygen content Kreb's solution perfusate A buffered, aqueous solution usually containing the cations sodium, potassium, calcium and magnesium, and anions chloride, sulfate, bicarbonate and phosphate and often including glucose as an energy source in which a specified amount of the tasteless, odorless, colorless gas essential for aerobic respiration with atomic number 8 has been dissolved, which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed http://www.sigmaaldrich.com/etc/medialib/docs/Sigma/Product_Information_Sheet/1/k3753pis.Par.0001.File.tmp/k3753pis.pdf A fluid which is injected or pumped into an organ or tissue, usually via blood vessels, composed of a solution of sodium chloride at a concentration which closely approximates the osmolarity of salt in blood. JSmith 2012-03-21T02:18:12Z PSS experimental_condition_ontology normal saline perfusate XCO:0000147 physiological salt solution perfusate A fluid which is injected or pumped into an organ or tissue, usually via blood vessels, composed of a solution of sodium chloride at a concentration which closely approximates the osmolarity of salt in blood. http://en.wikipedia.org/wiki/Saline_%28medicine%29#Normal A fluid which is injected or pumped into an organ or tissue, usually via blood vessels, composed of a solution of sodium chloride at a concentration which closely approximates the osmolarity of salt in blood, and which contains a specific, controlled concentration of oxygen gas, the tasteless, odorless, colorless gas with atomic number 8 essential for aerobic respiration, dissolved in it. JSmith 2012-03-21T02:19:03Z oxygenated PSS experimental_condition_ontology XCO:0000148 controlled oxygen content physiological salt solution perfusate A fluid which is injected or pumped into an organ or tissue, usually via blood vessels, composed of a solution of sodium chloride at a concentration which closely approximates the osmolarity of salt in blood, and which contains a specific, controlled concentration of oxygen gas, the tasteless, odorless, colorless gas with atomic number 8 essential for aerobic respiration, dissolved in it. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Saline_%28medicine%29#Normal Any condition in which the main influencing factor is an atom or molecule that has gained or lost one or more electrons and thereby acquired a charge, or is any of a large class of chemical compounds formed when a positively charged ion (a cation) bonds with a negatively charged ion (an anion). JSmith 2012-03-23T07:25:49Z experimental_condition_ontology XCO:0000149 ion/salt Any condition in which the main influencing factor is an atom or molecule that has gained or lost one or more electrons and thereby acquired a charge, or is any of a large class of chemical compounds formed when a positively charged ion (a cation) bonds with a negatively charged ion (an anion). American_Heritage:The_American_Heritage_Science_Dictionary_2005 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the main influencing factor is an atom of potassium, the chemical element with atomic number 19, that has lost one electron, forming a cation with a charge of +1. Potassium is the chief cation of intracellular fluid. JSmith 2012-03-23T07:31:29Z CHEBI:29103 K+ ion experimental_condition_ontology XCO:0000150 Not used for potassium salt in animal feed. For that application XCO:0000032, "controlled potassium content diet" is used. potassium ion A condition in which the main influencing factor is an atom of potassium, the chemical element with atomic number 19, that has lost one electron, forming a cation with a charge of +1. Potassium is the chief cation of intracellular fluid. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 JSmith 2012-03-23T08:10:45Z experimental_condition_ontology XCO:0000151 chemical time series The condition of exposing an organism, organ or tissue to a series of increasing or decreasing doses of a drug or other chemical from which a single measurement value is obtained. JSmith 2012-03-23T08:11:18Z experimental_condition_ontology XCO:0000152 drug dose time series The condition of exposing an organism, organ or tissue to a series of increasing or decreasing doses of a drug or other chemical from which a single measurement value is obtained. RGD:JRS A predetermined and specified amount of time during which an experimental specimen sits undisturbed, for example to allow a chemical reaction to proceed. JSmith 2012-03-26T10:46:30Z sample room temperature incubation experimental_condition_ontology XCO:0000153 sample resting period A predetermined and specified amount of time during which an experimental specimen sits undisturbed, for example to allow a chemical reaction to proceed. RGD:JRS This is any condition in which the main influencing factor is a homogeneous mixture of one or more ions, i.e. atoms or molecules that have gained or lost electron(s) and thereby acquired a charge, or one or more salts, i.e. members of the large class of chemical compounds formed when a positively charged ion (a cation) bonds with a negatively charged ion (an anion), dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. JSmith 2012-03-26T04:34:54Z experimental_condition_ontology XCO:0000154 ion/salt solution This is any condition in which the main influencing factor is a homogeneous mixture of one or more ions, i.e. atoms or molecules that have gained or lost electron(s) and thereby acquired a charge, or one or more salts, i.e. members of the large class of chemical compounds formed when a positively charged ion (a cation) bonds with a negatively charged ion (an anion), dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. American_Heritage:The_American_Heritage_Science_Dictionary_2005 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the main influencing factor is a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. JSmith 2012-03-26T04:36:15Z CHEBI:26710 salt solution experimental_condition_ontology saline solution XCO:0000155 sodium chloride solution A condition in which the main influencing factor is a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition in which the main influencing factor is a solution of sodium chloride (NaCl) and water in which the level of NaCl is maintained at a mass concentration of 9 grams per liter (0.9 grams per 100 mls of solution, or 0.9 % m/v). The osmolarity of normal saline is a close approximation to the osmolarity of NaCl in blood. JSmith 2012-03-26T04:56:10Z CHEBI:26710 PSS isotonic saline normal saline physiological saline physiological salt solution experimental_condition_ontology 0.9% Sodium Chloride Injection XCO:0000156 0.9% sodium chloride solution This is any condition in which the main influencing factor is a solution of sodium chloride (NaCl) and water in which the level of NaCl is maintained at a mass concentration of 9 grams per liter (0.9 grams per 100 mls of solution, or 0.9 % m/v). The osmolarity of normal saline is a close approximation to the osmolarity of NaCl in blood. http://en.wikipedia.org/wiki/Saline_%28medicine%29 The use of manual or mechanical means to limit some or all of an animal's normal movement for the purpose of examination, collection of samples, drug administration, therapy, or experimental manipulation. JSmith 2012-06-07T12:30:41Z experimental_condition_ontology XCO:0000157 physical restraint The use of manual or mechanical means to limit some or all of an animal's normal movement for the purpose of examination, collection of samples, drug administration, therapy, or experimental manipulation. http://grants.nih.gov/grants/olaw/Guide-for-the-care-and-use-of-Laboratory-animals.pdf The use of mechanical means, i.e. a manufactured apparatus or machine, to limit some or all of an animal's normal movements. JSmith 2012-06-07T12:42:46Z experimental_condition_ontology XCO:0000158 physical restraint in mechanical restrainer The use of mechanical means, i.e. a manufactured apparatus or machine, to limit some or all of an animal's normal movements. RGD:JRS http://grants.nih.gov/grants/olaw/Guide-for-the-care-and-use-of-Laboratory-animals.pdf The use of a tube type rodent restrainer, that is, a hollow cylinder usually made of a rigid clear material in a size that approximates the size of the animal and can be capped at one or both ends to prevent escape, to limit some or all of an animal's normal movements. JSmith 2012-06-07T12:43:33Z experimental_condition_ontology XCO:0000159 physical restraint in tube type rodent restrainer The use of a tube type rodent restrainer, that is, a hollow cylinder usually made of a rigid clear material in a size that approximates the size of the animal and can be capped at one or both ends to prevent escape, to limit some or all of an animal's normal movements. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed http://grants.nih.gov/grants/olaw/Guide-for-the-care-and-use-of-Laboratory-animals.pdf A substance that binds to a receptor without eliciting a biological response, blocking binding of substances that could elicit such responses. JSmith 2012-07-03T03:15:44Z experimental_condition_ontology XCO:0000160 receptor antagonist A substance that binds to a receptor without eliciting a biological response, blocking binding of substances that could elicit such responses. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition whose main influencing factor is losartan, an angiotensin II receptor antagonist and vasodilator which consists of a biphenylyltetrazole where a 1,1'-biphenyl group is attached at the 5-position. Losartan also has an additional trisubstituted imidazol-1-ylmethyl group at the 4'-position. JSmith 2012-07-09T10:53:01Z CHEBI:6541 experimental_condition_ontology XCO:0000161 losartan Nicotinic acetylcholine receptor antagonist, ganglionic blocking agent and vasodilator which consists of a dication whose structure comprises a pentane backbone linking two 1-methylpyrrolidinium groups. JSmith 2012-07-09T10:58:54Z CHEBI:347401 CHEBI:55326 experimental_condition_ontology XCO:0000162 pentolinium This is any condition in which the main influencing factor is drinking water in which the amount of one or more solutes are adjusted to a requirement. JSmith 2012-07-09T11:14:14Z experimental_condition_ontology XCO:0000163 controlled content drinking water This is any condition in which the main influencing factor is drinking water in which the amount of one or more solutes are adjusted to a requirement. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed A drink made up of water and a specified amount of sodium, i.e. sodium ions, consumed by an organism as part of an experiment. A sodium ion is an atom of sodium, the chemical element with atomic number 11, that has lost one electron, forming a cation with a charge of +1. JSmith 2012-07-09T11:19:29Z experimental_condition_ontology XCO:0000164 controlled sodium content drinking water A drink made up of water and a specified amount of sodium, i.e. sodium ions, consumed by an organism as part of an experiment. A sodium ion is an atom of sodium, the chemical element with atomic number 11, that has lost one electron, forming a cation with a charge of +1. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any process involving manual and instrumental techniques for incision or excision of a part of an organism to investigate and/or treat a pathological condition. JSmith 2012-07-11T01:38:55Z experimental_condition_ontology Not4Curation XCO:0000165 surgical manipulation This is any process involving manual and instrumental techniques for incision or excision of a part of an organism to investigate and/or treat a pathological condition. http://en.wikipedia.org/wiki/Surgery Any experimental condition in which the internal or external environment of an organ, that is, a differentiated, structural part of a system of the body that performs a specific function, is experimentally manipulated, for example through perfusion, increased or decreased blood flow, etc. without removal from the body. JSmith 2012-07-11T02:55:03Z experimental_condition_ontology XCO:0000166 controlled in situ organ condition Any experimental condition in which the internal or external environment of an organ, that is, a differentiated, structural part of a system of the body that performs a specific function, is experimentally manipulated, for example through perfusion, increased or decreased blood flow, etc. without removal from the body. RGD:JRS RGD:MRD http://www.thefreedictionary.com/ Any experimental condition in which the internal or external environment of one or both kidneys, the organ which functions to maintain proper water and electrolyte balance, regulate acid-base concentration, and filter the blood of metabolic wastes, is experimentally manipulated, for example through perfusion, increased or decreased blood flow, etc. without removal from the body. JSmith 2012-07-11T03:01:51Z experimental_condition_ontology XCO:0000167 controlled in situ kidney condition Any experimental condition in which the internal or external environment of one or both kidneys, the organ which functions to maintain proper water and electrolyte balance, regulate acid-base concentration, and filter the blood of metabolic wastes, is experimentally manipulated, for example through perfusion, increased or decreased blood flow, etc. without removal from the body. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 RGD:JRS Condition in which the difference in pressure between the arteries and veins in the kidney, the organ which functions to maintain proper water and electrolyte balance, regulate acid-base concentration, and filter the blood of metabolic wastes, is experimentally regulated, for example by injecting or pumping a fluid into the kidney at a specified pressure or by regulating the blood flow through the kidney, without removal of the organ from the body. JSmith 2012-07-11T03:07:44Z experimental_condition_ontology XCO:0000168 controlled in situ renal perfusion pressure Condition in which the difference in pressure between the arteries and veins in the kidney, the organ which functions to maintain proper water and electrolyte balance, regulate acid-base concentration, and filter the blood of metabolic wastes, is experimentally regulated, for example by injecting or pumping a fluid into the kidney at a specified pressure or by regulating the blood flow through the kidney, without removal of the organ from the body. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Any chemical to which a tracer has been added such as the addition of a fluorescent tag or inclusion of a radioactive element during synthesis. JSmith 2012-07-11T03:39:04Z experimental_condition_ontology XCO:0000169 labeled chemical Any chemical to which a tracer has been added such as the addition of a fluorescent tag or inclusion of a radioactive element during synthesis. RGD:JRS Chemical to which a fluorescent tag has been added as a tracer. JSmith 2012-07-11T03:51:55Z experimental_condition_ontology XCO:0000170 fluorescently labeled chemical Chemical to which a fluorescent tag has been added as a tracer. RGD:JRS Chemical into which a radioactive element has been incorporated as a tracer. JSmith 2012-07-11T03:53:33Z experimental_condition_ontology XCO:0000171 radioactively labeled chemical Chemical into which a radioactive element has been incorporated as a tracer. RGD:JRS Any of a group of organic compounds that includes sugars, starches, celluloses, and gums and serves as a major energy source in the diet of animals. JSmith 2012-07-11T04:09:48Z CHEBI:16646 experimental_condition_ontology XCO:0000172 carbohydrate Any of a group of organic compounds that includes sugars, starches, celluloses, and gums and serves as a major energy source in the diet of animals. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 This is any condition whose main influencing factor is a polysaccharide, a macromolecule consisting of large numbers (>10) of monosaccharide residues, that is, simple carbohydrate residues each consisting of a single basic sugar unit with the general formula (CH2O)n, linked glycosidically. JSmith 2012-07-11T04:13:15Z CHEBI:18154 polysaccharides experimental_condition_ontology XCO:0000173 polysaccharide This is any condition whose main influencing factor is a polysaccharide, a macromolecule consisting of large numbers (>10) of monosaccharide residues, that is, simple carbohydrate residues each consisting of a single basic sugar unit with the general formula (CH2O)n, linked glycosidically. Mosby:Mosbys_Medical_Dictionary--8th_Ed A fructose-based starch derived from rhizomes of plants from the Compositae family and used as a diagnostic aid in tests of kidney function, specifically glomerular filtration. JSmith 2012-07-11T04:15:22Z CHEBI:15443 experimental_condition_ontology XCO:0000174 inulin A fructose-based starch derived from rhizomes of plants from the Compositae family and used as a diagnostic aid in tests of kidney function, specifically glomerular filtration. Mosby:Mosbys_Medical_Dictionary--8th_Ed Inulin, a fructose-based starch derived from rhizomes of plants from the Compositae family and used as a diagnostic aid in tests of kidney function, specifically glomerular filtration, into which the mass 3 radioactive isotope of hydrogen has been incorporated as a tracer. JSmith 2012-07-11T04:18:17Z 3H-inulin experimental_condition_ontology XCO:0000175 tritiated inulin Inulin, a fructose-based starch derived from rhizomes of plants from the Compositae family and used as a diagnostic aid in tests of kidney function, specifically glomerular filtration, into which the mass 3 radioactive isotope of hydrogen has been incorporated as a tracer. Mosby:Mosbys_Medical_Dictionary--8th_Ed Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed Any of numerous proteins or conjugated proteins produced by living organisms and functioning as specialized catalysts for biochemical reactions. JSmith 2012-07-12T05:06:15Z experimental_condition_ontology XCO:0000176 enzyme Any of numerous proteins or conjugated proteins produced by living organisms and functioning as specialized catalysts for biochemical reactions. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 An enzyme in blood formed from prothrombin that facilitates blood clotting by reacting with fibrinogen to form fibrin, as well as participating in additional steps in the coagulation pathway. JSmith 2012-07-12T05:13:12Z EC:3.4.21.5 experimental_condition_ontology XCO:0000177 thrombin An enzyme in blood formed from prothrombin that facilitates blood clotting by reacting with fibrinogen to form fibrin, as well as participating in additional steps in the coagulation pathway. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 http://en.wikipedia.org/wiki/Thrombin A non-competitive inhibitor of the sarco / endoplasmic reticulum Ca2+ ATPase (SERCA) class of enzymes. Acts as a non-phorbol-ester-type tumor promoter and acts as an inhibitor of calcium ATPase of endoplasmic reticulum, leading to an increase in cytoplasmic calcium ions. JSmith 2012-07-12T05:24:18Z CHEBI:9516 experimental_condition_ontology XCO:0000178 thapsigargin A non-competitive inhibitor of the sarco / endoplasmic reticulum Ca2+ ATPase (SERCA) class of enzymes. Acts as a non-phorbol-ester-type tumor promoter and acts as an inhibitor of calcium ATPase of endoplasmic reticulum, leading to an increase in cytoplasmic calcium ions. Mondofacto:Mondofacto_Online_Medical_Dictionary http://en.wikipedia.org/wiki/Thapsigargin The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths between 10 and 120 nm. Radiation (i.e. ultraviolet light) at this wavelength is considered ionizing, that is, composed of photons that individually carry enough energy to liberate an electron from an atom or molecule without raising the bulk material to ionization temperature. JSmith 2012-07-13T12:39:17Z ionizing UV radiation exposure experimental_condition_ontology extreme UV ray exposure extreme ultraviolet ray exposure XCO:0000179 ionizing ultraviolet radiation exposure The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths between 10 and 120 nm. Radiation (i.e. ultraviolet light) at this wavelength is considered ionizing, that is, composed of photons that individually carry enough energy to liberate an electron from an atom or molecule without raising the bulk material to ionization temperature. http://en.wikipedia.org/wiki/Electromagnetic_Radiation http://en.wikipedia.org/wiki/Ionizing_radiation The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths between 120 and 400 nm. Radiation (i.e. ultraviolet light) at this wavelength does not have sufficient energy to liberate electrons from atoms or molecules although it can induce photochemical reactions, or accelerate radical reactions. JSmith 2012-07-13T01:00:12Z non-ionizing UV radiation exposure near ultraviolet radiation exposure experimental_condition_ontology XCO:0000180 non-ionizing ultraviolet radiation exposure The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths between 120 and 400 nm. Radiation (i.e. ultraviolet light) at this wavelength does not have sufficient energy to liberate electrons from atoms or molecules although it can induce photochemical reactions, or accelerate radical reactions. http://en.wikipedia.org/wiki/Electromagnetic_Radiation http://en.wikipedia.org/wiki/Ultraviolet Condition in which the presence or absence of visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, is constrained. JSmith 2012-07-13T02:59:55Z experimental_condition_ontology XCO:0000181 controlled visible light condition Condition in which the presence or absence of visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, is constrained. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed Condition in which the natural, usual or environmental level and/or time of exposure to visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, is controlled. JSmith 2012-07-13T03:09:31Z experimental_condition_ontology diurnal condition XCO:0000182 controlled exposure to ambient light Condition in which the natural, usual or environmental level and/or time of exposure to visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, is controlled. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed Condition during which visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, is removed. JSmith 2012-07-13T03:12:34Z experimental_condition_ontology nocturnal condition XCO:0000183 controlled exposure to darkness Condition during which visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, is removed. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed The divalent cation of calcium, the chemical element with symbol Ca and atomic number 20. JSmith 2012-07-13T03:19:56Z CHEBI:29108 experimental_condition_ontology XCO:0000184 calcium ion The divalent cation of calcium, the chemical element with symbol Ca and atomic number 20. http://en.wikipedia.org/wiki/Calcium A solution of the divalent cation of calcium, the chemical element with symbol Ca and atomic number 20. JSmith 2012-07-13T03:25:32Z CHEBI:29108 experimental_condition_ontology XCO:0000185 calcium ion solution A solution of the divalent cation of calcium, the chemical element with symbol Ca and atomic number 20. http://en.wikipedia.org/wiki/Calcium A toxic selective nicotinic cholinergic alkaloid from the seed of Laburnum anagyroides and other Leguminosae. Used in pharmacological studies of nicotinic cholinergic receptors in the brain. JSmith 2012-07-30T08:40:00Z CAS:485-35-8 experimental_condition_ontology baptitoxine sophorine XCO:0000186 cytisine A toxic selective nicotinic cholinergic alkaloid from the seed of Laburnum anagyroides and other Leguminosae. Used in pharmacological studies of nicotinic cholinergic receptors in the brain. Mondofacto:Mondofacto_Online_Medical_Dictionary A drug that counteracts cholinergic transmission at the ganglion type of nicotinic receptors of the autonomic ganglia by acting as a non-depolarizing competitive antagonist at the nicotinic acetylcholine receptor. JSmith 2012-07-30T08:54:30Z CAS:7187-66-8 CHEBI:9729 trimetaphan camsilate experimental_condition_ontology Arfonad XCO:0000187 trimethaphan camsylate A drug that counteracts cholinergic transmission at the ganglion type of nicotinic receptors of the autonomic ganglia by acting as a non-depolarizing competitive antagonist at the nicotinic acetylcholine receptor. http://en.wikipedia.org/wiki/Trimethaphan_camsylate Calcium channel blocker. JSmith 2012-07-30T09:01:57Z CAS:72803-02-2 experimental_condition_ontology PY 108-068 XCO:0000188 darodipine Calcium channel blocker. http://en.wikipedia.org/wiki/Darodipine Immobilization of a subject on a frame or platform by securing all four limbs to it, e.g. by taping them to mounts attached to the frame, thereby eliminating the subject's ability to move at will. JSmith 2012-08-01T04:38:43Z experimental_condition_ontology XCO:0000189 physical restraint on immobilization board Immobilization of a subject on a frame or platform by securing all four limbs to it, e.g. by taping them to mounts attached to the frame, thereby eliminating the subject's ability to move at will. Fink:Encyclopedia_of_Stress The 10 amino acid cleavage product produced by the action of renin on angiotensinogen. Ang I is apparently inactive unless further cleaved by angiotensin-converting enzyme (ACE) into Ang II. JSmith 2012-08-09T01:48:44Z experimental_condition_ontology XCO:0000190 angiotensin I The 10 amino acid cleavage product produced by the action of renin on angiotensinogen. Ang I is apparently inactive unless further cleaved by angiotensin-converting enzyme (ACE) into Ang II. PMID:18793332 The 8 amino acid cleavage product produced by the action of angiotensin-converting enzyme (ACE) on Ang I. Ang II is considered to be the main effector of the renin-angiotensin system (RAS), has endocrine, autocrine/paracrine, and intracrine hormone activities in the body and acts as a powerful vasoconstrictor. JSmith 2012-08-09T01:58:29Z CHEBI:48432 experimental_condition_ontology XCO:0000191 angiotensin II The 8 amino acid cleavage product produced by the action of angiotensin-converting enzyme (ACE) on Ang I. Ang II is considered to be the main effector of the renin-angiotensin system (RAS), has endocrine, autocrine/paracrine, and intracrine hormone activities in the body and acts as a powerful vasoconstrictor. PMID:18793332 The acetate ester of 11-deoxycorticosterone, a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone. JSmith 2012-08-09T02:19:10Z CHEBI:16973 experimental_condition_ontology 21-hydroxyprogesterone acetate DOCA desoxycorticosterone acetate XCO:0000192 deoxycorticosterone acetate The acetate ester of 11-deoxycorticosterone, a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone. http://en.wikipedia.org/wiki/11-Deoxycorticosterone Any natural or synthetic complex organic macromolecule composed of chain(s) of amino acids. A peptide can be contain as few as two amino acids; a protein can contain multiple chains composed of hundreds of amino acids. jsmith 2012-08-27T04:50:37Z experimental_condition_ontology Not4Curation polypeptide XCO:0000193 peptide/protein Any natural or synthetic complex organic macromolecule composed of chain(s) of amino acids. A peptide can be contain as few as two amino acids; a protein can contain multiple chains composed of hundreds of amino acids. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 An immunoglobulin molecule having a specific amino acid sequence that gives each antibody the ability to adhere to and interact only with the antigen that induced its synthesis and with molecules containing structures similar to that antigen. An antigen is any substance capable of inducing a specific immune response, including but not limited to toxins, bacterial proteins and viruses. jsmith 2012-08-27T05:01:08Z experimental_condition_ontology immunoglobulin XCO:0000194 antibody An immunoglobulin molecule having a specific amino acid sequence that gives each antibody the ability to adhere to and interact only with the antigen that induced its synthesis and with molecules containing structures similar to that antigen. An antigen is any substance capable of inducing a specific immune response, including but not limited to toxins, bacterial proteins and viruses. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed A membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is considered a primary target antigen involved in immune-mediated demyelination. jsmith 2012-08-27T05:05:03Z RGD:3102 experimental_condition_ontology Mog rMog (recombinant Mog) XCO:0000195 myelin oligodendrocyte glycoprotein A membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is considered a primary target antigen involved in immune-mediated demyelination. NCBI_Gene:4340 ATP-sensitive potassium channel inhibitor used as an anti-arrhythmia drug and a hypoglycemic/anti-diabetes drug. In the latter case, the drug causes beta cell membrane depolarization, which in turn results in opening of voltage-dependent calcium channels and subsequent insulin release. JSmith 2012-09-10T11:39:12Z CHEBI:5441 glyburide experimental_condition_ontology XCO:0000196 glybenclamide ATP-sensitive potassium channel inhibitor used as an anti-arrhythmia drug and a hypoglycemic/anti-diabetes drug. In the latter case, the drug causes beta cell membrane depolarization, which in turn results in opening of voltage-dependent calcium channels and subsequent insulin release. http://en.wikipedia.org/wiki/Glibenclamide Any substance that indicates the presence, absence, or concentration of another substance or the degree of reaction between substances by means of a characteristic change, especially in color. JSmith 2012-09-10T12:25:59Z experimental_condition_ontology XCO:0000197 indicator Any substance that indicates the presence, absence, or concentration of another substance or the degree of reaction between substances by means of a characteristic change, especially in color. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Any substance that indicates the concentration of hydrogen ions, that is the acidity level, of a solution by means of a characteristic change, especially in color. JSmith 2012-09-10T12:30:07Z experimental_condition_ontology XCO:0000198 pH indicator Any substance that indicates the concentration of hydrogen ions, that is the acidity level, of a solution by means of a characteristic change, especially in color. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Any substance which indicates the oxidation status of another substance or of a reaction by means of a characteristic change, especially in color. JSmith 2012-09-10T12:34:38Z redox indicator experimental_condition_ontology XCO:0000199 oxidation-reduction indicator Any substance which indicates the oxidation status of another substance or of a reaction by means of a characteristic change, especially in color. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 A monocarboxylic acid that serves as an intermediate in the metabolism of leucine and a substrate for NADPH-dependent dehydrogenases. JSmith 2012-09-10T12:50:31Z CHEBI:48430 pubchem.compound:70 2-Oxoisocaproate 4-methyl-2-oxovaleric acid alpha-ketoisocaproic acid experimental_condition_ontology Ketoleucine alpha-KIC XCO:0000200 4-methyl-2-oxopentanoic acid A monocarboxylic acid that serves as an intermediate in the metabolism of leucine and a substrate for NADPH-dependent dehydrogenases. http://en.wikipedia.org/wiki/Alpha-Ketoisocaproic_acid Surgical removal of one or both testes. JSmith 2012-09-10T01:13:58Z orchidectomy testectomy experimental_condition_ontology XCO:0000201 orchiectomy Surgical removal of one or both testes. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Surgical removal of a single testis. JSmith 2012-09-10T01:18:15Z unilateral orchidectomy experimental_condition_ontology unilateral testectomy XCO:0000202 unilateral orchiectomy Surgical removal of a single testis. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Surgical removal of both testes. JSmith 2012-09-10T01:20:16Z bilateral orchidectomy bilateral testectomy experimental_condition_ontology castration XCO:0000203 bilateral orchiectomy Surgical removal of both testes. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 The principal androgenic, that is, male sex hormone. Responsible for regulation of gonadotropic secretion, spermatogenesis and control of other male characteristics. JSmith 2012-09-10T01:41:13Z experimental_condition_ontology XCO:0000204 testosterone The principal androgenic, that is, male sex hormone. Responsible for regulation of gonadotropic secretion, spermatogenesis and control of other male characteristics. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 An agent that causes or increases the frequency of permanent, heritable changes in the DNA sequence or chromosomal structure of a cell or organism. JSmith 2012-09-11T04:39:32Z mutagen experimental_condition_ontology mutation inducing agent XCO:0000205 mutation inducing chemical An agent that causes or increases the frequency of permanent, heritable changes in the DNA sequence or chromosomal structure of a cell or organism. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Mosby:Mosbys_Medical_Dictionary--8th_Ed A component of tobacco smoke which has been shown to be mutagenic and carcinogenic in animal studies. JSmith 2012-09-11T05:01:10Z experimental_condition_ontology N,N-diethylnitrosamine NDEA diethylnitrosamine XCO:0000206 N-nitrosodiethylamine A component of tobacco smoke which has been shown to be mutagenic and carcinogenic in animal studies. PMID:8910949 A condition in which the main influencing factor is 3-methyl-4'-dimethylaminoazobenzene (MDAB), an azobenzene in which one of the phenyl groups is substituted at position 3 by a methyl group, while the other is substituted at position 4 by a dimethylamino group. MDAB is a potent liver carcinogen. JSmith 2012-09-11T05:33:14Z CAS:55-80-1 CHEBI:76329 pubchem.compound:5934 4-Dimethylamino-3'-methylazobenzene methyldimethylaminoazobenzene experimental_condition_ontology 3'-Me-DAB 3'-methyl-4-(dimethylamino)azobenzene MDAB XCO:0000207 3-methyl-4'-dimethylaminoazobenzene A condition in which the main influencing factor is 3-methyl-4'-dimethylaminoazobenzene (MDAB), an azobenzene in which one of the phenyl groups is substituted at position 3 by a methyl group, while the other is substituted at position 4 by a dimethylamino group. MDAB is a potent liver carcinogen. http://potency.berkeley.edu/chempages/3%27-METHYL-4-DIMETHYLAMINOAZOBENZENE.html A condition in which the main influencing factor is 2-acetamidofluorene (2-AAF) an ortho-fused polycyclic arene that consists of 9H-fluorene bearing an acetamido substituent at position 2. 2-AAF and a number of its metabolites are both carcinogenic and mutagenic. JSmith 2012-09-13T06:33:44Z CHEBI:17356 experimental_condition_ontology 2-AAF 2-acetylaminofluorene XCO:0000208 2-acetamidofluorene A condition in which the main influencing factor is 2-acetamidofluorene (2-AAF) an ortho-fused polycyclic arene that consists of 9H-fluorene bearing an acetamido substituent at position 2. 2-AAF and a number of its metabolites are both carcinogenic and mutagenic. http://en.wikipedia.org/wiki/Acetylaminofluorene JSmith 2012-09-13T06:34:26Z experimental_condition_ontology XCO:0000209 hepatectomy A condition involving the surgical excision of part of the liver, the large abdominal organ/gland which functions in the storage and filtration of blood, secretion of bile, and other processes. The partial liver removal may be minor (< 50%) or major (> 50%). JSmith 2012-09-13T06:34:52Z PMID:32156510 major hepatectomy minor hepatectomy experimental_condition_ontology XCO:0000210 partial hepatectomy A condition involving the surgical excision of part of the liver, the large abdominal organ/gland which functions in the storage and filtration of blood, secretion of bile, and other processes. The partial liver removal may be minor (< 50%) or major (> 50%). ISBN-13:9780781733908 PMID:32156510 JSmith 2012-09-13T06:36:13Z experimental_condition_ontology XCO:0000211 controlled sucrose content diet A regimen of solid food in which the amount of copper consumed is controlled. JSmith 2012-09-13T06:36:56Z controlled Cu content diet experimental_condition_ontology XCO:0000212 controlled copper content diet A regimen of solid food in which the amount of copper consumed is controlled. ISBN-13:9780781733908 https://www.merriam-webster.com Any condition in which the main influencing factor is arginine (L-arginine), an alpha-amino acid that is glycine in which the alpha-is substituted by a 3-guanidinopropyl group. JSmith 2012-09-13T06:45:59Z CHEBI:29016 MESH:D001120 2-amino-5-guanidinopentanoic acid ARG L-arginine R experimental_condition_ontology XCO:0000213 arginine Any condition in which the main influencing factor is arginine (L-arginine), an alpha-amino acid that is glycine in which the alpha-is substituted by a 3-guanidinopropyl group. CHEBI:29016 https://en.wikipedia.org/wiki/Arginine Any substance that makes another substance active or reactive, induces a chemical reaction, or combines with an enzyme to increase its catalytic activity. JSmith 2012-10-04T05:09:16Z experimental_condition_ontology Not4Curation XCO:0000214 activator Any substance that makes another substance active or reactive, induces a chemical reaction, or combines with an enzyme to increase its catalytic activity. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed A fluid which is injected or pumped into an organ or tissue, usually via blood vessels, composed of a solution of sodium chloride at a concentration which closely approximates the osmolarity of salt in blood, and which contains a specific, controlled concentration of calcium ions, divalent cations of the metallic chemical element with atomic number 20, dissolved in it. JSmith 2012-10-05T11:11:47Z experimental_condition_ontology XCO:0000215 controlled calcium ion content physiological salt solution perfusate A fluid which is injected or pumped into an organ or tissue, usually via blood vessels, composed of a solution of sodium chloride at a concentration which closely approximates the osmolarity of salt in blood, and which contains a specific, controlled concentration of calcium ions, divalent cations of the metallic chemical element with atomic number 20, dissolved in it. American_Heritage:The_American_Heritage_Science_Dictionary_2005 http://en.wikipedia.org/wiki/Saline_%28medicine%29#Normal Any chemical substance which increases the activity of an ion channel, one or more membrane-bound globular proteins that allow diffusion of specific ions across a cell membrane. JSmith 2012-10-04T05:16:39Z experimental_condition_ontology ion channel agonist XCO:0000216 ion channel activator Any chemical substance which increases the activity of an ion channel, one or more membrane-bound globular proteins that allow diffusion of specific ions across a cell membrane. Mosby:Mosbys_Medical_Dictionary--8th_Ed Any chemical substance which increases the activity of a cation channel, one or more membrane-bound globular proteins that allow diffusion of positively charged ions across a cell membrane. JSmith 2012-10-04T05:40:42Z experimental_condition_ontology XCO:0000217 cation channel activator Any chemical substance which increases the activity of a cation channel, one or more membrane-bound globular proteins that allow diffusion of positively charged ions across a cell membrane. Mosby:Mosbys_Medical_Dictionary--8th_Ed A phorbol ester analog that is an activator of TRPV4 (transient receptor potential cation channel, subfamily V, member 4) channels. JSmith 2012-10-04T05:41:38Z CHEBI:295732 pubchem.compound:452544 4-alpha-PDD experimental_condition_ontology XCO:0000218 4-alpha-phorbol 12,13-didecanoate A phorbol ester analog that is an activator of TRPV4 (transient receptor potential cation channel, subfamily V, member 4) channels. http://www.lclabs.com/PRODFILE/P-R/P-2170.php4 A capsaicinoid which is an irritant and a selective TRPV1 (transient receptor potential cation channel, subfamily V, member 1) agonist. JSmith 2012-10-04T06:08:13Z CHEBI:46932 8-Methyl-N-vanillylnonanamide N-(4-Hydroxy-3-methoxybenzyl)-8-methylnonanamide experimental_condition_ontology DHC XCO:0000219 dihydrocapsaicin A capsaicinoid which is an irritant and a selective TRPV1 (transient receptor potential cation channel, subfamily V, member 1) agonist. http://datasheets.scbt.com/sc-202578.pdf Any chemical substance which increases the activity of an anion channel, one or more membrane-bound globular proteins that allow diffusion of negatively charged ions across a cell membrane. JSmith 2012-10-04T06:11:24Z experimental_condition_ontology XCO:0000220 anion channel agonist Any chemical substance which increases the activity of an anion channel, one or more membrane-bound globular proteins that allow diffusion of negatively charged ions across a cell membrane. Mosby:Mosbys_Medical_Dictionary--8th_Ed Any chemical substance which decreases or interferes with the activity of an ion channel, one or more membrane-bound globular proteins that allow diffusion of specific ions across a cell membrane. JSmith 2012-10-04T06:13:42Z experimental_condition_ontology ion channel antagonist XCO:0000221 ion channel inhibitor Any chemical substance which decreases or interferes with the activity of an ion channel, one or more membrane-bound globular proteins that allow diffusion of specific ions across a cell membrane. Mosby:Mosbys_Medical_Dictionary--8th_Ed Any chemical substance which decreases or interferes with the activity of a cation channel, one or more membrane-bound globular proteins that allow diffusion of positively charged ions across a cell membrane. JSmith 2012-10-05T10:45:01Z experimental_condition_ontology cation channel antagonist XCO:0000222 cation channel inhibitor Any chemical substance which decreases or interferes with the activity of a cation channel, one or more membrane-bound globular proteins that allow diffusion of positively charged ions across a cell membrane. Mosby:Mosbys_Medical_Dictionary--8th_Ed Any chemical substance which decreases or interferes with the activity of an anion channel, one or more membrane-bound globular proteins that allow diffusion of negatively charged ions across a cell membrane. JSmith 2012-10-05T10:48:12Z experimental_condition_ontology anion channel antagonist XCO:0000223 anion channel inhibitor Any chemical substance which decreases or interferes with the activity of an anion channel, one or more membrane-bound globular proteins that allow diffusion of negatively charged ions across a cell membrane. Mosby:Mosbys_Medical_Dictionary--8th_Ed An inorganic dye which also intereacts with many types of proteins including ion channels and enzymes. JSmith 2012-10-05T11:03:00Z CHEBI:34956 ammoniated ruthenium oxychloride experimental_condition_ontology RuR XCO:0000224 ruthenium red An inorganic dye which also intereacts with many types of proteins including ion channels and enzymes. http://en.wikipedia.org/wiki/Ruthenium_red Any chemical substance which decreases or interferes with the activity of a potassium ion channel, that is, a complex of membrane-bound and membrane-spanning proteins that specifically allow diffusion of positively charged potassium ions across a cell membrane. JSmith 2012-10-05T11:29:50Z experimental_condition_ontology XCO:0000225 potassium channel inhibitor Any chemical substance which decreases or interferes with the activity of a potassium ion channel, that is, a complex of membrane-bound and membrane-spanning proteins that specifically allow diffusion of positively charged potassium ions across a cell membrane. http://en.wikipedia.org/wiki/Potassium_channel An 18 amino acid peptide neurotoxin from bee venom which blocks small-conductance Ca2+-activated K+ channels. JSmith 2012-10-05T11:41:19Z UniProtKB:P01500 pubchem.compound:16129677 apamine experimental_condition_ontology XCO:0000226 apamin An 18 amino acid peptide neurotoxin from bee venom which blocks small-conductance Ca2+-activated K+ channels. http://en.wikipedia.org/wiki/Apamin A 37 amino acid peptide neurotoxin from scorpion venom that is a blocker of large- and intermediate-conductance Ca2+-activated K+ channels. JSmith 2012-10-05T11:53:12Z UniProtKB:P13487 experimental_condition_ontology ChTX ChTX-Lq1 ChTx-a XCO:0000227 charybdotoxin A 37 amino acid peptide neurotoxin from scorpion venom that is a blocker of large- and intermediate-conductance Ca2+-activated K+ channels. http://en.wikipedia.org/wiki/Charybdotoxin A molecular chain compound composed of two or more amino acids joined by peptide bonds that in its endogenous state is produced in one part or organ of the body and initiates or regulates the activity of an organ or a group of cells in another part of the body. JSmith 2012-10-15T04:30:11Z experimental_condition_ontology XCO:0000228 peptide hormone A molecular chain compound composed of two or more amino acids joined by peptide bonds that in its endogenous state is produced in one part or organ of the body and initiates or regulates the activity of an organ or a group of cells in another part of the body. Mosby:Mosbys_Medical_Dictionary--8th_Ed A condition in which the main influencing factor is a chemical substance the structure of which is based on the basic 17-carbon-atom ring system steroid nucleus but may or may not have the characteristic arrangement of four fused cycloalkane rings, and which is produced in its endogenous state by an organ, cells of an organ or scattered cells, having a specific regulatory affect on the activity of an organ or tissue. JSmith 2012-10-15T04:36:54Z CHEBI:26764 experimental_condition_ontology XCO:0000229 steroid hormone A condition in which the main influencing factor is a chemical substance the structure of which is based on the basic 17-carbon-atom ring system steroid nucleus but may or may not have the characteristic arrangement of four fused cycloalkane rings, and which is produced in its endogenous state by an organ, cells of an organ or scattered cells, having a specific regulatory affect on the activity of an organ or tissue. CHEBI:35341 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A chemical substance consisting of an amine compound which contains one amino group and was derived from an aromatic amino acid, that in its endogenous state is produced in one part or organ of the body and initiates or regulates the activity of an organ or a group of cells in another part of the body. JSmith 2012-10-15T04:51:18Z experimental_condition_ontology XCO:0000230 monoamine hormone A chemical substance consisting of an amine compound which contains one amino group and was derived from an aromatic amino acid, that in its endogenous state is produced in one part or organ of the body and initiates or regulates the activity of an organ or a group of cells in another part of the body. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Antibody directed against the RT6.1 cell surface alloantigen (also known as ART2, Pta.A2, and Ag-F1). RT6.1 is an allelic form of the RT6 antigen which is expressed on most peripheral T cells but not on thymocytes. JSmith 2012-10-16T12:39:20Z Art2 antibody anti-ADP-ribosyltransferase 2 antibody experimental_condition_ontology DS4.23 mAb anti-Art2.1 mAb XCO:0000231 anti-RT6.1 antibody Antibody directed against the RT6.1 cell surface alloantigen (also known as ART2, Pta.A2, and Ag-F1). RT6.1 is an allelic form of the RT6 antigen which is expressed on most peripheral T cells but not on thymocytes. PMID:7559400 A high-molecular-weight polymeric compound composed of nucleotides, each consisting of a purine or pyrimidine base, a ribose or deoxyribose sugar, and a phosphate group. JSmith 2012-10-16T01:26:26Z experimental_condition_ontology XCO:0000232 nucleic acid A high-molecular-weight polymeric compound composed of nucleotides, each consisting of a purine or pyrimidine base, a ribose or deoxyribose sugar, and a phosphate group. Mosby:Mosbys_Medical_Dictionary--8th_Ed A long, polymeric chain of alternating phosphate and ribose units with the bases adenine, guanine, cytosine, and uracil bonded to the ribose. Although RNA is usually single-stranded it can also exist as RNA:RNA or RNA:DNA double-stranded molecules. JSmith 2012-10-16T02:15:23Z RNA experimental_condition_ontology XCO:0000233 ribonucleic acid A long, polymeric chain of alternating phosphate and ribose units with the bases adenine, guanine, cytosine, and uracil bonded to the ribose. Although RNA is usually single-stranded it can also exist as RNA:RNA or RNA:DNA double-stranded molecules. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed A long, polymeric chain of alternating phosphate and deoxyribose units with the bases adenine, guanine, cytosine, and thymine bonded to the deoxyribose. DNA can be single stranded or double stranded, that is, composed of either a single polymer or a pair of antiparallel polymers joined by hydrogen bonding between complementary bases. JSmith 2012-10-16T02:22:54Z DNA experimental_condition_ontology XCO:0000234 deoxyribonucleic acid A long, polymeric chain of alternating phosphate and deoxyribose units with the bases adenine, guanine, cytosine, and thymine bonded to the deoxyribose. DNA can be single stranded or double stranded, that is, composed of either a single polymer or a pair of antiparallel polymers joined by hydrogen bonding between complementary bases. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed This is any condition in which the main influencing factor is poly I:C, a synthetic dsRNA composed of a strand of poly(I) annealed to a strand of poly(C). Poly(I:C) is acts as an immunostimulant and mimics a viral infection by interacting with Toll-like receptor 3 (TLR3). JSmith 2012-10-16T02:34:34Z Poly(I:C) dsRNA Polyinosinic:polycytidylic acid dsRNA poly(I:C) poly(I:C) polyinosine-polycytidylic acid experimental_condition_ontology XCO:0000235 poly I:C This is any condition in which the main influencing factor is poly I:C, a synthetic dsRNA composed of a strand of poly(I) annealed to a strand of poly(C). Poly(I:C) is acts as an immunostimulant and mimics a viral infection by interacting with Toll-like receptor 3 (TLR3). http://www.invivogen.com/tlr3-ligands?gclid=CLDYv5u4wLICFahaMgod_H8AGg An biological agent that causes disease, especially a living microorganism such as a bacterium, virus, or fungus. JSmith 2012-10-16T03:04:11Z experimental_condition_ontology XCO:0000236 pathogen An biological agent that causes disease, especially a living microorganism such as a bacterium, virus, or fungus. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 A virus which has the potential to cause disease. A virus is one of a group of heterogeneous infective agents characterized by their lack of independent metabolism, their inability to replicate outside a host cell, their simple organization and their unique mode of replication. A virus consists of genetic material--either DNA or RNA--surrounded by a protein coat and, in some cases, by a membranous envelope. JSmith 2012-10-16T03:06:55Z virus experimental_condition_ontology XCO:0000237 viral pathogen A virus which has the potential to cause disease. A virus is one of a group of heterogeneous infective agents characterized by their lack of independent metabolism, their inability to replicate outside a host cell, their simple organization and their unique mode of replication. A virus consists of genetic material--either DNA or RNA--surrounded by a protein coat and, in some cases, by a membranous envelope. Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed A common parvovirus pathogen which causes largely asymptomatic infections in rats. KRV can be used to model environmental influences in the development of type 1 diabetes mellitus. JSmith 2012-10-16T03:20:45Z experimental_condition_ontology KRV XCO:0000238 Kilham rat virus A common parvovirus pathogen which causes largely asymptomatic infections in rats. KRV can be used to model environmental influences in the development of type 1 diabetes mellitus. PMID:19720792 http://www.criver.com/SiteCollectionDocuments/rm_ld_r_Rat_Parvoviruses.pdf A chemical or biological substance which is capable of causing illness, debilitation or death, to living organisms, tissues or cells. JSmith 2012-10-16T03:57:33Z experimental_condition_ontology poison toxic chemical XCO:0000239 toxic substance A chemical or biological substance which is capable of causing illness, debilitation or death, to living organisms, tissues or cells. Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed This is any condition in which the main influencing factor is a toxin, a noxious or poisonous substance produced by a biological organism such as a microbe, animal or plant. JSmith 2012-10-16T04:07:55Z biotoxin experimental_condition_ontology XCO:0000240 toxin This is any condition in which the main influencing factor is a toxin, a noxious or poisonous substance produced by a biological organism such as a microbe, animal or plant. ISBN:978-1416049982 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is streptozotocin, a naturally occurring chemical that is particularly toxic to the insulin-producing beta cells of the pancreas in mammals. STZ can be used to treat pancreatic islet cell cancers and to model type 1 diabetes mellitus in animals via destruction of the insulin-producing beta cells of the islets of Langerhans. JSmith 2012-10-16T04:09:16Z CHEBI:9288 STZ streptozocin experimental_condition_ontology XCO:0000241 streptozotocin This is any condition in which the main influencing factor is streptozotocin, a naturally occurring chemical that is particularly toxic to the insulin-producing beta cells of the pancreas in mammals. STZ can be used to treat pancreatic islet cell cancers and to model type 1 diabetes mellitus in animals via destruction of the insulin-producing beta cells of the islets of Langerhans. http://en.wikipedia.org/wiki/Streptozotocin A condition in which the main influencing factor is alloxan, an oxygenated pyrimidine derivative which is toxic to the pancreatic insulin-producing beta cells of the islets of Langerhans in rodents and other animals and can therefore be used for modeling type 1 diabetes mellitus through destruction of the beta cells. JSmith 2012-10-16T04:29:35Z pubchem.compound:5781 2,4,5,6-pyrimidinetetrone 5-Oxobarbituric acid alloxane mesoxalylurea experimental_condition_ontology XCO:0000242 alloxan A condition in which the main influencing factor is alloxan, an oxygenated pyrimidine derivative which is toxic to the pancreatic insulin-producing beta cells of the islets of Langerhans in rodents and other animals and can therefore be used for modeling type 1 diabetes mellitus through destruction of the beta cells. http://en.wikipedia.org/wiki/Alloxan Surgical removal of a portion of the pancreas, resulting in reduction but not elimination of the physiological functions of the pancreas. JSmith 2012-10-16T04:49:10Z experimental_condition_ontology subtotal pancreatectomy XCO:0000243 partial pancreatectomy Surgical removal of a portion of the pancreas, resulting in reduction but not elimination of the physiological functions of the pancreas. Gale:Gale_Encyclopedia_of_Medicine A solid diet in which the amount of fructose, the monosaccharide found in honey and many sweet fruits which chemically combines with glucose to form the disaccharide sucrose, is maintained at a specified level. JSmith 2012-10-16T05:00:17Z experimental_condition_ontology XCO:0000244 controlled fructose content diet A solid diet in which the amount of fructose, the monosaccharide found in honey and many sweet fruits which chemically combines with glucose to form the disaccharide sucrose, is maintained at a specified level. Mosby:Mosbys_Medical_Dictionary--8th_Ed A protein hormone formed from proinsulin in the beta cells of the pancreatic islets of Langerhans. The major fuel-regulating hormone, it is secreted into the blood in response to a rise in concentration of blood glucose or amino acids. Insulin promotes the storage of glucose and the uptake of amino acids, increases protein and lipid synthesis, and inhibits lipolysis and gluconeogenesis. JSmith 2012-10-16T05:04:48Z experimental_condition_ontology XCO:0000245 insulin A protein hormone formed from proinsulin in the beta cells of the pancreatic islets of Langerhans. The major fuel-regulating hormone, it is secreted into the blood in response to a rise in concentration of blood glucose or amino acids. Insulin promotes the storage of glucose and the uptake of amino acids, increases protein and lipid synthesis, and inhibits lipolysis and gluconeogenesis. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A regimen of solid food in which the amount of cholesterol, a steroid alcohol found in animal fats and oils, is controlled. JSmith 2012-11-30T15:42:17Z experimental_condition_ontology XCO:0000246 controlled cholesterol content diet A regimen of solid food in which the amount of cholesterol, a steroid alcohol found in animal fats and oils, is controlled. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed A regimen of solid food to which a specified amount of olive oil has been added. JSmith 2012-11-30T15:44:29Z experimental_condition_ontology XCO:0000247 controlled olive oil content diet A regimen of solid food to which a specified amount of olive oil has been added. RGD:JRS A surgical procedure in which one or both kidneys from a donor organism are implanted into a recipient organism. JSmith 2012-11-30T15:46:26Z kidney transplantation experimental_condition_ontology XCO:0000248 kidney transplant A surgical procedure in which one or both kidneys from a donor organism are implanted into a recipient organism. Gale:Gale_Encyclopedia_of_Medicine A surgical procedure in which the left kidney from a donor organism is implanted into a recipient organism. JSmith 2012-11-30T15:51:17Z experimental_condition_ontology XCO:0000249 left kidney transplant A surgical procedure in which the left kidney from a donor organism is implanted into a recipient organism. Gale:Gale_Encyclopedia_of_Medicine A surgical procedure in which the right kidney from a donor organism is implanted into a recipient organism. JSmith 2012-11-30T15:53:04Z experimental_condition_ontology XCO:0000250 right kidney transplant A surgical procedure in which the right kidney from a donor organism is implanted into a recipient organism. Gale:Gale_Encyclopedia_of_Medicine Any agent that induces exocrine, endocrine, or paracrine secretion. JSmith 2012-11-30T15:55:11Z experimental_condition_ontology XCO:0000251 secretagogue Any agent that induces exocrine, endocrine, or paracrine secretion. Mosby:Mosbys_Medical_Dictionary--8th_Ed A first generation potassium channel blocker and sulfonylurea oral hypoglycemic drug which stimulates the secretion of insulin by the pancreas. JSmith 2012-11-30T15:56:41Z experimental_condition_ontology XCO:0000252 tolbutamide A first generation potassium channel blocker and sulfonylurea oral hypoglycemic drug which stimulates the secretion of insulin by the pancreas. http://en.wikipedia.org/wiki/Tolbutamide This is any condition in which the main influencing factor is an ion of sodium, the chemical element with atomic number 11, that has lost one electron, forming a cation with a charge of +1. JSmith 2013-02-28T13:11:25Z CHEBI:29101 Na+ ion experimental_condition_ontology XCO:0000253 Not used for sodium salt in animal feed. For that application XCO:0000022, "controlled sodium content diet" is used. sodium ion This is any condition in which the main influencing factor is an ion of sodium, the chemical element with atomic number 11, that has lost one electron, forming a cation with a charge of +1. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the main influencing factor is a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron, forming a cation with a charge of +1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. JSmith 2013-02-28T18:54:08Z CHEBI:29101 Na+ ion solution experimental_condition_ontology XCO:0000254 sodium ion solution A condition in which the main influencing factor is a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron, forming a cation with a charge of +1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 An immunoglobulin molecule or a preparation of multiple antibody molecules having specific amino acid sequences with the ability to adhere to and interact specifically with one or more components of the structure located between endothelial cells of renal capillaries and the visceral epithelial cells of the kidney glomerulus. JSmith 2013-03-01T11:49:57Z experimental_condition_ontology anti-GBM antibody nephritogenic monoclonal antibody b35 XCO:0000255 anti-glomerular basement membrane antibody An immunoglobulin molecule or a preparation of multiple antibody molecules having specific amino acid sequences with the ability to adhere to and interact specifically with one or more components of the structure located between endothelial cells of renal capillaries and the visceral epithelial cells of the kidney glomerulus. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed A drug which is structurally similar to epinephrine and that binds to beta-adrenergic receptors to produce a physiologic reaction similar to or the same as that of epinephrine. JSmith 2013-03-01T12:37:50Z CHEBI:64317 isoprenaline experimental_condition_ontology XCO:0000256 isoproterenol A drug which is structurally similar to epinephrine and that binds to beta-adrenergic receptors to produce a physiologic reaction similar to or the same as that of epinephrine. http://en.wikipedia.org/wiki/Isoprenaline#Chemistry A drink made up of water containing a specified amount of hydrogen ions, the chemical element with atomic number 1 that have lost one electron forming a cation with a charge of +1, for consumption by an organism in an experiment. Adjusting the amount of hydrogen ions adjusts the acidity, i.e. the pH of the drinking water. JSmith 2013-03-01T16:10:48Z experimental_condition_ontology controlled acidity water controlled pH water water with adjusted pH XCO:0000257 controlled hydrogen ion content drinking water A drink made up of water containing a specified amount of hydrogen ions, the chemical element with atomic number 1 that have lost one electron forming a cation with a charge of +1, for consumption by an organism in an experiment. Adjusting the amount of hydrogen ions adjusts the acidity, i.e. the pH of the drinking water. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed Any phenomenon, chemical or biologic substance, or organism that exerts some force or effect resulting in a deviation from or interruption of the normal structure or function of any body part, organ, or system that is manifested by a characteristic set of symptoms and signs. JSmith 2013-03-01T16:24:26Z disease inducing agent experimental_condition_ontology XCO:0000258 disease-inducing agent Any phenomenon, chemical or biologic substance, or organism that exerts some force or effect resulting in a deviation from or interruption of the normal structure or function of any body part, organ, or system that is manifested by a characteristic set of symptoms and signs. Collins:Collins_Online_English_Dictionary Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules that exerts some force or effect resulting in a deviation from or interruption of the normal structure or function of any body part, organ, or system that is manifested by a characteristic set of symptoms and signs. JSmith 2013-03-01T16:30:57Z disease inducing chemical experimental_condition_ontology XCO:0000259 disease-inducing chemical A substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules that exerts some force or effect resulting in a deviation from or interruption of the normal structure or function of any body part, organ, or system that is manifested by a characteristic set of symptoms and signs. American_Heritage:The_American_Heritage_Science_Dictionary_2005 Collins:Collins_Online_English_Dictionary Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the major influencing factor is a peptide or protein, that is, any of a group of complex organic compounds containing carbon, hydrogen, oxygen, nitrogen, and sulfur consisting of alpha-amino acids joined by peptide linkages, capable of inducing a specific localized and/or systemic immune response. JSmith 2013-03-01T16:46:02Z antigenic protein experimental_condition_ontology XCO:0000260 peptide/protein antigen A condition in which the major influencing factor is a peptide or protein, that is, any of a group of complex organic compounds containing carbon, hydrogen, oxygen, nitrogen, and sulfur consisting of alpha-amino acids joined by peptide linkages, capable of inducing a specific localized and/or systemic immune response. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed A substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules that, when administered, results in the inflammation of one or more joints, the sites of junction or union between bones, especially those that allow motion of the bones. JSmith 2013-03-01T17:07:13Z experimental_condition_ontology XCO:0000261 arthritis inducing chemical A substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules that, when administered, results in the inflammation of one or more joints, the sites of junction or union between bones, especially those that allow motion of the bones. Collins:Collins_Online_English_Dictionary Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the major influencing factor is any of a family of extracellular, closely related proteins occurring as a major component of connective tissue, giving it strength and flexibility; composed of molecules of tropocollagen. JSmith 2013-03-01T17:35:20Z experimental_condition_ontology XCO:0000262 collagen A condition in which the major influencing factor is any of a family of extracellular, closely related proteins occurring as a major component of connective tissue, giving it strength and flexibility; composed of molecules of tropocollagen. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition in which the main influencing factor is pristane, an acyclic saturated hydrocarbon derived from phytane by loss of its C-16 terminal methyl group. Pristane has a role as a biomarker and an immunological adjuvant. It is a norterpene and a long-chain alkane. JSmith 2013-03-01T17:39:39Z CHEBI:53181 MESH:C009042 2,6,10,14-tetramethylpentadecane experimental_condition_ontology XCO:0000263 pristane A nonspecific stimulator of the immune response consisting of non-metabolizable oils used to make water-in-oil emulsions with specific antigens. The adjuvant increases the strength of the immune response. JSmith 2013-03-01T18:05:06Z experimental_condition_ontology XCO:0000264 Freund's adjuvant A nonspecific stimulator of the immune response consisting of non-metabolizable oils used to make water-in-oil emulsions with specific antigens. The adjuvant increases the strength of the immune response. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 https://www.invivogen.com/ifa IFA is used to make a water-in-oil antigen-containing emulsion that lacks the Mycobacteria found in Complete Freund&#8242;s Adjuvant so it minimizes the side-effects. It is routinely used for boosting immunizations subsequent to use of Freund's complete adjuvant. JSmith 2013-03-01T18:07:25Z experimental_condition_ontology FIA IFA XCO:0000265 Freund's incomplete adjuvant IFA is used to make a water-in-oil antigen-containing emulsion that lacks the Mycobacteria found in Complete Freund&#8242;s Adjuvant so it minimizes the side-effects. It is routinely used for boosting immunizations subsequent to use of Freund's complete adjuvant. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 https://www.sigmaaldrich.com/catalog/product/sigma/f5506?lang=en&region=US A water-in-oil emulsion incorporating antigen in the aqueous phase, and killed, dried mycobacteria, e.g., Mycobacterium butyricum in lightweight paraffin oil. A suspension is achieved with the aid of an emulsifying agent. The mixture induces both cell-mediated immunity (delayed hypersensitivity), and humoral antibody formation. JSmith 2013-03-01T18:10:14Z experimental_condition_ontology CFA FCA XCO:0000266 Freund's complete adjuvant A water-in-oil emulsion incorporating antigen in the aqueous phase, and killed, dried mycobacteria, e.g., Mycobacterium butyricum in lightweight paraffin oil. A suspension is achieved with the aid of an emulsifying agent. The mixture induces both cell-mediated immunity (delayed hypersensitivity), and humoral antibody formation. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the major influencing factor is a polymer found in the cell walls of prokaryotes that consists of polysaccharide and peptide chains in a strong molecular network. JSmith 2013-03-11T15:53:57Z CHEBI:8005 experimental_condition_ontology PG-PS XCO:0000267 peptidoglycan-polysaccharide A condition in which the major influencing factor is a polymer found in the cell walls of prokaryotes that consists of polysaccharide and peptide chains in a strong molecular network. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 A technique of mechanically widening narrowed or obstructed arteries by use of a soft catheter with an inflatable tip. JSmith 2013-03-11T16:14:44Z experimental_condition_ontology XCO:0000268 balloon angioplasty A technique of mechanically widening narrowed or obstructed arteries by use of a soft catheter with an inflatable tip. http://en.wikipedia.org/wiki/Balloon_angioplasty This is any condition in which the main influencing factor is any chemical substance which decreases or interferes with the activity of a calcium channel, one or more membrane-bound globular proteins that display selective permeability to calcium ions, the chemical element with atomic number 20 that has lost two electrons forming a cation with a charge of +2, and allow diffusion of these ions across a cell membrane. JSmith 2013-03-11T16:37:02Z calcium channel blocker experimental_condition_ontology XCO:0000269 calcium channel inhibitor This is any condition in which the main influencing factor is any chemical substance which decreases or interferes with the activity of a calcium channel, one or more membrane-bound globular proteins that display selective permeability to calcium ions, the chemical element with atomic number 20 that has lost two electrons forming a cation with a charge of +2, and allow diffusion of these ions across a cell membrane. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed A sulfur-containing carboxylic acid with a pyrrolidine substituent at C-1, which decreases or interferes with the activity of angiotensin converting enzyme (ACE) inhibitor, used as an anti-hypertensive drug. JSmith 2013-03-11T16:51:57Z CHEBI:3380 experimental_condition_ontology XCO:0000270 captopril A sulfur-containing carboxylic acid with a pyrrolidine substituent at C-1, which decreases or interferes with the activity of angiotensin converting enzyme (ACE) inhibitor, used as an anti-hypertensive drug. http://en.wikipedia.org/wiki/Captopril A substance that opposes oxidation, a reaction in which the atoms in an element lose electrons, and/or inhibits reactions brought about by dioxygen or peroxides. JSmith 2013-03-12T11:01:04Z antioxydant antoxidant experimental_condition_ontology XCO:0000271 antioxidant A substance that opposes oxidation, a reaction in which the atoms in an element lose electrons, and/or inhibits reactions brought about by dioxygen or peroxides. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed CHEBI:22586 A heterocyclic compound used as an agent for detoxifying reactive oxygen species. It catalyses the disproportionation of superoxide. JSmith 2013-03-12T11:09:12Z pubchem.compound:137994 experimental_condition_ontology 4-Oxypiperidol 4-hydroxy-2,2,6,6-tetramethylpiperidin-1-oxyl HyTEMPO Nitroxyl-2 TMPN Tanol XCO:0000272 tempol A heterocyclic compound used as an agent for detoxifying reactive oxygen species. It catalyses the disproportionation of superoxide. http://en.wikipedia.org/wiki/4-Hydroxy-TEMPO A family of linear, sulfated, high-molecular-weight polysaccharides made up of repeating galactose and 3,6-anhydrogalactose units with alternating alpha 1-3 and beta 1-4 glycosidic linkages. JSmith 2013-03-12T13:07:06Z CHEBI:3435 experimental_condition_ontology XCO:0000273 carrageenan A family of linear, sulfated, high-molecular-weight polysaccharides made up of repeating galactose and 3,6-anhydrogalactose units with alternating alpha 1-3 and beta 1-4 glycosidic linkages. http://en.wikipedia.org/wiki/Carrageenan Any simple carbohydrate consisting of a single basic sugar unit with the general formula Cn(H2O)n, with n ranging from 3 to 8. JSmith 2013-03-12T13:10:01Z experimental_condition_ontology XCO:0000274 monosaccharide Any simple carbohydrate consisting of a single basic sugar unit with the general formula Cn(H2O)n, with n ranging from 3 to 8. Mosby:Mosbys_Medical_Dictionary--8th_Ed A monosaccharide sugar, C6H12O6, occurring widely in plant and animal tissues. It is one of the three dietary monosaccharides, along with fructose and galactose, that are absorbed directly into the bloodstream during digestion, is the end product of carbohydrate metabolism, and is the chief source of energy for living organisms. JSmith 2013-03-12T13:28:39Z dextrose experimental_condition_ontology XCO:0000275 glucose A monosaccharide sugar, C6H12O6, occurring widely in plant and animal tissues. It is one of the three dietary monosaccharides, along with fructose and galactose, that are absorbed directly into the bloodstream during digestion, is the end product of carbohydrate metabolism, and is the chief source of energy for living organisms. http://www.thefreedictionary.com/ Any of a large group of organic compounds whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12. JSmith 2013-03-12T16:18:50Z experimental_condition_ontology XCO:0000276 hydrocarbon Any of a large group of organic compounds whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12. Mosby:Mosbys_Medical_Dictionary--8th_Ed Any organic compound whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, and whose carbon atoms form a continuous or closed chain linked by bonds that may be represented graphically by one or more circular or triangular forms. JSmith 2013-03-12T17:18:43Z experimental_condition_ontology XCO:0000277 cyclic hydrocarbon Any organic compound whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, and whose carbon atoms form a continuous or closed chain linked by bonds that may be represented graphically by one or more circular or triangular forms. http://www.thefreedictionary.com/ Any organic compound whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, and whose carbon atoms form continuous or closed chains linked by bonds that may be represented graphically by multiple interlinking circular or triangular forms. JSmith 2013-03-12T17:20:06Z experimental_condition_ontology XCO:0000278 polycyclic hydrocarbon Any organic compound whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, and whose carbon atoms form continuous or closed chains linked by bonds that may be represented graphically by multiple interlinking circular or triangular forms. http://www.thefreedictionary.com/ Any of a large and diverse class of organic compounds which are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, which are derived biosynthetically from units of isoprene and which have the general molecular formula (CH2=C(CH3)CH=CH2)n where n is the number of linked isoprene units. JSmith 2013-03-12T17:24:22Z experimental_condition_ontology XCO:0000279 terpene Any of a large and diverse class of organic compounds which are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, which are derived biosynthetically from units of isoprene and which have the general molecular formula (CH2=C(CH3)CH=CH2)n where n is the number of linked isoprene units. http://en.wikipedia.org/wiki/Terpene A triterpene, that is a terpine containing six isoprene units, consisting of 2,6,10,15,19,23-hexamethyltetracosane having six double bonds at the 2-, 6-, 10-, 14-, 18- and 22-positions with (all-E)-configuration. Squalene is the biochemical precursor to steroids. JSmith 2013-03-12T17:25:17Z CHEBI:15440 MESH:D013185 experimental_condition_ontology Spinacene Supraene XCO:0000280 squalene A triterpene, that is a terpine containing six isoprene units, consisting of 2,6,10,15,19,23-hexamethyltetracosane having six double bonds at the 2-, 6-, 10-, 14-, 18- and 22-positions with (all-E)-configuration. Squalene is the biochemical precursor to steroids. http://en.wikipedia.org/wiki/Squalene A condition in which the major influencing factor is the fibrillar collagen which comprises the main component of cartilage and is also found in the vitreous humor of the eye. Collagens are a family of extracellular, closely related proteins occurring as a major component of connective tissue, giving it strength and flexibility. JSmith 2013-03-12T17:41:57Z type 2 collagen experimental_condition_ontology XCO:0000281 type II collagen A condition in which the major influencing factor is the fibrillar collagen which comprises the main component of cartilage and is also found in the vitreous humor of the eye. Collagens are a family of extracellular, closely related proteins occurring as a major component of connective tissue, giving it strength and flexibility. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Collagen An immunoglobulin molecule having a specific amino acid sequence that gives it the ability to adhere to and interact only with Thy1, i.e. Thymocyte antigen 1, and molecules containing structures similar to that antigen. Thy1, also known as CD90, is a 25-37 kDa, heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored, conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen and now known to be the smallest member of the immunoglobulin superfamily of proteins. JSmith 2013-03-12T18:06:13Z anti-CD90 antibody experimental_condition_ontology XCO:0000282 anti-Thy1 antibody An immunoglobulin molecule having a specific amino acid sequence that gives it the ability to adhere to and interact only with Thy1, i.e. Thymocyte antigen 1, and molecules containing structures similar to that antigen. Thy1, also known as CD90, is a 25-37 kDa, heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored, conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen and now known to be the smallest member of the immunoglobulin superfamily of proteins. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed http://en.wikipedia.org/wiki/CD90 Exposure to visible light in a manner, such as for a length of time or at a level, which would not be considered natural, usual or environmental and which is designed to elicit or evoke an action or response in a cell, an excitable tissue, or an organism. JSmith 2013-03-13T12:03:39Z light therapy phototherapy experimental_condition_ontology XCO:0000283 visible light stimulus Exposure to visible light in a manner, such as for a length of time or at a level, which would not be considered natural, usual or environmental and which is designed to elicit or evoke an action or response in a cell, an excitable tissue, or an organism. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed Condition during which a subject or sample is directly in the presence of or influenced by visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, at a constrained level and/or for a constrained period of time. JSmith 2013-03-13T12:12:45Z experimental_condition_ontology XCO:0000284 controlled visible light exposure Condition during which a subject or sample is directly in the presence of or influenced by visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, at a constrained level and/or for a constrained period of time. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed A drink made up of water and a specified amount of the basic amino acid commonly known as L-NAME and used as a non-selective inhibitor of nitric oxide synthase, consumed by an organism as part of an experiment. JSmith 2013-03-13T14:48:31Z controlled L-NAME content drinking water experimental_condition_ontology XCO:0000285 controlled NG-nitroarginine methyl ester content drinking water A drink made up of water and a specified amount of the basic amino acid commonly known as L-NAME and used as a non-selective inhibitor of nitric oxide synthase, consumed by an organism as part of an experiment. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 MESH:D019331 A condition in which the major influencing factor is a highly antigenic, soluble photoreceptor protein expressed in the retina and the pineal gland and involved in desensitization of the photoactivated transduction cascade. JSmith 2013-03-13T17:02:20Z arrestin experimental_condition_ontology HSAg S-antigen S-antigen peptide S-arrestin SAG retinal soluble antigen XCO:0000286 retinal S-antigen A condition in which the major influencing factor is a highly antigenic, soluble photoreceptor protein expressed in the retina and the pineal gland and involved in desensitization of the photoactivated transduction cascade. NCBI_GeneID:6295 A condition in which the major influencing factor is a large glycoprotein, found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells, which is known to bind retinoids and thought to transport them between the retinal pigment epithelium and the photoreceptors. JSmith 2013-03-13T17:19:56Z interphotoreceptor retinol-binding protein retinol binding protein 3, interstitial experimental_condition_ontology IRBP Rbp3 XCO:0000287 interphotoreceptor retinoid-binding protein A condition in which the major influencing factor is a large glycoprotein, found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells, which is known to bind retinoids and thought to transport them between the retinal pigment epithelium and the photoreceptors. NCBI_GeneID:5949 A condition in which the major influencing factor is a 15 amino acid peptide (aa 1177-1191) derived from the interphotoreceptor retinoid-binding protein, a large glycoprotein, found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells, which is known to bind retinoids and thought to transport them between the retinal pigment epithelium and the photoreceptors. JSmith 2013-03-13T17:55:10Z PMID:10323205 experimental_condition_ontology R16 peptide of IRBP XCO:0000288 R16 peptide of interphotoreceptor retinoid-binding protein A condition in which the major influencing factor is a 15 amino acid peptide (aa 1177-1191) derived from the interphotoreceptor retinoid-binding protein, a large glycoprotein, found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells, which is known to bind retinoids and thought to transport them between the retinal pigment epithelium and the photoreceptors. NCBI_GeneID:5949 A condition in which the major influencing factor is a 23 amino acid peptide (aa 1169-1191) derived from the interphotoreceptor retinoid-binding protein, a large glycoprotein, found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells, which is known to bind retinoids and thought to transport them between the retinal pigment epithelium and the photoreceptors. JSmith 2013-03-13T17:56:51Z PMID:18203685 experimental_condition_ontology R14 peptide of IRBP XCO:0000289 R14 peptide of interphotoreceptor retinoid-binding protein A condition in which the major influencing factor is a 23 amino acid peptide (aa 1169-1191) derived from the interphotoreceptor retinoid-binding protein, a large glycoprotein, found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells, which is known to bind retinoids and thought to transport them between the retinal pigment epithelium and the photoreceptors. NCBI_GeneID:5949 A condition in which the major influencing factor is a fatty acid and cholesterol binding protein which together with myelin basic protein constitutes a major fraction of the peripheral nervous system myelin proteins. JSmith 2013-03-13T18:21:29Z RGD:1585218 myelin P2 protein experimental_condition_ontology Pmp2 XCO:0000290 peripheral myelin protein 2 A condition in which the major influencing factor is a fatty acid and cholesterol binding protein which together with myelin basic protein constitutes a major fraction of the peripheral nervous system myelin proteins. UniProtKB:P02689 A condition in which the major influencing factor is the peptide (KNTEISFKLGQEFEETTADNRKTK) representing residues 58 to 81 of peripheral myelin protein 2, a fatty acid and cholesterol binding protein which together with myelin basic protein constitutes a major fraction of the peripheral nervous system myelin proteins. JSmith 2013-03-13T18:44:21Z experimental_condition_ontology P2 58-81 P2 peptide 58-81 XCO:0000291 peripheral myelin protein 2 peptide 58-81 A condition in which the major influencing factor is the peptide (KNTEISFKLGQEFEETTADNRKTK) representing residues 58 to 81 of peripheral myelin protein 2, a fatty acid and cholesterol binding protein which together with myelin basic protein constitutes a major fraction of the peripheral nervous system myelin proteins. RGD:2306736 UniProtKB:P02689 A condition in which the major influencing factor is peripheral nerve myelin, a lipoproteinaceous substance largely composed of phospholipids and proteins, which forms the sheaths surrounding the axons of peripheral nerves, that is, nerves that are not part of either the brain or spinal cord of the organism. JSmith 2013-03-13T19:18:05Z experimental_condition_ontology PNM PNS myelin peripheral nervous system myelin XCO:0000292 peripheral nerve myelin A condition in which the major influencing factor is peripheral nerve myelin, a lipoproteinaceous substance largely composed of phospholipids and proteins, which forms the sheaths surrounding the axons of peripheral nerves, that is, nerves that are not part of either the brain or spinal cord of the organism. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed A coordination complex of technetium-99m, a radioisotope of the chemical element technetium, atomic number 43, a gamma emitter having a half-life of approximately 6 hours, and methoxyisobutylisonitrile (MIBI), a lipophilic cation, used as an agent in nuclear medicine imaging. JSmith 2013-03-13T20:07:09Z CHEBI:33371 experimental_condition_ontology 99mTc-hexakis-2-methoxy-2-methylpropyl isonitrile Cardiolite MIBI XCO:0000293 99mTc-sestamibi A coordination complex of technetium-99m, a radioisotope of the chemical element technetium, atomic number 43, a gamma emitter having a half-life of approximately 6 hours, and methoxyisobutylisonitrile (MIBI), a lipophilic cation, used as an agent in nuclear medicine imaging. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Technetium_%2899mTc%29_sestamibi Any of the naturally-occuring, primary female sex hormones or related synthetic molecules with the capacity to perform the same function(s), i.e. to bind to estrogen receptors and stimulate or control the development and maintenance of female sex characteristics. JSmith 2013-05-07T15:32:52Z CHEBI:50114 experimental_condition_ontology Not4Curation XCO:0000294 estrogen/estrogen analog Any of the naturally-occuring, primary female sex hormones or related synthetic molecules with the capacity to perform the same function(s), i.e. to bind to estrogen receptors and stimulate or control the development and maintenance of female sex characteristics. http://en.wikipedia.org/wiki/Estrogen A synthetic estrogen analog with chemical formula C18H20O2. The structure is similar to that of estrogen but lacks the complete four ring structure. As a drug it is used to treat prostatic and sometimes breast carcinomas. It is an epigenetic carcinogen. JSmith 2013-05-07T16:01:13Z CHEBI:41922 experimental_condition_ontology DES XCO:0000295 diethylstilbestrol A synthetic estrogen analog with chemical formula C18H20O2. The structure is similar to that of estrogen but lacks the complete four ring structure. As a drug it is used to treat prostatic and sometimes breast carcinomas. It is an epigenetic carcinogen. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Diethylstilbestrol The act of rapidly moving the feet on an exercise apparatus with an endless belt that allows the user to perform the action of running in place and that is maintained at an angle which deviates from the horozontal by a specified amount. JSmith 2013-06-07T16:08:44Z running on sloped treadmill experimental_condition_ontology XCO:0000296 running on inclined treadmill The act of rapidly moving the feet on an exercise apparatus with an endless belt that allows the user to perform the action of running in place and that is maintained at an angle which deviates from the horozontal by a specified amount. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed Encarta:Encarta_World_English_Dictionary Condition in which liquids for drinking (bringing a liquid into the mouth and swallowing it to quench thirst, for nourishment, etc.), such as water, are withheld for a specified period of time. JSmith 2013-06-11T09:50:38Z water deprivation experimental_condition_ontology XCO:0000297 fluid deprivation Condition in which liquids for drinking (bringing a liquid into the mouth and swallowing it to quench thirst, for nourishment, etc.), such as water, are withheld for a specified period of time. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 http://www.yourdictionary.com/drink Water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O) supplied as a drink, that is, as a liquid to be brought into the mouth and swallowed to quench thirst, for nourishment, etc., in which the amount of saccharin, a cyclic imine of 2-sulfobenzoic acid which is 500 times sweeter than sugar and used as a nonnutritive sweetener, is adjusted to a requirement. JSmith 2013-06-11T10:05:25Z experimental_condition_ontology XCO:0000298 controlled saccharin content drinking water Water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O) supplied as a drink, that is, as a liquid to be brought into the mouth and swallowed to quench thirst, for nourishment, etc., in which the amount of saccharin, a cyclic imine of 2-sulfobenzoic acid which is 500 times sweeter than sugar and used as a nonnutritive sweetener, is adjusted to a requirement. http://www.thefreedictionary.com/ Condition in which a drink, that is, a liquid to be brought into the mouth and swallowed to quench thirst, for nourishment, etc., made up of water and a specified amount of ethanol, the alcohol with chemical formula CH3-CH2-OH obtained from the fermentation of sugars and starches or by chemical synthesis which is the intoxicating ingredient of alcoholic beverages, is supplied as the only available drink option for consumption by an organism in an experiment. JSmith 2013-06-11T10:06:43Z experimental_condition_ontology XCO:0000299 controlled ethanol content drinking water with no other optional drink source Condition in which a drink, that is, a liquid to be brought into the mouth and swallowed to quench thirst, for nourishment, etc., made up of water and a specified amount of ethanol, the alcohol with chemical formula CH3-CH2-OH obtained from the fermentation of sugars and starches or by chemical synthesis which is the intoxicating ingredient of alcoholic beverages, is supplied as the only available drink option for consumption by an organism in an experiment. http://www.thefreedictionary.com/ Condition in which a drink, that is, a liquid to be brought into the mouth and swallowed to quench thirst, for nourishment, etc., made up of water and a specified amount of ethanol, the alcohol with chemical formula CH3-CH2-OH obtained from the fermentation of sugars and starches or by chemical synthesis which is the intoxicating ingredient of alcoholic beverages, is supplied along with additive-free water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O), as an additional drink option for consumption by an organism in an experiment. JSmith 2013-06-11T10:07:22Z experimental_condition_ontology XCO:0000300 controlled ethanol content drinking water with water as an optional drink source Condition in which a drink, that is, a liquid to be brought into the mouth and swallowed to quench thirst, for nourishment, etc., made up of water and a specified amount of ethanol, the alcohol with chemical formula CH3-CH2-OH obtained from the fermentation of sugars and starches or by chemical synthesis which is the intoxicating ingredient of alcoholic beverages, is supplied along with additive-free water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O), as an additional drink option for consumption by an organism in an experiment. http://www.thefreedictionary.com/ A condition in which the main influencing factor is a homogeneous mixture of atoms of lithium, the chemical element with atomic number 3, that have lost one electron, forming a cation with a charge of +1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. JSmith 2013-06-11T10:08:36Z CHEBI:49713 experimental_condition_ontology XCO:0000301 lithium ion solution A condition in which the main influencing factor is a homogeneous mixture of atoms of lithium, the chemical element with atomic number 3, that have lost one electron, forming a cation with a charge of +1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the main influencing factor is a homogeneous mixture of atoms of lithium, the chemical element with atomic number 3, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. JSmith 2013-06-11T10:09:05Z CHEBI:48607 experimental_condition_ontology XCO:0000302 lithium chloride solution A condition in which the main influencing factor is a homogeneous mixture of atoms of lithium, the chemical element with atomic number 3, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 The surgical excision of one or both of the adrenal glands, two small, dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine. JSmith 2013-06-20T17:37:01Z suprarenalectomy experimental_condition_ontology XCO:0000303 adrenalectomy The surgical excision of one or both of the adrenal glands, two small, dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 The surgical excision of both adrenal glands, two small, dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine. JSmith 2013-06-20T17:49:29Z bilateral suprarenalectomy experimental_condition_ontology XCO:0000304 bilateral adrenalectomy The surgical excision of both adrenal glands, two small, dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 The surgical excision of only one of the adrenal glands, two small, dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine. JSmith 2013-06-20T17:50:15Z unilateral suprarenalectomy experimental_condition_ontology XCO:0000305 unilateral adrenalectomy The surgical excision of only one of the adrenal glands, two small, dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 An activity or condition which involves subjecting all or part of an organism to a relatively low, i.e., lower than considered normal, temperature. JSmith 2013-06-21T16:31:04Z experimental_condition_ontology XCO:0000306 cold exposure An activity or condition which involves subjecting all or part of an organism to a relatively low, i.e., lower than considered normal, temperature. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed An activity or condition in which the air surrounding or encircling the organism has a relatively low, or lower than considered normal, temperature, i.e., air in which the molecules possess a lower than normal amount of random kinetic energy. JSmith 2013-06-21T16:52:48Z cold exposure, ambient air experimental_condition_ontology cold stress XCO:0000307 cold ambient air exposure An activity or condition in which the air surrounding or encircling the organism has a relatively low, or lower than considered normal, temperature, i.e., air in which the molecules possess a lower than normal amount of random kinetic energy. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed An activity or condition which involves subjecting all or part of an organism to a relatively high, or higher than considered normal, temperature, that is, possessing a higher than normal level of random kinetic energy of atoms, molecules, or ions. JSmith 2013-06-21T17:12:21Z experimental_condition_ontology XCO:0000308 heat exposure An activity or condition which involves subjecting all or part of an organism to a relatively high, or higher than considered normal, temperature, that is, possessing a higher than normal level of random kinetic energy of atoms, molecules, or ions. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed An activity or condition in which the air surrounding or encircling the organism or isolated organ has a relatively high, or higher than considered normal, temperature, i.e., air in which the molecules possess a higher than normal amount of random kinetic energy. JSmith 2013-06-21T17:21:42Z heat exposure, ambient air experimental_condition_ontology hot ambient air exposure warm ambient air exposure XCO:0000309 heated ambient air exposure An activity or condition in which the air surrounding or encircling the organism or isolated organ has a relatively high, or higher than considered normal, temperature, i.e., air in which the molecules possess a higher than normal amount of random kinetic energy. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed An antihypertensive agent that acts by selectively inhibiting transmission in post-ganglionic adrenergic nerves. It is believed to act mainly by preventing the release of norepinephrine at nerve endings and causes depletion of norepinephrine in peripheral sympathetic nerve terminals as well as in tissues. It does not appear to act at the level of the adrenergic receptors. JSmith 2013-06-21T18:45:16Z CHEBI:5557 MESH:D006145 experimental_condition_ontology XCO:0000310 guanethidine An antihypertensive agent that acts by selectively inhibiting transmission in post-ganglionic adrenergic nerves. It is believed to act mainly by preventing the release of norepinephrine at nerve endings and causes depletion of norepinephrine in peripheral sympathetic nerve terminals as well as in tissues. It does not appear to act at the level of the adrenergic receptors. http://www.drugbank.ca/drugs/DB01170#pharmacology A condition in which the main influencing factor is a homogeneous mixture of atoms of potassium, the chemical element with atomic number 19, that have lost one electron, forming a cation with a charge of +1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. JSmith 2013-06-25T14:02:51Z CHEBI:29103 K+ ion solution experimental_condition_ontology XCO:0000311 potassium ion solution A condition in which the main influencing factor is a homogeneous mixture of atoms of potassium, the chemical element with atomic number 19, that have lost one electron, forming a cation with a charge of +1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the main influencing factor is a homogeneous mixture of atoms of potassium, the chemical element with atomic number 19, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. JSmith 2013-06-25T14:06:24Z CHEBI:32588 KCl solution experimental_condition_ontology XCO:0000312 potassium chloride solution A condition in which the main influencing factor is a homogeneous mixture of atoms of potassium, the chemical element with atomic number 19, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the main influencing factor is an atom of lithium, the chemical element with atomic number 3, that has lost one electron, forming a cation with a charge of +1. JSmith 2013-06-25T14:24:21Z CHEBI:49713 Li+ ion experimental_condition_ontology XCO:0000313 lithium ion A condition in which the main influencing factor is an atom of lithium, the chemical element with atomic number 3, that has lost one electron, forming a cation with a charge of +1. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Any substance or mixture of substances that, in solution (typically aqueous), resists change in pH upon addition of small amounts of acid or base. JSmith 2013-06-25T14:52:26Z CHEBI:35225 experimental_condition_ontology XCO:0000314 buffer A homogeneous mixture of molecules, atoms and/or ions, one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. JSmith 2013-06-25T14:58:18Z CHEBI:35225 experimental_condition_ontology XCO:0000315 buffer solution A homogeneous mixture of molecules, atoms and/or ions, one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A homogeneous mixture which does not contain calcium, the chemical element with atomic number 20, but does contain molecules, atoms and/or ions one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. JSmith 2013-06-25T15:06:57Z CHEBI:35225 experimental_condition_ontology XCO:0000316 calcium-free buffer solution A homogeneous mixture which does not contain calcium, the chemical element with atomic number 20, but does contain molecules, atoms and/or ions one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A homogeneous mixture of calcium, the chemical element with atomic number 20, with other molecules, atoms and/or ions one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. JSmith 2013-06-25T15:13:18Z CHEBI:29108 CHEBI:35225 calcium-containing buffer solution experimental_condition_ontology XCO:0000317 buffered calcium ion solution A homogeneous mixture of calcium, the chemical element with atomic number 20, with other molecules, atoms and/or ions one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A process in which manual and instrumental techniques are used to assemble or combine parts or substances, especially in order to create something new. JSmith 2013-06-25T16:06:11Z experimental_condition_ontology Not4Curation XCO:0000318 surgical construction A process in which manual and instrumental techniques are used to assemble or combine parts or substances, especially in order to create something new. Cambridge:Cambridge_Online_Dictionary_of_American_English Collins:Collins_Online_English_Dictionary http://en.wikipedia.org/wiki/Surgery A surgically created passageway between the abdominal aorta and inferior vena cava. JSmith 2013-06-25T16:08:47Z PMID:2142618 experimental_condition_ontology ACF XCO:0000319 artificial aortocaval fistula A surgically created passageway between the abdominal aorta and inferior vena cava. ISBN-13:978-0781733908 Either of two compounds (C12H30Br2N2 or C12H30Cl2N2) used in the treatment of hypertension. Hexamethonium is a depolarising ganglionic blocker, a nicotinic acetylcholine receptor antagonist that acts in autonomic ganglia by binding in or on the receptor but not the acetylcholine binding site itself. JSmith 2013-06-25T17:12:45Z CHEBI:5700 CID:3604 MESH:D018738 Benzohexamethonium hexamethone hexathonide experimental_condition_ontology XCO:0000320 hexamethonium Either of two compounds (C12H30Br2N2 or C12H30Cl2N2) used in the treatment of hypertension. Hexamethonium is a depolarising ganglionic blocker, a nicotinic acetylcholine receptor antagonist that acts in autonomic ganglia by binding in or on the receptor but not the acetylcholine binding site itself. Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed http://en.wikipedia.org/wiki/Hexamethonium The compound C12H30Br2N2, consisting of a hexamethonium cation and dibromide anion, used in the treatment of hypertension. Hexamethonium is a depolarising ganglionic blocker, a nicotinic acetylcholine receptor antagonist that acts in autonomic ganglia by binding in or on the receptor but not the acetylcholine binding site itself. JSmith 2013-06-25T17:17:10Z chembl.compound:CHEMBL105608 pubchem.compound:5938 experimental_condition_ontology hexamethonium dibromide XCO:0000321 hexamethonium bromide The compound C12H30Br2N2, consisting of a hexamethonium cation and dibromide anion, used in the treatment of hypertension. Hexamethonium is a depolarising ganglionic blocker, a nicotinic acetylcholine receptor antagonist that acts in autonomic ganglia by binding in or on the receptor but not the acetylcholine binding site itself. Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed http://en.wikipedia.org/wiki/Hexamethonium The compound C12H30Cl2N2, consisting of a hexamethonium cation and dichloride anion, used in the treatment of hypertension. Hexamethonium is a depolarising ganglionic blocker, a nicotinic acetylcholine receptor antagonist that acts in autonomic ganglia by binding in or on the receptor but not the acetylcholine binding site itself. JSmith 2013-06-25T17:19:38Z CHEMBL:105608 CID:93550 experimental_condition_ontology hexamethonium dichloride XCO:0000322 hexamethonium chloride The compound C12H30Cl2N2, consisting of a hexamethonium cation and dichloride anion, used in the treatment of hypertension. Hexamethonium is a depolarising ganglionic blocker, a nicotinic acetylcholine receptor antagonist that acts in autonomic ganglia by binding in or on the receptor but not the acetylcholine binding site itself. Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed http://en.wikipedia.org/wiki/Hexamethonium Any condition in which the main influencing factor is an alcohol, a compound in which a hydroxy group, -OH, is attached to a saturated carbon atom. JSmith 2013-08-07T16:27:07Z CHEBI:30879 experimental_condition_ontology XCO:0000323 alcohol Any condition in which the main influencing factor is a primary alcohol, a compound in which a hydroxy group, -OH, is attached to a saturated carbon atom which has either three hydrogen atoms attached to it or only one other carbon atom and two hydrogen atoms attached to it. JSmith 2013-08-07T16:35:17Z CHEBI:15734 experimental_condition_ontology XCO:0000324 primary alcohol Any condition in which the main influencing factor is ethanol, a primary alcohol with chemical formula CH3-CH2-OH, that is ethane in which one of the hydrogens is substituted by a hydroxy group. JSmith 2013-08-07T16:39:26Z CHEBI:16236 ethyl alcohol experimental_condition_ontology EtOH XCO:0000325 ethanol Any condition in which the main influencing factor is ethanol, the colorless, volatile, flammable liquid, CH3CH2OH, produced by yeast fermentation of carbohydrates or synthesized by hydration of ethylene, suspended in a saline solution, a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient quantity of water. JSmith 2013-08-07T16:45:26Z ethanol in saline ethanol in 0.9 % saline ethanol in 0.9 % saline solution experimental_condition_ontology XCO:0000326 controlled ethanol content saline Any condition in which the main influencing factor is ethanol, the colorless, volatile, flammable liquid, CH3CH2OH, produced by yeast fermentation of carbohydrates or synthesized by hydration of ethylene, suspended in a saline solution, a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient quantity of water. Webster:Random_House_Kernerman_Websters_College_Dictionary_2010 A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of quinine, and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Quinine is a bitter alkaloid of cinchona that has antimalarial, analgesic, antipyretic, mild oxytocic, cardiac depressant, and sclerosing properties, and that decreases the excitability of the motor end plate. JSmith 2013-08-07T17:05:17Z experimental_condition_ontology XCO:0000327 controlled quinine content drinking water A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of quinine, and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Quinine is a bitter alkaloid of cinchona that has antimalarial, analgesic, antipyretic, mild oxytocic, cardiac depressant, and sclerosing properties, and that decreases the excitability of the motor end plate. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed http://www.yourdictionary.com/drink A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of deoxycorticosterone, and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Deoxycorticosterone is a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone. jsmith 2013-08-22T12:58:04Z experimental_condition_ontology controlled DOC content drinking water XCO:0000328 controlled deoxycorticosterone content drinking water A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of deoxycorticosterone, and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Deoxycorticosterone is a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/11-Deoxycorticosterone http://www.yourdictionary.com/drink A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of saline and a specified amount of deoxycorticosterone, and consumed by an organism as part of an experiment. Saline is a homogeneous mixture of sodium chloride (i.e. atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1) dispersed molecularly in a sufficient and specified quantity of dissolving medium (solvent) such as water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Deoxycorticosterone is a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone. jsmith 2013-08-22T13:00:11Z CHEBI:16973 experimental_condition_ontology controlled DOC and sodium chloride content drinking water controlled DOC content saline drink controlled deoxycorticosterone and sodium content drinking water XCO:0000329 controlled deoxycorticosterone content saline drink A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of saline and a specified amount of deoxycorticosterone, and consumed by an organism as part of an experiment. Saline is a homogeneous mixture of sodium chloride (i.e. atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1) dispersed molecularly in a sufficient and specified quantity of dissolving medium (solvent) such as water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Deoxycorticosterone is a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/11-Deoxycorticosterone http://www.yourdictionary.com/drink Any condition in which the main influencing factor is deoxycorticosterone, a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone, or a derivative of that hormone. jsmith 2013-08-22T14:38:17Z experimental_condition_ontology DOC XCO:0000330 deoxycorticosterone Any condition in which the main influencing factor is deoxycorticosterone, a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone, or a derivative of that hormone. http://en.wikipedia.org/wiki/11-Deoxycorticosterone Any condition in which the main influencing factor is RU28362, a highly selective neuroactive agonist of the glucocorticoid (Corticoid Type II) receptor, but not of the mineralocorticoid (Corticoid Type I) receptor. jsmith 2013-08-22T14:49:55Z pubchem.compound:123790 11,17-dihydroxy-6-methyl-17-(1-propynyl)androsta-1,4,6-triene-3-one experimental_condition_ontology XCO:0000331 RU28362 Any condition in which the main influencing factor is RU28362, a highly selective neuroactive agonist of the glucocorticoid (Corticoid Type II) receptor, but not of the mineralocorticoid (Corticoid Type I) receptor. http://en.wikipedia.org/wiki/RU28362 http://www.nursa.org/molecule.cfm?molType=ligand&molId=1123 A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of RU28362, and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). RU28362 is a highly selective neuroactive agonist of the glucocorticoid (Corticoid Type II) receptor, but not of the mineralocorticoid (Corticoid Type I) receptor. jsmith 2013-08-22T15:03:35Z experimental_condition_ontology XCO:0000332 controlled RU28362 content drinking water A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of RU28362, and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). RU28362 is a highly selective neuroactive agonist of the glucocorticoid (Corticoid Type II) receptor, but not of the mineralocorticoid (Corticoid Type I) receptor. ISBN:978-1416049982 http://en.wikipedia.org/wiki/RU28362 http://www.nursa.org/molecule.cfm?molType=ligand&molId=1123 http://www.thefreedictionary.com/ A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of saline and a specified amount of RU28362, and consumed by an organism as part of an experiment. Saline is a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient and specified quantity of dissolving medium (solvent) such as water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). RU28362 is a highly selective neuroactive agonist of the glucocorticoid (Corticoid Type II) receptor, but not of the mineralocorticoid (Corticoid Type I) receptor. jsmith 2013-08-22T15:06:01Z experimental_condition_ontology controlled RU28362 and sodium chloride content drinking water XCO:0000333 controlled RU28362 content saline drink A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of saline and a specified amount of RU28362, and consumed by an organism as part of an experiment. Saline is a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient and specified quantity of dissolving medium (solvent) such as water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). RU28362 is a highly selective neuroactive agonist of the glucocorticoid (Corticoid Type II) receptor, but not of the mineralocorticoid (Corticoid Type I) receptor. ISBN:978-1416049982 http://en.wikipedia.org/wiki/RU28362 http://www.nursa.org/molecule.cfm?molType=ligand&molId=1123 http://www.thefreedictionary.com/ The surgical excision of only the adrenal gland on the left side of the body. The left adrenal gland is generally the larger of the two dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine. jsmith 2013-08-22T15:48:28Z left suprarenalectomy left unilateral adrenalectomy left unilateral suprarenalectomy experimental_condition_ontology XCO:0000334 Note that "left" in this context refers to the perspective of the organism, not that of the observer. (Wikipedia: Anatomical_terms_of_location). left adrenalectomy The surgical excision of only the adrenal gland on the left side of the body. The left adrenal gland is generally the larger of the two dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 http://en.wikipedia.org/wiki/Adrenal_gland The surgical excision of only the adrenal gland on the right side of the body. The right adrenal gland is generally the smaller of the two dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine. jsmith 2013-08-22T15:50:50Z right suprarenalectomy right unilateral adrenalectomy right unilateral suprarenalectomy experimental_condition_ontology XCO:0000335 Note that "right" in this context refers to the perspective of the organism, not that of the observer. (Wikipedia: Anatomical_terms_of_location). right adrenalectomy The surgical excision of only the adrenal gland on the right side of the body. The right adrenal gland is generally the smaller of the two dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 http://en.wikipedia.org/wiki/Adrenal_gland This is any condition in which the main influencing factor is an adrenergic antagonist, an agent that binds to but does not activate adrenergic receptors thereby blocking the actions of endogenous or exogenous adrenergic agonists, substances that have an affinity for and stimulate physiologic activity at adrenergic receptors. Adrenergic receptors are a class of G protein-coupled receptors that bind catecholamines, especially norepinephrine and epinephrine. jsmith 2013-08-22T16:22:29Z adrenergic receptor antagonist experimental_condition_ontology XCO:0000336 adrenergic antagonist This is any condition in which the main influencing factor is an adrenergic antagonist, an agent that binds to but does not activate adrenergic receptors thereby blocking the actions of endogenous or exogenous adrenergic agonists, substances that have an affinity for and stimulate physiologic activity at adrenergic receptors. Adrenergic receptors are a class of G protein-coupled receptors that bind catecholamines, especially norepinephrine and epinephrine. CHEBI:37887 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Adrenergic_receptors A condition in which an air jet, i.e. a rapid stream of air (the colorless, odorless, tasteless mixture of gases, mainly nitrogen, oxygen and lesser gases, plus water vapor and particulates, that surrounds the earth) forced under pressure through a small opening or nozzle, is directed toward the body or a part of the body of an organism. jsmith 2013-08-22T17:01:21Z experimental_condition_ontology air-jet stress forced air exposure XCO:0000337 air-jet exposure A condition in which an air jet, i.e. a rapid stream of air (the colorless, odorless, tasteless mixture of gases, mainly nitrogen, oxygen and lesser gases, plus water vapor and particulates, that surrounds the earth) forced under pressure through a small opening or nozzle, is directed toward the body or a part of the body of an organism. American_Heritage:The_American_Heritage_Science_Dictionary_2005 This is any condition in which the main influencing factor is a particle with a size between 1 and 100 nanometers composed of any substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules. jsmith 2013-08-23T12:19:49Z ultrafine chemical particle experimental_condition_ontology XCO:0000338 chemical nanoparticle This is any condition in which the main influencing factor is a particle with a size between 1 and 100 nanometers composed of any substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed American_Heritage:The_American_Heritage_Science_Dictionary_2005 Collins:Collins_Online_English_Dictionary http://en.wikipedia.org/wiki/Nanoparticle This is any condition in which the main influencing factor is a nanoparticle with a size between 1 and 100 nanometers composed of titanium dioxide. Titanium dioxide is a white insoluble powder that is the naturally occurring oxide of titanium, chemical formula TiO2, i.e. composed of one atom of titanium, the strong, low-density, highly corrosion-resistant metallic element with atomic number 22, and two atoms of oxygen, the highly reactive chemical element with atomic number 8 that is essential for plant and animal respiration and is required for nearly all combustion. jsmith 2013-08-23T15:14:06Z CHEBI:51050 titanium(IV) oxide nanoparticle ultrafine TiO2 powder ultrafine titanium dioxide powder titania nanoparticle experimental_condition_ontology XCO:0000339 titanium dioxide nanoparticle This is any condition in which the main influencing factor is a nanoparticle with a size between 1 and 100 nanometers composed of titanium dioxide. Titanium dioxide is a white insoluble powder that is the naturally occurring oxide of titanium, chemical formula TiO2, i.e. composed of one atom of titanium, the strong, low-density, highly corrosion-resistant metallic element with atomic number 22, and two atoms of oxygen, the highly reactive chemical element with atomic number 8 that is essential for plant and animal respiration and is required for nearly all combustion. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed http://en.wikipedia.org/wiki/Nanoparticle http://en.wikipedia.org/wiki/Titanium_dioxide Any condition in which the main influencing factor is a homogeneous mixture of molecules, atoms and/or ions dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. jsmith 2013-08-23T15:45:06Z experimental_condition_ontology XCO:0000340 solution Any condition in which the main influencing factor is a homogeneous mixture of molecules, atoms and/or ions dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition in which the main influencing factor is a substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules and which has the capacity to perform a particular role or initiate or participate in a particular activity or process. JSmith 2013-09-03T16:26:49Z CHEBI:50906 chemical with specified role experimental_condition_ontology XCO:0000341 chemical with specified function This is any condition in which the main influencing factor is a substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules and which has the capacity to perform a particular role or initiate or participate in a particular activity or process. American_Heritage:The_American_Heritage_Science_Dictionary_2005 Collins:Collins_Online_English_Dictionary Mosby:Mosbys_Dental_Dictionary--2nd_Ed This is any condition in which the main influencing factor is a substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules, where that molecular composition explicitly contains one or more particular parts or groups that are held or put together in a particular way. JSmith 2013-09-03T16:30:12Z CHEBI:24431 experimental_condition_ontology Not4Curation XCO:0000342 chemical with specified structure This is any condition in which the main influencing factor is a substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules, where that molecular composition explicitly contains one or more particular parts or groups that are held or put together in a particular way. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed American_Heritage:The_American_Heritage_Science_Dictionary_2005 Collins:Collins_Online_English_Dictionary Any condition in which the main influencing factor is a chemical having a nitroso (R-N=O) and a urea moiety. A urea moiety consists of two -NH2 groups joined by a carbonyl (C=O) group. JSmith 2013-09-04T13:12:02Z experimental_condition_ontology XCO:0000343 nitrosourea Any condition in which the main influencing factor is a chemical having a nitroso (R-N=O) and a urea moiety. A urea moiety consists of two -NH2 groups joined by a carbonyl (C=O) group. http://en.wikipedia.org/wiki/Nitrosourea Any condition in which the main influencing factor is a chemical with three major moieties, a propyl group (a linear three-carbon alkyl substituent with chemical formula -C3H7), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group). JSmith 2013-09-04T13:25:28Z 1-nitroso-1-propylurea propylnitrosourea experimental_condition_ontology 1-propyl-1-nitrosourea PNU XCO:0000344 N-propyl-N-nitrosourea Any condition in which the main influencing factor is a chemical with three major moieties, a propyl group (a linear three-carbon alkyl substituent with chemical formula -C3H7), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group). http://en.wikipedia.org/wiki/Nitrosourea http://en.wikipedia.org/wiki/Propyl pubchem.compound:13157 Any condition in which the main influencing factor is a chemical with three major moieties, an ethyl group (a two-carbon alkyl substituent with chemical formula -C2H5), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group). JSmith 2013-09-04T13:34:43Z CHEBI:23995 pubchem.compound:12967 N-ethyl-N-nitroso carbamide ethylnitrosourea experimental_condition_ontology 1-ethyl-1-nitrosourea ENU XCO:0000345 N-ethyl-N-nitrosourea Any condition in which the main influencing factor is a chemical with three major moieties, an ethyl group (a two-carbon alkyl substituent with chemical formula -C2H5), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group). http://en.wikipedia.org/wiki/Ethyl_group http://en.wikipedia.org/wiki/Nitrosourea Any condition in which the main influencing factor is a chemical with three major moieties, a methyl group (a one-carbon alkyl substituent with chemical formula -CH3), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group). JSmith 2013-09-20T16:27:41Z CHEBI:50102 pubchem.compound:12967 N-methyl-N-nitrosocarbamide methylnitrosourea experimental_condition_ontology 1-methyl-1-nitrosourea MNU XCO:0000346 N-methyl-N-nitrosourea Any condition in which the main influencing factor is a chemical with three major moieties, a methyl group (a one-carbon alkyl substituent with chemical formula -CH3), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group). http://en.wikipedia.org/wiki/Methyl_group http://en.wikipedia.org/wiki/N-Methyl-N-nitrosourea http://en.wikipedia.org/wiki/Nitrosourea This is any condition in which the main influencing factor is surgical manipulation causing blockage of a blood vessel, any one of the network of muscular tubes that carry blood through the body. JSmith 2013-11-11T10:32:17Z experimental_condition_ontology XCO:0000347 blood vessel occlusion This is any condition in which the main influencing factor is surgical manipulation causing blockage of a blood vessel, any one of the network of muscular tubes that carry blood through the body. Mosby:Mosbys_Medical_Dictionary--8th_Ed A surgical manipulation causing blockage of the middle cerebral artery (MCA), one of the three major paired arteries that supply blood to the cerebrum. The MCA arises from the internal carotid and continues into the lateral sulcus where it branches and projects into the lateral cerebral cortex. JSmith 2013-11-11T10:46:10Z experimental_condition_ontology MCA occlusion XCO:0000348 middle cerebral artery occlusion A surgical manipulation causing blockage of the middle cerebral artery (MCA), one of the three major paired arteries that supply blood to the cerebrum. The MCA arises from the internal carotid and continues into the lateral sulcus where it branches and projects into the lateral cerebral cortex. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Middle_Cerebral_Artery Any phenomenon, chemical or biologic substance, or organism that, when administered, results in the inflammation of one or more joints, the sites of junction or union between bones, especially those that allow motion of the bones. JSmith 2013-11-11T12:01:59Z experimental_condition_ontology XCO:0000349 arthritis-inducing agent Any phenomenon, chemical or biologic substance, or organism that, when administered, results in the inflammation of one or more joints, the sites of junction or union between bones, especially those that allow motion of the bones. Collins:Collins_Online_English_Dictionary Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A biologic agent consisting of a more or less purified preparation of cell walls from streptococcus bacteria. Streptococcus is a genus of spherical Gram-positive bacteria belonging to the phylum Firmicutes and the lactic acid bacteria group. The cell wall is the rigid structure that lies just outside of and is joined to the plasma membrane of plant cells and most prokaryotic cells, which protects the cell and maintains its shape. JSmith 2013-11-11T12:03:50Z experimental_condition_ontology SCW XCO:0000350 streptococcal cell wall A biologic agent consisting of a more or less purified preparation of cell walls from streptococcus bacteria. Streptococcus is a genus of spherical Gram-positive bacteria belonging to the phylum Firmicutes and the lactic acid bacteria group. The cell wall is the rigid structure that lies just outside of and is joined to the plasma membrane of plant cells and most prokaryotic cells, which protects the cell and maintains its shape. Collins:Collins_Online_English_Dictionary Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Streptococcus A condition in which the major influencing factor is 4-nitroquinoline N-oxide, a tumorigenic derivative of quinoline N-oxide containing a nitro functional group (-NO2) at the 4 position of the quinoline bicyclic structure. Quinoline is a heterocyclic aromatic organic compound with the chemical formula C9H7N. 4-nitroquinoline 1-oxide and its metabolite 4-hydroxyaminoquinoline-1-oxide bind to nucleic acids and cause lesions usually corrected by nucleotide excision repair. JSmith 2013-11-11T13:00:15Z XCO:0000366 CHEBI:16907 MESH:D015112 4-Nitroquinoline 1-oxide experimental_condition_ontology 4NQO XCO:0000351 4-nitroquinoline N-oxide A condition in which the major influencing factor is 4-nitroquinoline N-oxide, a tumorigenic derivative of quinoline N-oxide containing a nitro functional group (-NO2) at the 4 position of the quinoline bicyclic structure. Quinoline is a heterocyclic aromatic organic compound with the chemical formula C9H7N. 4-nitroquinoline 1-oxide and its metabolite 4-hydroxyaminoquinoline-1-oxide bind to nucleic acids and cause lesions usually corrected by nucleotide excision repair. http://en.wikipedia.org/wiki/4-Nitroquinoline_1-oxide http://en.wikipedia.org/wiki/Quinoline A condition in which the major influencing factor is myelin, a lipoproteinaceous substance largely composed of phospholipids and proteins, which forms the sheaths surrounding the myelinated nerve fibers. JSmith 2013-11-11T13:10:37Z experimental_condition_ontology XCO:0000352 myelin A condition in which the major influencing factor is myelin, a lipoproteinaceous substance largely composed of phospholipids and proteins, which forms the sheaths surrounding the myelinated nerve fibers. Mosby:Mosbys_Medical_Dictionary--8th_Ed A condition in which the major influencing factor is the lipoproteinaceous substance largely composed of phospholipids and proteins, which forms the sheaths surrounding the myelinated nerve fibers of the central nervous system, i.e., the brain and spinal cord. JSmith 2013-11-11T13:26:36Z experimental_condition_ontology CNS myelin XCO:0000353 central nervous system myelin A condition in which the major influencing factor is the lipoproteinaceous substance largely composed of phospholipids and proteins, which forms the sheaths surrounding the myelinated nerve fibers of the central nervous system, i.e., the brain and spinal cord. Mosby:Mosbys_Medical_Dictionary--8th_Ed A guanidine derivative with a nitro group (-NO2) on the nitrogen at position 3 and a methyl group (-CH3) and nitroso group (-NO) on the nitrogen at position 1. MNNG acts by adding alkyl groups to the O6 of guanine and O4 of thymine of DNA, giving it potent mutagenic and carcinogenic properties. JSmith 2013-11-11T14:50:46Z CHEBI:21759 pubchem.compound:9562060 1-methyl-3-nitro-1-nitrosoguanidine methylnitronitrosoguanidine experimental_condition_ontology MNNG XCO:0000354 N-methyl-N'-nitro-N-nitrosoguanidine A guanidine derivative with a nitro group (-NO2) on the nitrogen at position 3 and a methyl group (-CH3) and nitroso group (-NO) on the nitrogen at position 1. MNNG acts by adding alkyl groups to the O6 of guanine and O4 of thymine of DNA, giving it potent mutagenic and carcinogenic properties. MESH:D008769 http://en.wikipedia.org/wiki/Methylnitronitrosoguanidine A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of N-methyl-N'-nitro-N-nitrosoguanidine (MNNG), and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). MNNG is a guanidine derivative with a nitro group (-NO2) on the nitrogen at position 3 and a methyl group (-CH3) and nitroso group (-NO) on the nitrogen at position 1. MNNG acts by adding alkyl groups to the O6 of guanine and O4 of thymine of DNA, giving it potent mutagenic and carcinogenic properties. JSmith 2013-11-11T15:17:46Z CHEBI:21759 controlled 1-methyl-3-nitro-1-nitrosoguanidine content drinking water controlled methylnitronitrosoguanidine content drinking water experimental_condition_ontology controlled MNNG content drinking water XCO:0000355 controlled N-methyl-N'-nitro-N-nitrosoguanidine content drinking water A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of N-methyl-N'-nitro-N-nitrosoguanidine (MNNG), and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). MNNG is a guanidine derivative with a nitro group (-NO2) on the nitrogen at position 3 and a methyl group (-CH3) and nitroso group (-NO) on the nitrogen at position 1. MNNG acts by adding alkyl groups to the O6 of guanine and O4 of thymine of DNA, giving it potent mutagenic and carcinogenic properties. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 MESH:D008769 http://en.wikipedia.org/wiki/Methylnitronitrosoguanidine http://www.yourdictionary.com/drink A condition in which the major contributing factor is a preparation of spinal cord which has been rendered uniform in structure and/or composition throughout, for example by grinding the tissue until it has been reduced to particles which are evenly distributed thoughout a fluid. Spinal cord is the long, flexible, nearly cylindric structure of nerve tissue that extends from the medulla oblongata down through the vertebral canal and from which the spinal nerves branch off to various parts of the body. JSmith 2013-11-11T15:35:41Z experimental_condition_ontology XCO:0000356 spinal cord homogenate A condition in which the major contributing factor is a preparation of spinal cord which has been rendered uniform in structure and/or composition throughout, for example by grinding the tissue until it has been reduced to particles which are evenly distributed thoughout a fluid. Spinal cord is the long, flexible, nearly cylindric structure of nerve tissue that extends from the medulla oblongata down through the vertebral canal and from which the spinal nerves branch off to various parts of the body. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Mosby:Mosbys_Medical_Dictionary--8th_Ed The action of ambulation on an exercise apparatus with an endless belt that allows the user to perform the action of running in place and that is maintained at an angle which deviates from the horozontal by a specified amount. JSmith 2013-11-11T15:50:46Z walking on sloped treadmill experimental_condition_ontology XCO:0000357 walking on inclined treadmill The action of ambulation on an exercise apparatus with an endless belt that allows the user to perform the action of running in place and that is maintained at an angle which deviates from the horozontal by a specified amount. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed Encarta:Encarta_World_English_Dictionary A substance administered specifically to aid diagnosis of a disease or condition. JSmith 2013-11-11T16:04:05Z experimental_condition_ontology diagnostic aid XCO:0000358 diagnostic agent A substance administered specifically to aid diagnosis of a disease or condition. CHEBI:33295 Webster:Random_House_Kernerman_Websters_College_Dictionary_2010 A condition in which the main influencing factor is an organic sodium salt that is the monosodium salt of p-aminohippuric acid, an amide derivative of the amino acid glycine and para-aminobenzoic acid. Sodium p-aminohippurate is used as a diagnostic agent in the measurement of renal plasma flow. JSmith 2013-11-11T16:10:30Z sodium para-aminohippurate experimental_condition_ontology PAH XCO:0000359 sodium p-aminohippurate A condition in which the main influencing factor is an organic sodium salt that is the monosodium salt of p-aminohippuric acid, an amide derivative of the amino acid glycine and para-aminobenzoic acid. Sodium p-aminohippurate is used as a diagnostic agent in the measurement of renal plasma flow. CHEBI:104011 CHEBI:31204 http://en.wikipedia.org/wiki/Aminohippuric_acid The insertion of a tubular, flexible surgical instrument into an artery to withdraw or introduce fluid. An artery is a vessel in which blood flows away from the heart. JSmith 2013-12-20T12:41:32Z experimental_condition_ontology XCO:0000360 arterial catheter implantation The insertion of a tubular, flexible surgical instrument into an artery to withdraw or introduce fluid. An artery is a vessel in which blood flows away from the heart. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 The forcible surgical separation from the spine of the motor root of a left side spinal nerve between the #3 and #5 lumbar vertebrae. JSmith 2013-12-20T13:05:25Z experimental_condition_ontology XCO:0000361 left L3-L5 ventral root avulsion The forcible surgical separation from the spine of the motor root of a left side spinal nerve between the #3 and #5 lumbar vertebrae. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Gale:Gale_Encyclopedia_of_Medicine_2008 The use of a pouch made from a very thin flexible plastic (any of various organic compounds produced by polymerization, capable of being molded, extruded, cast into various shapes and films) to limit some or all of an animal's normal movements. JSmith 2013-12-20T13:13:08Z experimental_condition_ontology XCO:0000362 physical restraint in plastic bag The use of a pouch made from a very thin flexible plastic (any of various organic compounds produced by polymerization, capable of being molded, extruded, cast into various shapes and films) to limit some or all of an animal's normal movements. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed Collins:Collins_Online_English_Dictionary http://grants.nih.gov/grants/olaw/Guide-for-the-care-and-use-of-Laboratory-animals.pdf A condition in which the main influencing factor is a single-celled or multicellular organism that has the capacity to cause disease, and the cell(s) of which individually have a true nucleus, that is, one that is bounded by a nuclear membrane, contains one or more chromosomes, and divides by mitosis. JSmith 2013-12-20T13:28:29Z experimental_condition_ontology XCO:0000363 eukaryotic pathogen A condition in which the main influencing factor is a single-celled or multicellular organism that has the capacity to cause disease, and the cell(s) of which individually have a true nucleus, that is, one that is bounded by a nuclear membrane, contains one or more chromosomes, and divides by mitosis. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed A condition in which the main influencing factor is a sporozoan species that is an intracellular parasite in a variety of vertebrates and is the causative agent of toxoplasmosis. JSmith 2013-12-20T13:29:36Z experimental_condition_ontology XCO:0000364 Toxoplasma gondii A condition in which the main influencing factor is a sporozoan species that is an intracellular parasite in a variety of vertebrates and is the causative agent of toxoplasmosis. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 A condition in which the main influencing factor is Toxoplasma gondii cysts. Toxoplasma gondii is a sporozoan species that is an intracellular parasite in a variety of vertebrates and is the causative agent of toxoplasmosis. Cyst refers to the larval stage in the life cycle during which individual organisms are enveloped in a protective wall. JSmith 2013-12-20T13:30:01Z experimental_condition_ontology XCO:0000365 Toxoplasma gondii cysts A condition in which the main influencing factor is Toxoplasma gondii cysts. Toxoplasma gondii is a sporozoan species that is an intracellular parasite in a variety of vertebrates and is the causative agent of toxoplasmosis. Cyst refers to the larval stage in the life cycle during which individual organisms are enveloped in a protective wall. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 true This is any condition in which the main influencing factor is surgical control device implantation in which the control device does not dispense the chemical, drug, or electrical stimulation dispensed by the experimental device. JSmith 2013-12-20T14:06:20Z control surgical device implantation sham surgical device implantation experimental_condition_ontology XCO:0000367 surgical device implantation sham procedure This is any condition in which the main influencing factor is surgical control device implantation in which the control device does not dispense the chemical, drug, or electrical stimulation dispensed by the experimental device. PMID:15687265 Any condition in which the main influencing factor is a chemical that causes an anti-self reaction by the immune system of the treated individual. JSmith 2013-12-20T14:29:13Z experimental_condition_ontology XCO:0000368 autoimmune disease-inducing chemical Any condition in which the main influencing factor is a chemical that causes an anti-self reaction by the immune system of the treated individual. RGD:JRS An antirheumatic of slow action that, in certain susceptible individuals, causes a gold-induced, Th2-dependent autoimmunity. JSmith 2013-12-20T14:29:49Z experimental_condition_ontology Atps allochrysine aurotioprol XCO:0000369 aurothiopropanol sulfonate An antirheumatic of slow action that, in certain susceptible individuals, causes a gold-induced, Th2-dependent autoimmunity. PMID:15128826 A condition in which the main influencing factor is any form of Trichinella spiralis, a nematode parasite that occurs in animals such as rodents, pigs, bears, and in humans. The organism, which matures in the intestines, producing larvae that travel through the blood and lymphatic systems to the muscles where they encyst, is responsible for the disease trichinosis. JSmith 2014-01-09T13:19:52Z experimental_condition_ontology XCO:0000370 Trichinella spiralis A condition in which the main influencing factor is any form of Trichinella spiralis, a nematode parasite that occurs in animals such as rodents, pigs, bears, and in humans. The organism, which matures in the intestines, producing larvae that travel through the blood and lymphatic systems to the muscles where they encyst, is responsible for the disease trichinosis. http://en.wikipedia.org/wiki/Trichinella_spiralis A condition in which the main influencing factor is the infective larvae of the nematode parasite Trichinella spiralis. JSmith 2014-01-09T13:27:57Z experimental_condition_ontology XCO:0000371 Trichinella spiralis larvae A condition in which the main influencing factor is the infective larvae of the nematode parasite Trichinella spiralis. http://en.wikipedia.org/wiki/Trichinella_spiralis A condition in which the main influencing factor is dexamethasone, a long-acting synthetic adrenocorticoid, analogous to but more potent than cortisol (a natural hormone produced by the adrenal glands), with anti-inflammatory and immunosuppressant activities. JSmith 2014-01-09T13:51:38Z experimental_condition_ontology XCO:0000372 dexamethasone A condition in which the main influencing factor is dexamethasone, a long-acting synthetic adrenocorticoid, analogous to but more potent than cortisol (a natural hormone produced by the adrenal glands), with anti-inflammatory and immunosuppressant activities. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Dexamethasone http://www.nlm.nih.gov/medlineplus/druginfo/meds/a682792.html This is any condition in which the main influencing factor is surgical denervation, which my involve transection, resection, or complete surgical removal of a nerve, any of the cordlike structures that convey impulses between the central nervous system and one or more parts of the body, and that each consist of an outer connective tissue sheath surrounding a bundle of conductive fibers. JSmith 2014-01-09T14:52:48Z MESH:D003714 experimental_condition_ontology XCO:0000373 surgical denervation This is any condition in which the main influencing factor is surgical denervation, which my involve transection, resection, or complete surgical removal of a nerve, any of the cordlike structures that convey impulses between the central nervous system and one or more parts of the body, and that each consist of an outer connective tissue sheath surrounding a bundle of conductive fibers. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Dental_Dictionary--2nd_Ed Surgical transection or severing of an axon, the process of a neuron capable of conducting action potentials or self-propagating nerve impulses away from the cell body. JSmith 2014-01-09T14:56:20Z MESH:D019771 experimental_condition_ontology XCO:0000374 axotomy Surgical transection or severing of an axon, the process of a neuron capable of conducting action potentials or self-propagating nerve impulses away from the cell body. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed Surgical transection or severing of one or more axons of the sciatic nerve, the large sensory and motor nerve that in humans arises from the sacral plexus and passes through the greater sciatic foramen to midthigh where it divides into the common peroneal and tibial nerves. JSmith 2014-01-09T14:57:23Z MA:0001172 MESH:D019771 experimental_condition_ontology XCO:0000375 sciatic nerve axotomy Surgical transection or severing of one or more axons of the sciatic nerve, the large sensory and motor nerve that in humans arises from the sacral plexus and passes through the greater sciatic foramen to midthigh where it divides into the common peroneal and tibial nerves. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Surgical transection or severing of one or more axons of the saphenous nerve, a sensory nerve that is a terminal branch of the femoral nerve, in humans extending from the femoral triangle to the foot, becoming subcutaneous on the medial side of the knee. JSmith 2014-01-09T14:57:26Z MA:0002761 MESH:D019771 experimental_condition_ontology XCO:0000376 saphenous nerve axotomy Surgical transection or severing of one or more axons of the saphenous nerve, a sensory nerve that is a terminal branch of the femoral nerve, in humans extending from the femoral triangle to the foot, becoming subcutaneous on the medial side of the knee. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed Farlex:Farlex_Partner_Medical_Dictionary_2012 ISBN:978-1416049982 A condition in which the main influencing factor is any of a group of unrelated organic substances occurring in many foods in small amounts and necessary in trace amounts for the normal metabolic functioning of the body. JSmith 2014-01-09T17:12:36Z experimental_condition_ontology XCO:0000377 vitamin A condition in which the main influencing factor is any of a group of unrelated organic substances occurring in many foods in small amounts and necessary in trace amounts for the normal metabolic functioning of the body. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the main influencing factor is any of a group of at least eight related fat-soluble compounds with similar biological antioxidant activity, particularly alpha-tocopherol but also including other isomers of tocopherol and the related compounds tocotrienol and tocomonoenol. JSmith 2014-01-09T17:14:02Z CHEBI:33234 experimental_condition_ontology XCO:0000378 vitamin E A condition in which the main influencing factor is any of a group of at least eight related fat-soluble compounds with similar biological antioxidant activity, particularly alpha-tocopherol but also including other isomers of tocopherol and the related compounds tocotrienol and tocomonoenol. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://www.cyberlipid.org/vite/vite0001.htm A condition in which the main influencing factor is the most active form of vitamin E, a 6-hydroxychroman derivative (chromene) with methyl groups in position 2,5,7, and 8 and a phytyl side chain attached at carbon 2. May be described chemically as 2R-(4'R,8'R)-5,7,8-trimethyltocol, with the term tocol indicating the 2-ring structure (benzopyran-6-ol) basic to all vitamin E compounds. JSmith 2014-01-09T17:15:15Z CHEBI:22470 experimental_condition_ontology a-tocopherol XCO:0000379 alpha-tocopherol A condition in which the main influencing factor is the most active form of vitamin E, a 6-hydroxychroman derivative (chromene) with methyl groups in position 2,5,7, and 8 and a phytyl side chain attached at carbon 2. May be described chemically as 2R-(4'R,8'R)-5,7,8-trimethyltocol, with the term tocol indicating the 2-ring structure (benzopyran-6-ol) basic to all vitamin E compounds. http://www.cyberlipid.org/vite/vite0001.htm A condition in which the main influencing factor is a hydrophobic 13 carbon saturated chain with methyl side groups at the 4', 8' and 12' positions. In its native form, the molecule is attached to the 2-carbon of the benzopyran-6-ol double ring structure of alpha-tocopherol. JSmith 2014-01-09T17:16:43Z experimental_condition_ontology alpha-tocopherol phytyl side chain XCO:0000380 phytyl side chain of alpha-tocopherol A condition in which the main influencing factor is a hydrophobic 13 carbon saturated chain with methyl side groups at the 4', 8' and 12' positions. In its native form, the molecule is attached to the 2-carbon of the benzopyran-6-ol double ring structure of alpha-tocopherol. http://www.cyberlipid.org/vite/vite0001.htm Condition in which the main influencing factor is the steroid hormone progesterone, the principal pro-gestational hormone liberated by the corpus luteum, adrenal cortex, and placenta, whose function is to prepare the uterus for the reception and development of the fertilized oocyte by inducing transformation of the endometrium from the proliferative to the secretory stage. JSmith 2014-01-09T17:37:07Z experimental_condition_ontology XCO:0000381 progesterone Condition in which the main influencing factor is the steroid hormone progesterone, the principal pro-gestational hormone liberated by the corpus luteum, adrenal cortex, and placenta, whose function is to prepare the uterus for the reception and development of the fertilized oocyte by inducing transformation of the endometrium from the proliferative to the secretory stage. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A drink made up of water and a specified amount of captopril consumed by an organism as part of an experiment. Captopril is an angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and some types of congestive heart failure. JSmith 2014-01-09T18:05:23Z experimental_condition_ontology XCO:0000382 controlled captopril content drinking water A drink made up of water and a specified amount of captopril consumed by an organism as part of an experiment. Captopril is an angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and some types of congestive heart failure. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Captopril A drink made up of water and a specified amount of losartan consumed by an organism as part of an experiment. Losartan is a selective, competitive angiotensin II receptor type 1 (AT1) receptor antagonist, reducing the end organ responses to angiotensin II. JSmith 2014-01-09T18:07:00Z experimental_condition_ontology XCO:0000383 controlled losartan content drinking water A drink made up of water and a specified amount of losartan consumed by an organism as part of an experiment. Losartan is a selective, competitive angiotensin II receptor type 1 (AT1) receptor antagonist, reducing the end organ responses to angiotensin II. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Losartan A drink made up of water and a specified amount of tempol consumed by an organism as part of an experiment. Tempol (4-Hydroxy-TEMPO) is a heterocyclic compound used as an agent for detoxifying reactive oxygen species. It catalyses the disproportionation of superoxide. JSmith 2014-01-09T18:07:59Z experimental_condition_ontology XCO:0000384 controlled tempol content drinking water A drink made up of water and a specified amount of tempol consumed by an organism as part of an experiment. Tempol (4-Hydroxy-TEMPO) is a heterocyclic compound used as an agent for detoxifying reactive oxygen species. It catalyses the disproportionation of superoxide. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/TEMPOL Any substance, such as a chemical, a mix of chemicals or a pathogen, which has the capacity to cause the development of the symptoms of glomerulonephritis, kidney inflammation characterized by inflammation of the capillary loops in the renal glomeruli. JSmith 2014-01-10T15:46:03Z experimental_condition_ontology XCO:0000385 glomerulonephritis-inducing agent Any substance, such as a chemical, a mix of chemicals or a pathogen, which has the capacity to cause the development of the symptoms of glomerulonephritis, kidney inflammation characterized by inflammation of the capillary loops in the renal glomeruli. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed A condition in which the main influencing factor is a relatively undefined mix of macromolecules such as glycoproteins, proteoglycans, and fragmented collagens, derived from the basement membrane of renal glomeruli via treatment with collagenase, an enzyme that catalyzes the hydrolysis of peptide bonds in triple helical regions of collagen, one of the major components of basement membranes. A basement membrane is an organised multi-molecular extracellular matrix which is characteristically found under epithelial and endothelial cells. JSmith 2014-01-10T15:47:24Z experimental_condition_ontology collagenase-solubilized GBM XCO:0000386 collagenase-solubilized glomerular basement membrane A condition in which the main influencing factor is a relatively undefined mix of macromolecules such as glycoproteins, proteoglycans, and fragmented collagens, derived from the basement membrane of renal glomeruli via treatment with collagenase, an enzyme that catalyzes the hydrolysis of peptide bonds in triple helical regions of collagen, one of the major components of basement membranes. A basement membrane is an organised multi-molecular extracellular matrix which is characteristically found under epithelial and endothelial cells. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Segen:Segens_Medical_Dictionary_2012 A condition in which the main influencing factor is a relatively undefined mix of macromolecules such as glycoproteins, proteoglycans, and fragmented collagens, derived from the basement membrane of renal glomeruli from rats (i.e., members of the species Rattus norvegicus) via treatment with collagenase, an enzyme that catalyzes the hydrolysis of peptide bonds in triple helical regions of collagen, one of the major components of basement membranes. A basement membrane is an organised multi-molecular extracellular matrix which is characteristically found under epithelial and endothelial cells. JSmith 2014-01-10T15:48:30Z experimental_condition_ontology collagenase-solubilized rat GBM XCO:0000387 collagenase-solubilized rat glomerular basement membrane A condition in which the main influencing factor is a relatively undefined mix of macromolecules such as glycoproteins, proteoglycans, and fragmented collagens, derived from the basement membrane of renal glomeruli from rats (i.e., members of the species Rattus norvegicus) via treatment with collagenase, an enzyme that catalyzes the hydrolysis of peptide bonds in triple helical regions of collagen, one of the major components of basement membranes. A basement membrane is an organised multi-molecular extracellular matrix which is characteristically found under epithelial and endothelial cells. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Segen:Segens_Medical_Dictionary_2012 Condition in which the main influencing factor is acetaminophen, an analgesic and antipyretic with effects similar to aspirin but only weakly antiinflammatory. JSmith 2014-01-21T16:34:04Z CHEBI:46195 MESH:D000082 N-acetyl-p-aminophenol para-acetylaminophenol paracetamol experimental_condition_ontology APAP XCO:0000388 acetaminophen Condition in which the main influencing factor is acetaminophen, an analgesic and antipyretic with effects similar to aspirin but only weakly antiinflammatory. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the air surrounding an organism or breathed by the organism contains a controlled amount of cigarette smoke, the combined gases and particulates given off when tobacco in the form of a cigarette burns or smolders. A cigarette is a cylinder of cut blonde or black tobacco ensheathed in a tube of paper, with or without an incorporated filter to decrease inhaled tars. JSmith 2014-01-21T16:58:06Z experimental_condition_ontology exposure to atmospheric cigarette smoke XCO:0000389 controlled cigarette smoke content A condition in which the air surrounding an organism or breathed by the organism contains a controlled amount of cigarette smoke, the combined gases and particulates given off when tobacco in the form of a cigarette burns or smolders. A cigarette is a cylinder of cut blonde or black tobacco ensheathed in a tube of paper, with or without an incorporated filter to decrease inhaled tars. McGraw-Hill:McGraw-Hill_Concise_Dictionary_of_Modern_Medicine This is any condition in which the main influencing factor is an antimetabolite, a substance which competes with or replaces a metabolite (a chemical that is part of the normal metabolism of a cell or body), and so prevents or reduces its normal utilization or activity. Antimetabolites are often structurally similar to the metabolite for which they substitute. JSmith 2014-02-07T15:47:34Z CHEBI:35221 MESH:D000963 experimental_condition_ontology XCO:0000390 antimetabolite This is any condition in which the main influencing factor is an antimetabolite, a substance which competes with or replaces a metabolite (a chemical that is part of the normal metabolism of a cell or body), and so prevents or reduces its normal utilization or activity. Antimetabolites are often structurally similar to the metabolite for which they substitute. http://en.wikipedia.org/wiki/Antimetabolite A condition in which the main influencing factor is 5-bromo-2'-deoxyuridine (BrdU), a synthetic nucleoside analog and antimetabolite of thymidine. Because BrdU substitutes for thymidine in DNA during replication its incorporation can be used as a marker of cell division. JSmith 2014-02-07T15:58:44Z CHEBI:472552 MESH:D001973 experimental_condition_ontology BrdU bromodeoxyuridine XCO:0000391 5-bromo-2'-deoxyuridine A condition in which the main influencing factor is 5-bromo-2'-deoxyuridine (BrdU), a synthetic nucleoside analog and antimetabolite of thymidine. Because BrdU substitutes for thymidine in DNA during replication its incorporation can be used as a marker of cell division. http://en.wikipedia.org/wiki/Bromodeoxyuridine A condition in which the main influencing factor is any of various compounds consisting of a purine or pyrimidine base and a sugar, usually ribose or deoxyribose, with (nucleotide) or without (nucleoside) one or more phosphate groups. JSmith 2014-02-07T16:00:28Z experimental_condition_ontology XCO:0000392 nucleoside/nucleotide A condition in which the main influencing factor is any of various compounds consisting of a purine or pyrimidine base and a sugar, usually ribose or deoxyribose, with (nucleotide) or without (nucleoside) one or more phosphate groups. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 http://en.wikipedia.org/wiki/Nucleotide A condition in which the main influencing factor is 1,2-dimethylhydrazine, DNA alkylating agent that is a potent carcinogen; used to induce colon tumours in experimental animals. JSmith 2014-02-07T16:46:23Z CHEBI:73755 MESH:D019813 N,N'-dimethylhydrazine experimental_condition_ontology Hydrazomethane SDMH symmetrical dimethylhydrazine XCO:0000393 1,2-dimethylhydrazine A condition in which the main influencing factor is 1,2-dimethylhydrazine, DNA alkylating agent that is a potent carcinogen; used to induce colon tumours in experimental animals. Mondofacto:Mondofacto_Online_Medical_Dictionary http://en.wikipedia.org/wiki/1,2-dimethylhydrazine A regimen of solid food to which a specified amount of bile acid has been added. Bile acids are steroid acids derived from cholesterol in the liver (primary) or produced from primary bile acids by intestinal bacteria (secondary). JSmith 2014-02-07T16:57:51Z experimental_condition_ontology XCO:0000394 controlled bile acid content diet A regimen of solid food to which a specified amount of bile acid has been added. Bile acids are steroid acids derived from cholesterol in the liver (primary) or produced from primary bile acids by intestinal bacteria (secondary). Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A drink made up of water and a specified amount of 4-nitroquinoline N-oxide, a tumorigenic derivative of quinoline N-oxide containing a nitro functional group (-NO2) at the 4 position of the quinoline bicyclic structure. 4-nitroquinoline 1-oxide and its metabolite 4-hydroxyaminoquinoline-1-oxide bind to nucleic acids and cause lesions usually corrected by nucleotide excision repair. JSmith 2014-02-07T17:03:31Z CHEBI:16907 MESH:D015112 controlled 4-Nitroquinoline 1-oxide drinking water experimental_condition_ontology controlled 4NQO drinking water XCO:0000395 controlled 4-nitroquinoline N-oxide content drinking water A drink made up of water and a specified amount of 4-nitroquinoline N-oxide, a tumorigenic derivative of quinoline N-oxide containing a nitro functional group (-NO2) at the 4 position of the quinoline bicyclic structure. 4-nitroquinoline 1-oxide and its metabolite 4-hydroxyaminoquinoline-1-oxide bind to nucleic acids and cause lesions usually corrected by nucleotide excision repair. http://en.wikipedia.org/wiki/4-Nitroquinoline_1-oxide Any organic aromatic compound consisting of at least one phenolic group, that is, a group having one or more hydroxy groups attached to a benzene or other arene ring. JSmith 2014-02-27T13:23:28Z CHEBI:33853 experimental_condition_ontology XCO:0000396 phenolic/phenol derivative A synthetic phenolic compound with the chemical formula (CH3)2C(C6H4OH)2, i.e. one in which a central carbon links to two methyl groups and two hydroxyphenyl groups. BPA is similar in structure to estradiol and can bind to and activate the estrogen receptor. JSmith 2014-02-27T13:28:43Z CHEBI:33216 experimental_condition_ontology BPA XCO:0000397 bisphenol A A synthetic phenolic compound with the chemical formula (CH3)2C(C6H4OH)2, i.e. one in which a central carbon links to two methyl groups and two hydroxyphenyl groups. BPA is similar in structure to estradiol and can bind to and activate the estrogen receptor. http://en.wikipedia.org/wiki/Bisphenol_A A condition in which the main influencing factor is cisplatin, a chemotherapy drug in which two ammine ligands and two chloro ligands are oriented in a cis planar configuration around a central platinum ion. Cisplatin is mutagenic and serves as an anti-cancer drug through its ability to bind to and crosslink DNA, interfering with cell division, triggering DNA repair mechanisms and, in turn, activating apoptosis. JSmith 2014-02-27T15:53:25Z CHEBI:27899 experimental_condition_ontology XCO:0000398 cisplatin A condition in which the main influencing factor is cisplatin, a chemotherapy drug in which two ammine ligands and two chloro ligands are oriented in a cis planar configuration around a central platinum ion. Cisplatin is mutagenic and serves as an anti-cancer drug through its ability to bind to and crosslink DNA, interfering with cell division, triggering DNA repair mechanisms and, in turn, activating apoptosis. CHEBI:27899 http://en.wikipedia.org/wiki/Cisplatin A metal ion surrounded by, and forming coordinate covalent bonds with, a set of ligands comprised of any combination of other molecules or ions able to donate an electron pair. JSmith 2014-02-27T15:55:56Z experimental_condition_ontology XCO:0000399 complex ion A metal ion surrounded by, and forming coordinate covalent bonds with, a set of ligands comprised of any combination of other molecules or ions able to donate an electron pair. http://chemwiki.ucdavis.edu/Inorganic_Chemistry/Coordination_Chemistry/Complex_Ion_Equilibria/Complex-Ion_Equilibria http://www.chemguide.co.uk/inorganic/complexions/whatis.html#top A surgical manipulation in which one tissue, organ or body part is forcibly torn away from the whole, or in which an attached or anchored tissue is torn away from another tissue or body part. JSmith 2014-02-27T17:28:06Z experimental_condition_ontology XCO:0000400 surgical avulsion A surgical manipulation in which one tissue, organ or body part is forcibly torn away from the whole, or in which an attached or anchored tissue is torn away from another tissue or body part. Mosby:Mosbys_Medical_Dictionary--8th_Ed Segen:Segens_Medical_Dictionary_2012 The surgical tearing apart of the nerve root, the part of a nerve adjacent to the center to which it is connected, from that center, for example, surgical separation of one or both of two bundles of nerve fibers (the posterior and anterior roots) from the spinal cord by tearing rather than cutting. JSmith 2014-02-27T17:29:08Z experimental_condition_ontology XCO:0000401 nerve root avulsion The surgical tearing apart of the nerve root, the part of a nerve adjacent to the center to which it is connected, from that center, for example, surgical separation of one or both of two bundles of nerve fibers (the posterior and anterior roots) from the spinal cord by tearing rather than cutting. Farlex:Farlex_Partner_Medical_Dictionary_2012 Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed Mosby:Mosbys_Medical_Dictionary--8th_Ed A condition in which an experimental subject is exposed to an experimental apparatus in order to habituate the individual to the apparatus. Habituation is the gradual decrease in behavioral responses to a particular stimulus or environment after repeated exposures have proven to be of no consequence. JSmith 2014-02-28T11:38:55Z experimental_condition_ontology XCO:0000402 habituation to experimental apparatus A condition in which an experimental subject is exposed to an experimental apparatus in order to habituate the individual to the apparatus. Habituation is the gradual decrease in behavioral responses to a particular stimulus or environment after repeated exposures have proven to be of no consequence. Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed http://en.wikipedia.org/wiki/Habituation A solid diet in which the amount of cisplatin, a chemotherapy drug in which two ammine ligands and two chloro ligands are oriented in a cis planar configuration around a central platinum ion, is maintained at a specified level. JSmith 2014-02-28T12:22:58Z CHEBI:27899 experimental_condition_ontology XCO:0000403 controlled cisplatin content diet A solid diet in which the amount of cisplatin, a chemotherapy drug in which two ammine ligands and two chloro ligands are oriented in a cis planar configuration around a central platinum ion, is maintained at a specified level. Mosby:Mosbys_Medical_Dictionary--8th_Ed A solid diet in which the amount of bisphenol A is maintained at a specified level. Bisphenol A is a synthetic phenolic compound with the chemical formula (CH3)2C(C6H4OH)2, i.e. one in which a central carbon links to two methyl groups and two hydroxyphenyl groups. BPA is similar in structure to estradiol and can bind to and activate the estrogen receptor. JSmith 2014-02-28T12:23:03Z CHEBI:33216 experimental_condition_ontology controlled BPA content diet XCO:0000404 controlled bisphenol A content diet A solid diet in which the amount of bisphenol A is maintained at a specified level. Bisphenol A is a synthetic phenolic compound with the chemical formula (CH3)2C(C6H4OH)2, i.e. one in which a central carbon links to two methyl groups and two hydroxyphenyl groups. BPA is similar in structure to estradiol and can bind to and activate the estrogen receptor. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Bisphenol_A A drink made up of water and a specified amount of cisplatin consumed by an organism as part of an experiment. Cisplatin is a chemotherapy drug in which two ammine ligands and two chloro ligands are oriented in a cis planar configuration around a central platinum ion. JSmith 2014-02-28T12:48:11Z CHEBI:27899 experimental_condition_ontology XCO:0000405 controlled cisplatin content drinking water A drink made up of water and a specified amount of cisplatin consumed by an organism as part of an experiment. Cisplatin is a chemotherapy drug in which two ammine ligands and two chloro ligands are oriented in a cis planar configuration around a central platinum ion. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Cisplatin A drink made up of water and a specified amount of bisphenol A consumed by an organism as part of an experiment. Bisphenol A is a synthetic phenolic compound with the chemical formula (CH3)2C(C6H4OH)2, i.e. one in which a central carbon links to two methyl groups and two hydroxyphenyl groups. BPA is similar in structure to estradiol and can bind to and activate the estrogen receptor. JSmith 2014-02-28T12:48:15Z CHEBI:33216 experimental_condition_ontology controlled BPA content drinking water XCO:0000406 controlled bisphenol A content drinking water A drink made up of water and a specified amount of bisphenol A consumed by an organism as part of an experiment. Bisphenol A is a synthetic phenolic compound with the chemical formula (CH3)2C(C6H4OH)2, i.e. one in which a central carbon links to two methyl groups and two hydroxyphenyl groups. BPA is similar in structure to estradiol and can bind to and activate the estrogen receptor. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Bisphenol_A This is any condition in which the main influencing factor is a substance which has the ability to lower the level of glucose, particularly blood glucose, in an organism. JSmith 2014-02-28T17:14:36Z CHEBI:35526 antidiabetic drug antidiabetic agent antihyperglycemic agent experimental_condition_ontology Not4Curation XCO:0000407 hypoglycemic agent A condition in which the main influencing factor is metformin, an oral antidiabetic drug in the biguanide class which functions to supress the production of glucose by the liver (hepatic gluconeogenesis). JSmith 2014-02-28T17:17:09Z CHEBI:6801 Glucophage experimental_condition_ontology XCO:0000408 metformin A condition in which the main influencing factor is metformin, an oral antidiabetic drug in the biguanide class which functions to supress the production of glucose by the liver (hepatic gluconeogenesis). http://en.wikipedia.org/wiki/Metformin A drink made up of water and a specified amount of metformin consumed by an organism as part of an experiment. Metformin is an oral antidiabetic drug in the biguanide class which functions to supress the production of glucose by the liver (hepatic gluconeogenesis). JSmith 2014-02-28T17:27:21Z CHEBI:6801 experimental_condition_ontology XCO:0000409 controlled metformin content drinking water A drink made up of water and a specified amount of metformin consumed by an organism as part of an experiment. Metformin is an oral antidiabetic drug in the biguanide class which functions to supress the production of glucose by the liver (hepatic gluconeogenesis). Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Metformin A solid diet in which the amount of metformin, an oral antidiabetic drug in the biguanide class which functions to supress the production of glucose by the liver (hepatic gluconeogenesis), is maintained at a specified level. JSmith 2014-02-28T17:29:02Z CHEBI:6801 experimental_condition_ontology XCO:0000410 controlled metformin content diet A solid diet in which the amount of metformin, an oral antidiabetic drug in the biguanide class which functions to supress the production of glucose by the liver (hepatic gluconeogenesis), is maintained at a specified level. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Metformin Any experimental condition that is specifically related to the reproduction of the organism, that is, to the cellular, genetic, behavioral and temporal processes by which an organism produces offspring similar to itself so that the species is perpetuated. JSmith 2014-03-04T12:21:41Z experimental_condition_ontology XCO:0000411 reproduction condition Any experimental condition that is specifically related to the reproduction of the organism, that is, to the cellular, genetic, behavioral and temporal processes by which an organism produces offspring similar to itself so that the species is perpetuated. Mosby:Mosbys_Medical_Dictionary--8th_Ed The state of a female and/or her offspring, and the processes which occur, during the period from conception to birth or termination of the pregnancy. JSmith 2014-03-04T12:29:54Z experimental_condition_ontology pregnancy XCO:0000412 gestation The state of a female and/or her offspring, and the processes which occur, during the period from conception to birth or termination of the pregnancy. Farlex:Farlex_Partner_Medical_Dictionary_2012 The emergence and separation of offspring from the body of the mother. JSmith 2014-03-04T12:36:04Z experimental_condition_ontology parturition XCO:0000413 birth The emergence and separation of offspring from the body of the mother. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 The process of synthesis and secretion of milk from the mammary glands in the nourishment of offspring. JSmith 2014-03-04T12:38:40Z experimental_condition_ontology breast feeding milk production XCO:0000414 lactation The process of synthesis and secretion of milk from the mammary glands in the nourishment of offspring. Mosby:Mosbys_Medical_Dictionary--8th_Ed This is any condition in which the main influencing factor is maternal milk, the nutrient fluid produced by the mammary gland of a female mammal for the nourishment of her young and consumed by her offspring or a fosterling of the same species. JSmith 2014-03-04T12:44:39Z experimental_condition_ontology breast milk mother's milk XCO:0000415 maternal milk This is any condition in which the main influencing factor is maternal milk, the nutrient fluid produced by the mammary gland of a female mammal for the nourishment of her young and consumed by her offspring or a fosterling of the same species. Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed This is any condition in which the main influencing factor is milk, a nutrient fluid containing proteins, fats, lactose, and various vitamins and minerals produced by the mammary gland of a female mammal. JSmith 2014-03-04T12:54:50Z experimental_condition_ontology XCO:0000416 milk This is any condition in which the main influencing factor is milk, a nutrient fluid containing proteins, fats, lactose, and various vitamins and minerals produced by the mammary gland of a female mammal. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed A solid diet in which the amount of one or more phytoestrogens, any of a group of weakly estrogenic, nonsteroidal compounds widely occurring in plants, is maintained at a specified level. JSmith 2014-03-04T13:32:02Z CHEBI:76989 experimental_condition_ontology XCO:0000417 controlled phytoestrogen content diet A solid diet in which the amount of one or more phytoestrogens, any of a group of weakly estrogenic, nonsteroidal compounds widely occurring in plants, is maintained at a specified level. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed A solid diet which specifically contains no phytoestrogens, any of a group of weakly estrogenic, nonsteroidal compounds widely occurring in plants. JSmith 2014-03-04T13:35:13Z CHEBI:76989 experimental_condition_ontology XCO:0000418 phytoestrogen-free diet A solid diet which specifically contains no phytoestrogens, any of a group of weakly estrogenic, nonsteroidal compounds widely occurring in plants. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed A solid diet specifically containing no soy, that is, no derivative of soybeans, the bean of the leguminous plant, Glycine max, which contains little starch but is rich in protein and phytoestrogens. JSmith 2014-03-04T13:38:15Z experimental_condition_ontology XCO:0000419 soy-free diet A solid diet specifically containing no soy, that is, no derivative of soybeans, the bean of the leguminous plant, Glycine max, which contains little starch but is rich in protein and phytoestrogens. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed A condition in which the environment of the offspring within the uterus is controlled during any or all of the period between fertilization and parturition. JSmith 2014-03-04T13:53:44Z experimental_condition_ontology controlled gestational environment XCO:0000420 controlled in utero environment A condition in which the environment of the offspring within the uterus is controlled during any or all of the period between fertilization and parturition. Farlex:Farlex_Partner_Medical_Dictionary_2012 Any condition which occurs while an organism is still within the uterus of its mother during the gestation period. JSmith 2014-03-04T15:25:32Z experimental_condition_ontology XCO:0000421 in utero condition Any condition which occurs while an organism is still within the uterus of its mother during the gestation period. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Any condition in which the main influencing factor is a quinone, a member of a class of compounds having a fully conjugated cyclic dione structure, such as that of benzoquinones, derived from aromatic compounds by conversion of an even number of -CH= groups into -C(=O)- groups with any necessary rearrangement of double bonds. JSmith 2014-03-04T17:35:52Z CHEBI:36141 experimental_condition_ontology XCO:0000422 quinone A condition in which the main influencing factor is thymoquinone, an antioxidant phytochemical compound found in the plant Nigella sativa. Thymoquinone has the chemical formula C10H12O2 and is a 1,4-benzoquinone substituted at the 2 and 5 position with a methyl and an isopropyl group (2-Isopropyl-5-methyl- or 5-Isopropyl-2-methyl-). JSmith 2014-03-04T17:36:38Z CHEBI:113532 MESH:C003466 pubchem.compound:10281 2-isopropyl-5-methylbenzoquinone 2-methyl-5-isopropyl-p-benzoquinone 2-methyl-5-propan-2-ylcyclohexa-2,5-diene-1,4-dione dihydrothymoquinone experimental_condition_ontology XCO:0000423 thymoquinone A condition in which the main influencing factor is thymoquinone, an antioxidant phytochemical compound found in the plant Nigella sativa. Thymoquinone has the chemical formula C10H12O2 and is a 1,4-benzoquinone substituted at the 2 and 5 position with a methyl and an isopropyl group (2-Isopropyl-5-methyl- or 5-Isopropyl-2-methyl-). http://en.wikipedia.org/wiki/Thymoquinone A condition in which the main influencing factor is benfotiamine, a synthetic thioester S-acyl derivative and analogue of thiamine (vitamin B1); used as an antioxidant dietary supplement. JSmith 2014-03-04T17:48:57Z CHEBI:41039 S-benzoylthiamine O-monophosphate experimental_condition_ontology XCO:0000424 benfotiamine A condition in which the main influencing factor is benfotiamine, a synthetic thioester S-acyl derivative and analogue of thiamine (vitamin B1); used as an antioxidant dietary supplement. http://en.wikipedia.org/wiki/Benfotiamine A condition in which the main influencing factor is lactotransferrin, a multifunctional protein of the transferrin family which is a major iron-binding protein in milk and body secretions, and has antimicrobial activity. JSmith 2014-03-05T09:50:27Z lactoferrin experimental_condition_ontology LTF XCO:0000425 lactotransferrin A condition in which the main influencing factor is lactotransferrin, a multifunctional protein of the transferrin family which is a major iron-binding protein in milk and body secretions, and has antimicrobial activity. RGD:1313477 http://en.wikipedia.org/wiki/Lactoferrin This is any condition in which the main influencing factor is 1H-pyrazole, a heterocyclic organic compound with the formula C3H3N2H which is a 5-membered ring of three carbon atoms and two adjacent nitrogen centers, i.e., with nitrogens at positions 1 and 2 of the ring. 1H-pyrazole is a tautomer of 3H-pyrazole and 4H-pyrazole. Pyrazole is a core motif in many antioxidant molecules. JSmith 2014-03-05T09:52:40Z CHEBI:17241 PMID:34355092 1,2-Diazacyclopenta-2,4-diene pyrazole experimental_condition_ontology 1,2-diazole XCO:0000426 1H-pyrazole This is any condition in which the main influencing factor is 1H-pyrazole, a heterocyclic organic compound with the formula C3H3N2H which is a 5-membered ring of three carbon atoms and two adjacent nitrogen centers, i.e., with nitrogens at positions 1 and 2 of the ring. 1H-pyrazole is a tautomer of 3H-pyrazole and 4H-pyrazole. Pyrazole is a core motif in many antioxidant molecules. http://en.wikipedia.org/wiki/Pyrazole A condition in which the main influencing factor is lycopene, a bright red polyunsaturated carotenoid hydrocarbon (i.e. a carotene) with the formula C40H56. Lycopene is a tetraterpene assembled from eight isoprene units and has antioxidant activity. JSmith 2014-03-05T09:54:44Z CHEBI:15948 experimental_condition_ontology XCO:0000427 lycopene A condition in which the main influencing factor is lycopene, a bright red polyunsaturated carotenoid hydrocarbon (i.e. a carotene) with the formula C40H56. Lycopene is a tetraterpene assembled from eight isoprene units and has antioxidant activity. http://en.wikipedia.org/wiki/Lycopene This is any condition in which the main influencing factor is fructose, a monosaccharide isomer of glucose which, although it is a 6-carbon sugar (hexose), generally exists as a 5-member hemiketal ring. Fructose is one of three dietary monosaccharides, along with glucose and galactose, that are absorbed directly into the bloodstream during digestion. JSmith 2014-03-05T10:26:45Z CHEBI:15824 CHEBI:28757 experimental_condition_ontology XCO:0000428 fructose This is any condition in which the main influencing factor is fructose, a monosaccharide isomer of glucose which, although it is a 6-carbon sugar (hexose), generally exists as a 5-member hemiketal ring. Fructose is one of three dietary monosaccharides, along with glucose and galactose, that are absorbed directly into the bloodstream during digestion. http://en.wikipedia.org/wiki/Fructose This is any condition in which the main influencing factor is a drink made up of water and a specified amount of fructose consumed by a subject. Fructose is one of three dietary monosaccharides that are absorbed directly into the bloodstream during digestion. JSmith 2014-03-05T10:27:59Z PMID:33790226 experimental_condition_ontology XCO:0000429 controlled fructose content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of fructose consumed by a subject. Fructose is one of three dietary monosaccharides that are absorbed directly into the bloodstream during digestion. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Fructose This is any condition in which the main influencing factor is silymarin, a strongly antioxidant mixture of flavonolignans extracted from the milk thistle plant (Silybum marianum). The components or silymarin are capable of scavenging both free radicals and reactive oxygen species (ROS). JSmith 2014-03-05T10:39:11Z experimental_condition_ontology XCO:0000430 silymarin This is any condition in which the main influencing factor is silymarin, a strongly antioxidant mixture of flavonolignans extracted from the milk thistle plant (Silybum marianum). The components or silymarin are capable of scavenging both free radicals and reactive oxygen species (ROS). PMID:24145092 Any condition in which the main influencing factor is a disaccharide, a member of the class of sugars that yield two monosaccharide molecules upon hydrolysis. JSmith 2014-03-07T10:28:37Z experimental_condition_ontology XCO:0000431 disaccharide Any condition in which the main influencing factor is a disaccharide, a member of the class of sugars that yield two monosaccharide molecules upon hydrolysis. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Any condition in which the main influencing factor is sucrose, a nonreducing disaccharide of glucose and fructose used as a food, a sweetener, a preservative and a pharmaceutical aid. JSmith 2014-03-07T10:31:32Z CHEBI:17992 experimental_condition_ontology XCO:0000432 sucrose Any condition in which the main influencing factor is sucrose, a nonreducing disaccharide of glucose and fructose used as a food, a sweetener, a preservative and a pharmaceutical aid. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A drink made up of water and a specified amount of sucrose consumed by an organism as part of an experiment. Sucrose is a nonreducing disaccharide of glucose and fructose used as a food, a sweetener, a preservative and a pharmaceutical aid. JSmith 2014-03-07T10:33:57Z CHEBI:17992 experimental_condition_ontology XCO:0000433 controlled sucrose content drinking water A drink made up of water and a specified amount of sucrose consumed by an organism as part of an experiment. Sucrose is a nonreducing disaccharide of glucose and fructose used as a food, a sweetener, a preservative and a pharmaceutical aid. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Condition in which the main influencing factor is octylphenol, a phenolic ring with an 8-carbon side chain. JSmith 2014-03-07T13:09:25Z CHEBI:34432 experimental_condition_ontology XCO:0000434 octylphenol This is any condition in which the main influencing factor is any chemical that inhibits or prevents the proliferation of neoplasms. JSmith 2014-03-12T13:30:22Z CHEBI:35610 experimental_condition_ontology anticancer agent cancer chemotherapy agent XCO:0000435 antineoplastic agent A solid diet in which the amount of N-propyl-N-nitrosourea (PNU) is maintained at a specified level. PNU is a mutation-inducing chemical with three major moieties, a propyl group (-C3H7), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group). JSMITH 2014-04-17T12:42:14Z controlled 1-nitroso-1-propylurea content diet controlled propylnitrosourea content diet experimental_condition_ontology controlled 1-propyl-1-nitrosourea content diet controlled PNU content diet XCO:0000436 controlled N-propyl-N-nitrosourea content diet A solid diet in which the amount of N-propyl-N-nitrosourea (PNU) is maintained at a specified level. PNU is a mutation-inducing chemical with three major moieties, a propyl group (-C3H7), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group). Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Nitrosourea pubchem.compound:13157 A drink made up of water and a specified amount of N-propyl-N-nitrosourea (PNU) consumed by an organism as part of an experiment. PNU is a mutation-inducing chemical with three major moieties, a propyl group (-C3H7), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group). JSMITH 2014-04-17T12:42:20Z controlled 1-nitroso-1-propylurea content drinking water controlled propylnitrosourea content drinking water experimental_condition_ontology controlled 1-propyl-1-nitrosourea content drinking water controlled PNU content drinking water XCO:0000437 controlled N-propyl-N-nitrosourea content drinking water A drink made up of water and a specified amount of N-propyl-N-nitrosourea (PNU) consumed by an organism as part of an experiment. PNU is a mutation-inducing chemical with three major moieties, a propyl group (-C3H7), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group). Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Nitrosourea pubchem.compound:13157 A condition in which the main influencing factor is candesartan, the angiotensin II receptor 1 (AT1) antagonist which exhibits antihypertensive effects in animal models. JSMITH 2014-04-17T13:11:54Z CHEBI:3348 MESH:C081643 2-Ethoxy-1-[[2'-(2H-tetrazol-5-yl)[1,1'-biphenyl]-4-yl]methyl]-1H-benzimidazole-7-carboxylic acid 1-[[(cyclohexyloxy)carbonyl]oxy]ethyl ester TCV-116 experimental_condition_ontology XCO:0000438 candesartan A condition in which the main influencing factor is candesartan, the angiotensin II receptor 1 (AT1) antagonist which exhibits antihypertensive effects in animal models. http://en.wikipedia.org/wiki/Candesartan A drink made up of water and a specified amount of 3-methyl-4'-dimethylaminoazobenzene (MDAB), a substituted azobenzene compound that acts as a potent liver carcinogen, consumed by an organism as part of an experiment. JSMITH 2014-04-17T15:49:17Z CHEBI:76329 controlled 4-Dimethylamino-3'-methylazobenzene content drinking water controlled methyldimethylaminoazobenzene content drinking water experimental_condition_ontology controlled 3'-Me-DAB content drinking water controlled 3'-methyl-4-(dimethylamino)azobenzene content drinking water controlled MDAB content drinking water XCO:0000439 controlled 3-methyl-4'-dimethylaminoazobenzene content drinking water A drink made up of water and a specified amount of 3-methyl-4'-dimethylaminoazobenzene (MDAB), a substituted azobenzene compound that acts as a potent liver carcinogen, consumed by an organism as part of an experiment. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://potency.berkeley.edu/chempages/3%27-METHYL-4-DIMETHYLAMINOAZOBENZENE.html A solid diet in which the amount of 3'-methyl-4-dimethylaminoazobenzene (MDAB), a substituted azobenzene compound that acts as a potent liver carcinogen, is maintained at a specified level. JSMITH 2014-04-17T15:49:21Z CHEBI:76329 controlled 3'-methyl-4-(dimethylamino)azobenzene content diet controlled 4-Dimethylamino-3'-methylazobenzene content diet controlled methyldimethylaminoazobenzene content diet experimental_condition_ontology controlled 3'-Me-DAB content diet controlled MDAB content diet XCO:0000440 controlled 3-methyl-4'-dimethylaminoazobenzene content diet A solid diet in which the amount of 3'-methyl-4-dimethylaminoazobenzene (MDAB), a substituted azobenzene compound that acts as a potent liver carcinogen, is maintained at a specified level. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://potency.berkeley.edu/chempages/3%27-METHYL-4-DIMETHYLAMINOAZOBENZENE.html This is any condition in which the main influencing factor is a drink made up of water and a specified amount of 2-acetamidofluorene, a substituted ortho-fused polycyclic arene that is a carcinogenic and mutagenic derivative of fluorene, consumed by a subject. JSMITH 2014-04-17T16:31:36Z CHEBI:17356 experimental_condition_ontology controlled 2-AAF content drinking water controlled 2-acetylaminofluorene content drinking water XCO:0000441 controlled 2-acetamidofluorene content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of 2-acetamidofluorene, a substituted ortho-fused polycyclic arene that is a carcinogenic and mutagenic derivative of fluorene, consumed by a subject. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://en.wikipedia.org/wiki/Acetylaminofluorene A solid diet in which the amount of 2-acetamidofluorene, a substituted ortho-fused polycyclic arene that is a carcinogenic and mutagenic derivative of fluorene, is maintained at a specified level. JSMITH 2014-04-17T16:31:40Z CHEBI:17356 experimental_condition_ontology controlled 2-AAF content diet controlled 2-acetylaminofluorene content diet XCO:0000442 controlled 2-acetamidofluorene content diet A solid diet in which the amount of 2-acetamidofluorene, a substituted ortho-fused polycyclic arene that is a carcinogenic and mutagenic derivative of fluorene, is maintained at a specified level. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Acetylaminofluorene A solid diet in which the amount of dexamethasone (DEX) is maintained at a specified level. DEX is a long-acting synthetic adrenocorticoid, analogous to but more potent than cortisol (a natural hormone produced by the adrenal glands), with anti-inflammatory and immunosuppressant activities. JSmith 2014-04-24T13:35:39Z experimental_condition_ontology controlled DEX content diet XCO:0000443 controlled dexamethasone content diet A solid diet in which the amount of dexamethasone (DEX) is maintained at a specified level. DEX is a long-acting synthetic adrenocorticoid, analogous to but more potent than cortisol (a natural hormone produced by the adrenal glands), with anti-inflammatory and immunosuppressant activities. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Dexamethasone http://www.nlm.nih.gov/medlineplus/druginfo/meds/a682792.html A drink made up of water and a specified amount of dexamethasone (DEX) consumed by an organism as part of an experiment. DEX is a long-acting synthetic adrenocorticoid, analogous to but more potent than cortisol (a natural hormone produced by the adrenal glands), with anti-inflammatory and immunosuppressant activities. JSmith 2014-04-24T13:35:46Z experimental_condition_ontology controlled DEX content drinking water XCO:0000444 controlled dexamethasone content drinking water A drink made up of water and a specified amount of dexamethasone (DEX) consumed by an organism as part of an experiment. DEX is a long-acting synthetic adrenocorticoid, analogous to but more potent than cortisol (a natural hormone produced by the adrenal glands), with anti-inflammatory and immunosuppressant activities. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Dexamethasone http://www.nlm.nih.gov/medlineplus/druginfo/meds/a682792.html A relatively standardized solution of sodium chloride to which one or more phosphate salts have been added to maintain a neutral pH. PBS is isotonic, that is, the ionic strength of PBS is close to that inside living cells. JSmith 2014-04-24T14:08:08Z CHEBI:26020 CHEBI:26710 CHEBI:35225 experimental_condition_ontology PBS phosphate-buffer sodium chloride solution XCO:0000445 phosphate buffered saline A relatively standardized solution of sodium chloride to which one or more phosphate salts have been added to maintain a neutral pH. PBS is isotonic, that is, the ionic strength of PBS is close to that inside living cells. http://en.wikipedia.org/wiki/Phosphate_buffered_saline One of the two types of reproductive cycles. Specifically, the correlated phenomena of the endocrine and reproductive systems of a female (especially, non-primate) mammal resulting in regularly occurring periods during which the female is sexually active and receptive, estrus, separated by periods in which there is no sexual receptivity. JSmith 2014-05-15T18:09:42Z estrous cycle experimental_condition_ontology estral cycle XCO:0000446 estrus cycle One of the two types of reproductive cycles. Specifically, the correlated phenomena of the endocrine and reproductive systems of a female (especially, non-primate) mammal resulting in regularly occurring periods during which the female is sexually active and receptive, estrus, separated by periods in which there is no sexual receptivity. Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed A regularly recurrent state of sexual excitability during which the female of non-primate mammalian species will accept the male and is capable of conceiving. JSmith 2014-05-15T18:16:20Z oestrus experimental_condition_ontology estrous heat XCO:0000447 estrus A regularly recurrent state of sexual excitability during which the female of non-primate mammalian species will accept the male and is capable of conceiving. Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed Mosby:Mosbys_Medical_Dictionary--8th_Ed The period of regression and sexual inactivity in females of non-primate mammalian species between estrus and diestrus. JSmith 2014-05-15T18:25:00Z experimental_condition_ontology metestrous XCO:0000448 metestrus The period of regression and sexual inactivity in females of non-primate mammalian species between estrus and diestrus. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed A period of sexual quiescence that intervenes between two periods of estrus in females of non-primate mammalian species between. In general during diestrus blood levels of estrogens are minimal, progesterone levels are high and the physiological state in the uterus is most conducive for implantation and growth of the developing fetus. JSmith 2014-05-15T18:29:26Z experimental_condition_ontology diestrous XCO:0000449 diestrus A period of sexual quiescence that intervenes between two periods of estrus in females of non-primate mammalian species between. In general during diestrus blood levels of estrogens are minimal, progesterone levels are high and the physiological state in the uterus is most conducive for implantation and growth of the developing fetus. Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed A preparatory period immediately preceding estrus and characterized by growth of graafian follicles, increased estrogenic activity, and alteration of uterine and vaginal mucosa. JSmith 2014-05-15T18:33:04Z experimental_condition_ontology proestrous XCO:0000450 proestrus A preparatory period immediately preceding estrus and characterized by growth of graafian follicles, increased estrogenic activity, and alteration of uterine and vaginal mucosa. Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed A condition in which the main influencing factor is a neurotropic virus that is a member of the Herpesviridae family and that, once the infection becomes chronic, has the ability to cycle through recurring outbreak periods followed by periods of latency or dormancy in which the virus is inactive but still present in infected nerve cells. HSV1 causes primarily mouth, throat, face, eye, and central nervous system infections. JSmith 2014-05-15T19:05:50Z experimental_condition_ontology HSV-1 Herpes simplex virus 1 XCO:0000451 Herpes simplex virus type 1 A condition in which the main influencing factor is a neurotropic virus that is a member of the Herpesviridae family and that, once the infection becomes chronic, has the ability to cycle through recurring outbreak periods followed by periods of latency or dormancy in which the virus is inactive but still present in infected nerve cells. HSV1 causes primarily mouth, throat, face, eye, and central nervous system infections. http://en.wikipedia.org/wiki/Herpes_simplex_virus A solid diet in which the amount of casein is maintained at a specified level. Casein, a phosphoprotein, is the principle protein component of milk. JSmith 2014-06-12T17:25:24Z experimental_condition_ontology controlled caseinogen content diet XCO:0000452 controlled casein content diet A solid diet in which the amount of casein is maintained at a specified level. Casein, a phosphoprotein, is the principle protein component of milk. Mosby:Mosbys_Medical_Dictionary--8th_Ed This is a solid diet in which the amount of butter is maintained at a specified level. Butter is a soft yellowish or whitish emulsion of milk fat, water and air, churned from milk or cream and processed for use in cooking and as a food. JSmith 2014-06-12T17:27:00Z experimental_condition_ontology XCO:0000453 controlled butter content diet This is a solid diet in which the amount of butter is maintained at a specified level. Butter is a soft yellowish or whitish emulsion of milk fat, water and air, churned from milk or cream and processed for use in cooking and as a food. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Mosby:Mosbys_Medical_Dictionary--8th_Ed A solid diet in which the amount of a specified oil is maintained at a specified level. An oil is any unctuous, combustible substance that is liquid, or easily liquefiable, on warming, and is soluble in ether but not in water. Oils may be animal, vegetable, or mineral in origin. JSmith 2014-06-12T17:27:48Z experimental_condition_ontology XCO:0000454 controlled oil content diet A solid diet in which the amount of a specified oil is maintained at a specified level. An oil is any unctuous, combustible substance that is liquid, or easily liquefiable, on warming, and is soluble in ether but not in water. Oils may be animal, vegetable, or mineral in origin. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed A solid diet in which the amount of corn oil is maintained at a specified level. Corn oil is a refined fixed, that is, nonvolatile, oil obtained from corn, the embryo of Zea mays plant. It is sometimes promoted as a good source of polyunsaturated fatty acids. JSmith 2014-06-12T17:28:44Z experimental_condition_ontology XCO:0000455 controlled corn oil content diet A solid diet in which the amount of corn oil is maintained at a specified level. Corn oil is a refined fixed, that is, nonvolatile, oil obtained from corn, the embryo of Zea mays plant. It is sometimes promoted as a good source of polyunsaturated fatty acids. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed Any condition in which the primary influencing agent is retinyl palmitate, the synthetic ester of retinol (vitamin A) and palmitic acid, with formula C36H60O2. JSmith 2014-06-12T17:56:00Z experimental_condition_ontology retinol palmitate XCO:0000456 retinyl palmitate Any condition in which the primary influencing agent is retinyl palmitate, the synthetic ester of retinol (vitamin A) and palmitic acid, with formula C36H60O2. http://en.wikipedia.org/wiki/Retinyl_palmitate A solid diet in which the amount of any retinoid is maintained at a specified level. Retinoids comprise retinal, retinol and any structurally similar natural derivative or synthetic compound, with or without vitamin A activity. JSmith 2014-06-12T17:57:57Z controlled vitamin A content diet experimental_condition_ontology XCO:0000457 controlled retinoid content diet A solid diet in which the amount of any retinoid is maintained at a specified level. Retinoids comprise retinal, retinol and any structurally similar natural derivative or synthetic compound, with or without vitamin A activity. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Mosby:Mosbys_Medical_Dictionary--8th_Ed A solid diet in which the amount of retinyl palmitate is maintained at a specified level. Retinyl palmitate is the synthetic ester of retinol (vitamin A) and palmitic acid, with formula C36H60O2. JSmith 2014-06-12T17:59:02Z experimental_condition_ontology controlled retinol palmitate content diet XCO:0000458 controlled retinyl palmitate content diet A solid diet in which the amount of retinyl palmitate is maintained at a specified level. Retinyl palmitate is the synthetic ester of retinol (vitamin A) and palmitic acid, with formula C36H60O2. Mosby:Mosbys_Medical_Dictionary--8th_Ed http://en.wikipedia.org/wiki/Retinyl_palmitate This is any condition in which the main influencing factor is a controlled light/dark cycle in which an organism experiences multiple periods of controlled ambient light followed by exposure to darkness. JSmith 2014-06-17T16:30:05Z experimental_condition_ontology XCO:0000459 controlled light/dark cycle This is any condition in which the main influencing factor is a controlled light/dark cycle in which an organism experiences multiple periods of controlled ambient light followed by exposure to darkness. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Induction and/or maintenance of a hollow cavity beneath the skin between the scapulae (the flat triangular bones at the top or back of the shoulder), by injection or other introduction of a specified volume of air. Experimental air pouches are often used to encapsulate foreign cells or other substances. JSmith 2014-06-17T17:19:15Z experimental_condition_ontology XCO:0000460 subcutaneous interscapular air pouch Induction and/or maintenance of a hollow cavity beneath the skin between the scapulae (the flat triangular bones at the top or back of the shoulder), by injection or other introduction of a specified volume of air. Experimental air pouches are often used to encapsulate foreign cells or other substances. PMID:17277140 PMID:7019400 Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed A dietary regimen in which access to food is limited, e.g. to a specified number of hours per day or to a specified part of the light-dark cycle, with or without restrictions in the amount or type of food available when feeding is allowed. JSmith 2014-06-23T16:24:46Z food restriction TRF time-restricted feeding experimental_condition_ontology XCO:0000461 restricted feeding A dietary regimen in which access to food is limited, e.g. to a specified number of hours per day or to a specified part of the light-dark cycle, with or without restrictions in the amount or type of food available when feeding is allowed. PMID:24739093 The portion of a controlled light/dark cycle in which the subject is exposed to ambient light (that is, during which the room is lit). A controlled light/dark cycle is a recurring series of conditions in which an organism experiences successive periods of exposure to controlled ambient light followed by exposure to darkness, the lack of such light, which is in turn followed by exposure to controlled ambient light and so forth. JSmith 2014-08-26T13:10:29Z experimental_condition_ontology XCO:0000462 light phase of controlled light/dark cycle The portion of a controlled light/dark cycle in which the subject is exposed to ambient light (that is, during which the room is lit). A controlled light/dark cycle is a recurring series of conditions in which an organism experiences successive periods of exposure to controlled ambient light followed by exposure to darkness, the lack of such light, which is in turn followed by exposure to controlled ambient light and so forth. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition in which the main influencing factor is the part of a controlled light/dark cycle when the subject is not being exposed to ambient light (that is, during the dark phase of the cycle). A controlled light/dark cycle is a recurring series of conditions in which an organism experiences periods of controlled ambient light followed by periods of darkness. JSmith 2014-08-26T13:12:48Z experimental_condition_ontology XCO:0000463 dark phase of controlled light/dark cycle This is any condition in which the main influencing factor is the part of a controlled light/dark cycle when the subject is not being exposed to ambient light (that is, during the dark phase of the cycle). A controlled light/dark cycle is a recurring series of conditions in which an organism experiences periods of controlled ambient light followed by periods of darkness. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Any experimental condition in which the internal or external environment of an organ, that is, a differentiated, structural part of a system of the body that performs a specific function, is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body. JSmith 2015-01-13T12:48:26Z experimental_condition_ontology XCO:0000464 controlled ex vivo organ condition Any experimental condition in which the internal or external environment of an organ, that is, a differentiated, structural part of a system of the body that performs a specific function, is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body. Farlex:Farlex_Partner_Medical_Dictionary_2012 Mosby:Mosbys_Medical_Dictionary--8th_Ed Any experimental condition in which the internal or external environment of an artery, one of the large blood vessels carrying blood in a direction away from the heart to the tissues, is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body. JSmith 2015-01-13T12:59:22Z experimental_condition_ontology XCO:0000465 controlled ex vivo artery condition Any experimental condition in which the internal or external environment of an artery, one of the large blood vessels carrying blood in a direction away from the heart to the tissues, is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body. Farlex:Farlex_Partner_Medical_Dictionary_2012 Mosby:Mosbys_Medical_Dictionary--8th_Ed A condition in which the pressure, or force per area, exerted by a perfusate against the walls of an artery after removal from the body but while the tissue is still viable, is regulated or maintained at a specified level. JSmith 2015-01-13T13:16:48Z controlled ex vivo artery intraluminal pressure experimental_condition_ontology XCO:0000466 controlled ex vivo artery perfusion pressure A condition in which the pressure, or force per area, exerted by a perfusate against the walls of an artery after removal from the body but while the tissue is still viable, is regulated or maintained at a specified level. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed Farlex:Farlex_Partner_Medical_Dictionary_2012 ISBN:978-1416049982 Condition in which the main influencing factor is a retinoid, any of a group of compounds containing 20 carbon atoms and structurally related to retinal, retinol, and other substances, some of which exhibit vitamin A activity. JSmith 2015-03-06T18:09:40Z CHEBI:26537 experimental_condition_ontology XCO:0000467 retinoid Condition in which the main influencing factor is a retinoid, any of a group of compounds containing 20 carbon atoms and structurally related to retinal, retinol, and other substances, some of which exhibit vitamin A activity. Mosby:Mosbys_Medical_Dictionary--8th_Ed Condition in which the main influencing factor is vitamin A, a group of fat-soluble retinoids produced via metabolism of provitamin A carotenoids. Vitamin A is involved in immune function, vision, reproduction, and cellular communication. JSmith 2015-03-06T18:11:00Z CHEBI:12777 experimental_condition_ontology XCO:0000468 vitamin A Condition in which the main influencing factor is vitamin A, a group of fat-soluble retinoids produced via metabolism of provitamin A carotenoids. Vitamin A is involved in immune function, vision, reproduction, and cellular communication. http://en.wikipedia.org/wiki/Vitamin_A https://ods.od.nih.gov/factsheets/VitaminA-Consumer/ Condition in which the main influencing factor is isotretinoin, a synthetic first generation retinoid compound used for the treatment of severe cases of acne and other skin diseases. JSmith 2015-03-06T18:13:57Z CHEBI:6067 13-cis-retinoic acid 13cRA Accutane experimental_condition_ontology Roaccutane XCO:0000469 isotretinoin Condition in which the main influencing factor is isotretinoin, a synthetic first generation retinoid compound used for the treatment of severe cases of acne and other skin diseases. http://en.wikipedia.org/wiki/Retinoid Condition in which the main influencing factor is a flavonoid, any of a class of plant secondary metabolites that have the general structure of a 15-carbon skeleton, which consists of two phenyl rings (A and B) and a heterocyclic ring (C). JSmith 2015-03-06T18:16:29Z experimental_condition_ontology bioflavonoid XCO:0000470 flavonoid Condition in which the main influencing factor is a flavonoid, any of a class of plant secondary metabolites that have the general structure of a 15-carbon skeleton, which consists of two phenyl rings (A and B) and a heterocyclic ring (C). http://en.wikipedia.org/wiki/Flavonoid Condition in which the main influencing factor is quercetin, a pentahydroxyflavone having the five hydroxy groups placed at the 3-, 3'-, 4'-, 5- and 7-positions. It is a yellow flavonoid pigment found in oak bark, the juice of lemons, asparagus, and other fruits and vegetables and is used to reduce abnormal capillary fragility. JSmith 2015-03-06T18:17:55Z CHEBI:16243 experimental_condition_ontology meletin XCO:0000471 quercetin Condition in which the main influencing factor is quercetin, a pentahydroxyflavone having the five hydroxy groups placed at the 3-, 3'-, 4'-, 5- and 7-positions. It is a yellow flavonoid pigment found in oak bark, the juice of lemons, asparagus, and other fruits and vegetables and is used to reduce abnormal capillary fragility. Mosby:Mosbys_Medical_Dictionary--8th_Ed Condition in which the main influencing factor is chrysin, a dihydroxyflavone in which the two hydroxy groups are located at positions 5 and 7. JSmith 2015-03-06T18:19:02Z CHEBI:75095 experimental_condition_ontology 5,7-dihydroxyflavone XCO:0000472 chrysin Condition in which the main influencing factor is naringenin, a trihydroxyflavanone that is flavanone substituted by hydroxy groups at positions 5, 6 and 4'. Naringenin is the predominant flavanone in grapefruit and has demonstrated inhibitory activity against the CYP1A2 cytochrome P450 isoform. JSmith 2015-03-06T18:20:06Z CHEBI:50202 experimental_condition_ontology XCO:0000473 naringenin Condition in which the main influencing factor is naringenin, a trihydroxyflavanone that is flavanone substituted by hydroxy groups at positions 5, 6 and 4'. Naringenin is the predominant flavanone in grapefruit and has demonstrated inhibitory activity against the CYP1A2 cytochrome P450 isoform. http://en.wikipedia.org/wiki/Naringenin Condition in which the main influencing factor is alendronate (the anionic form of alendronic acid), a bisphosphonate drug used for osteoporosis and several other bone diseases, because it inhibits osteoclast-mediated bone-resorption. JSmith 2015-03-06T18:29:05Z CHEBI:2567 CHEBI:50647 Binosto Fosamax sodium alendronate experimental_condition_ontology alendronic acid XCO:0000474 alendronate Condition in which the main influencing factor is alendronate (the anionic form of alendronic acid), a bisphosphonate drug used for osteoporosis and several other bone diseases, because it inhibits osteoclast-mediated bone-resorption. http://en.wikipedia.org/wiki/Alendronic_acid Any condition in which the primary influencing agent is a bacterial pathogen, a disease-causing unicellular prokaryotic microorganism that commonly multiplies by cell division, lacks a nucleus or membrane-bound organelles, and generally has a cell wall. JSmith 2015-04-29T14:14:39Z experimental_condition_ontology pathogenic bacteria XCO:0000475 bacterial pathogen Any condition in which the primary influencing agent is a bacterial pathogen, a disease-causing unicellular prokaryotic microorganism that commonly multiplies by cell division, lacks a nucleus or membrane-bound organelles, and generally has a cell wall. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the primary influencing factor is Streptococcus pneumoniae, a species of Gram-positive, alpha-hemolytic, facultative anaerobic bacteria commonly found in the nasopharynx of healthy human carriers. JSmith 2015-04-30T13:35:44Z NCBITaxon:1313 experimental_condition_ontology XCO:0000476 Streptococcus pneumoniae A condition in which the primary influencing factor is Streptococcus pneumoniae, a species of Gram-positive, alpha-hemolytic, facultative anaerobic bacteria commonly found in the nasopharynx of healthy human carriers. http://en.wikipedia.org/wiki/Streptococcus_pneumoniae This is any condition in which the main influencing factor is Streptococcus pneumoniae D39, a potentially virulent strain of the S. pneumoniae species of Gram-positive, alpha-hemolytic, facultative anaerobic bacteria commonly found in the nasopharynx of healthy human carriers. JSmith 2015-04-30T13:36:39Z NCBITaxon:373153 Streptococcus pneumoniae serotype 2, strain D39 Streptococcus pneumoniae strain D39 experimental_condition_ontology XCO:0000477 Streptococcus pneumoniae D39 This is any condition in which the main influencing factor is Streptococcus pneumoniae D39, a potentially virulent strain of the S. pneumoniae species of Gram-positive, alpha-hemolytic, facultative anaerobic bacteria commonly found in the nasopharynx of healthy human carriers. http://en.wikipedia.org/wiki/Streptococcus_pneumoniae This is any condition in which the main influencing factor is Streptococcus pneumoniae TIGR4, a potentially virulent strain of the S. pneumoniae species of Gram-positive, alpha-hemolytic, facultative anaerobic bacteria commonly found in the nasopharynx of healthy human carriers. JSmith 2015-04-30T13:38:57Z NCBITaxon:170187 Streptococcus pneumoniae strain TIGR4 experimental_condition_ontology XCO:0000478 Streptococcus pneumoniae TIGR4 This is any condition in which the main influencing factor is Streptococcus pneumoniae TIGR4, a potentially virulent strain of the S. pneumoniae species of Gram-positive, alpha-hemolytic, facultative anaerobic bacteria commonly found in the nasopharynx of healthy human carriers. http://en.wikipedia.org/wiki/Streptococcus_pneumoniae A condition in which the primary influencing factor is Haemophilus influenzae, a Gram-negative, coccobacillary, facultatively anaerobic bacterium which is considered an opportunistic pathogen, i.e. one that can colonize a host without causing disease unless there are extenuating circumstances which result in susceptibility on the part of the host. JSmith 2015-04-30T13:41:32Z NCBITaxon:727 experimental_condition_ontology XCO:0000479 Haemophilus influenzae A condition in which the primary influencing factor is Haemophilus influenzae, a Gram-negative, coccobacillary, facultatively anaerobic bacterium which is considered an opportunistic pathogen, i.e. one that can colonize a host without causing disease unless there are extenuating circumstances which result in susceptibility on the part of the host. http://en.wikipedia.org/wiki/Haemophilus_influenzae A condition in which the primary influencing factor is one or more nontypeable strain(s) of Haemophilus influenzae (NTHi). NTHi refers to any unencapsulated strain of the Gram-negative, coccobacillary, facultatively anaerobic bacterium species Haemophilus influenza. Such bacteria lack the capsular antigens used to serotype strains and therefore cannot be classified by serology. NTHi strains are the important pathogens in chronic and recurrent otitis media in children. JSmith 2015-04-30T13:42:32Z experimental_condition_ontology NTHi XCO:0000480 nontypeable Haemophilus influenzae A condition in which the primary influencing factor is one or more nontypeable strain(s) of Haemophilus influenzae (NTHi). NTHi refers to any unencapsulated strain of the Gram-negative, coccobacillary, facultatively anaerobic bacterium species Haemophilus influenza. Such bacteria lack the capsular antigens used to serotype strains and therefore cannot be classified by serology. NTHi strains are the important pathogens in chronic and recurrent otitis media in children. PMID:15968074 http://en.wikipedia.org/wiki/Haemophilus_influenzae A condition in which the primary influencing factor is the 86-028NP strain of Haemophilus influenzae. 86-028NP is a pathogenic, nontypeable H. influenzae strain isolated from the nasopharynx of a child with chronic otitis media. JSmith 2015-04-30T13:48:27Z NCBITaxon:281310 Haemophilus influenzae strain 86-028NP experimental_condition_ontology 86028NP NTHi 86-028NP XCO:0000481 Haemophilus influenzae 86-028NP A condition in which the primary influencing factor is the 86-028NP strain of Haemophilus influenzae. 86-028NP is a pathogenic, nontypeable H. influenzae strain isolated from the nasopharynx of a child with chronic otitis media. PMID:15968074 http://en.wikipedia.org/wiki/Haemophilus_influenzae A substance that kills or slows the growth of one or more microorganisms, including bacteria, viruses, fungi and protozoans. JSmith 2015-04-30T14:25:42Z CHEBI:33281 experimental_condition_ontology antibiotic XCO:0000482 antimicrobial agent This is any condition in which the main influencing factor is an antibacterial agent, a substance that kills or slows the growth of bacteria, unicellular prokaryotic microorganisms that commonly multiply by cell division, lack a nucleus or membrane-bound organelles, and generally have a cell wall. JSmith 2015-04-30T14:31:11Z CHEBI:33282 experimental_condition_ontology XCO:0000483 antibacterial agent This is any condition in which the main influencing factor is an antibacterial agent, a substance that kills or slows the growth of bacteria, unicellular prokaryotic microorganisms that commonly multiply by cell division, lack a nucleus or membrane-bound organelles, and generally have a cell wall. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition in which the main influencing factor is ceftriaxone, a third-generation cephalosporin antibacterial agent with broad-spectrum activity against both Gram-positive and Gram-negative bacteria. JSmith 2015-04-30T14:44:33Z CHEBI:29007 experimental_condition_ontology XCO:0000484 ceftriaxone This is any condition in which the main influencing factor is ceftriaxone, a third-generation cephalosporin antibacterial agent with broad-spectrum activity against both Gram-positive and Gram-negative bacteria. http://en.wikipedia.org/wiki/Ceftriaxone A condition in which the primary influencing factor is the H2 mutant of the 86-028NP strain of Haemophilus influenzae. JSmith 2015-05-14T17:54:23Z NCBITaxon:281310 Haemophilus influenzae mutant strain 86-028NP-H2 experimental_condition_ontology 86H2 NTHi 86-028NP H2 mutant XCO:0000485 Haemophilus influenzae 86-028NP H2 mutant A condition in which the primary influencing factor is the H2 mutant of the 86-028NP strain of Haemophilus influenzae. RGD:JRS A condition in which the primary influencing factor is the C5 mutant of the 86-028NP strain of Haemophilus influenzae. JSmith 2015-05-14T17:58:28Z NCBITaxon:281310 Haemophilus influenzae mutant strain 86-028NP-C5 experimental_condition_ontology 86C5 NTHi 86-028NP C5 mutant XCO:0000486 Haemophilus influenzae 86-028NP C5 mutant A condition in which the primary influencing factor is the C5 mutant of the 86-028NP strain of Haemophilus influenzae. RGD:JRS A condition in which the primary influencing factor is the LuxS mutant of Streptococcus pneumoniae TIGR4. JSmith 2015-05-14T17:59:26Z NCBITaxon:170187 Streptococcus pneumoniae mutant strain TIGR4luxS experimental_condition_ontology TIGR4luxS XCO:0000487 Streptococcus pneumoniae TIGR4 LuxS mutant A condition in which the primary influencing factor is the LuxS mutant of Streptococcus pneumoniae TIGR4. RGD:JRS Any condition related to or affecting the external interactions and relationships of a single organism, between single organisms, or within or between groups of organisms. jesmith 2015-12-07T15:12:14Z experimental_condition_ontology social context condition XCO:0000488 social environment condition Any condition related to or affecting the external interactions and relationships of a single organism, between single organisms, or within or between groups of organisms. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed Any condition in which the social environment of an organism is set or changed for a specified and/or limited period of time. jesmith 2015-12-07T15:40:22Z experimental_condition_ontology XCO:0000489 temporary social environment condition Any condition in which the social environment of an organism is set or changed for a specified and/or limited period of time. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed Any condition in which the social environment of an organism is set or changed for an extended period of time or on a continual basis. jesmith 2015-12-07T15:56:22Z experimental_condition_ontology XCO:0000490 ongoing social environment condition Any condition in which the social environment of an organism is set or changed for an extended period of time or on a continual basis. Collins:Collins_Online_English_Dictionary This is any condition in which the main influencing factor is controlled social contact with an organism from the same species. A species is a fundamental category of taxonomic classification, ranking below a genus and consisting of related organisms capable of interbreeding. jesmith 2015-12-07T15:59:02Z experimental_condition_ontology XCO:0000491 controlled exposure to an organism of the same species This is any condition in which the main influencing factor is controlled social contact with an organism from the same species. A species is a fundamental category of taxonomic classification, ranking below a genus and consisting of related organisms capable of interbreeding. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 This is an experimental condition in which a test subject is placed in social contact with a juvenile (young, not yet mature, not fully grown and/or not fully developed) organism from the same species. jesmith 2015-12-07T16:11:18Z controlled exposure to an adolescent of the same species experimental_condition_ontology XCO:0000492 controlled exposure to a juvenile of the same species This is an experimental condition in which a test subject is placed in social contact with a juvenile (young, not yet mature, not fully grown and/or not fully developed) organism from the same species. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed https://www.merriam-webster.com An experimental condition in which a test subject is placed in social contact with an adult (an organism that is fully developed and has reached physical and/or sexual maturity) from the same species. jesmith 2015-12-07T16:18:25Z experimental_condition_ontology XCO:0000493 controlled exposure to an adult of the same species An experimental condition in which a test subject is placed in social contact with an adult (an organism that is fully developed and has reached physical and/or sexual maturity) from the same species. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed The physiological period after the natural cessation of estrus or menstruation cycles in an aging female mammal. jesmith 2016-02-01T11:00:34Z experimental_condition_ontology post-productive period postmenopausal XCO:0000494 postmenopause The physiological period after the natural cessation of estrus or menstruation cycles in an aging female mammal. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 http://www.medicaldictionaryweb.com/Postmenopause-definition/ A condition in which the main influencing factor is any substance that is poisonous or destructive to nerve cells or tissue, or that can be metabolized into a substance that is destructive to nerve cells or tissue. jesmith 2016-04-25T13:04:37Z neurotoxin experimental_condition_ontology XCO:0000495 Note that, although commonly used to refer to any neurotoxic substance, the term "neurotoxin" is technically restricted to naturally occurring proteins or peptides which are neurotoxic. neurotoxic substance A condition in which the main influencing factor is any substance that is poisonous or destructive to nerve cells or tissue, or that can be metabolized into a substance that is destructive to nerve cells or tissue. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the main influencing factor is a peptide, a protein or a conjugated protein produced by some higher plants, animals, and pathogenic bacteria, that is poisonous or destructive to nerve cells or tissue. jesmith 2016-04-25T13:25:58Z experimental_condition_ontology XCO:0000496 neurotoxin A condition in which the main influencing factor is a peptide, a protein or a conjugated protein produced by some higher plants, animals, and pathogenic bacteria, that is poisonous or destructive to nerve cells or tissue. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 A condition in which the main influencing factor is a synthetic or naturally derived compound that causes loss of dopaminergic neurons and induces Parkinson-like symptoms (parkinsonism) in animal models and/or Parkinson disease in humans. jesmith 2016-04-25T13:44:48Z MESH:D010300 Parkinson's disease inducing chemical experimental_condition_ontology parkinsonism-inducing chemical XCO:0000497 Parkinson disease-inducing chemical A condition in which the main influencing factor is a synthetic or naturally derived compound that causes loss of dopaminergic neurons and induces Parkinson-like symptoms (parkinsonism) in animal models and/or Parkinson disease in humans. PMID:22108613 A condition in which the main influencing factor is oxidopamine, a neurotoxic organic compound used to induce degeneration of dopaminergic neurons in animal models. jesmith 2016-04-25T15:27:15Z CHEBI:78741 experimental_condition_ontology 6-OHDA 6-hydoxydopamine XCO:0000498 oxidopamine A condition in which the main influencing factor is oxidopamine, a neurotoxic organic compound used to induce degeneration of dopaminergic neurons in animal models. PMID:22108613 This is any condition in which the main influencing factor is1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP), the precursor to the toxic metabolite MPP+ (1-methyl-4-phenylpyridinium cation) which promotes degeneration of dopaminergic neurons. jesmith 2016-04-25T15:31:31Z CHEBI:17963 MPTP N-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine N-methyl-4-phenylpyridinium Pyridine, 1,2,3,6-tetrahydro-1-methyl-4-phenyl- experimental_condition_ontology XCO:0000499 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine This is any condition in which the main influencing factor is1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP), the precursor to the toxic metabolite MPP+ (1-methyl-4-phenylpyridinium cation) which promotes degeneration of dopaminergic neurons. PMID:22108613 A condition in which the main influencing factor is paraquat, a herbicidal organic cation used to model Parkinson's disease in mice. jesmith 2016-04-25T15:35:55Z CHEBI:34905 experimental_condition_ontology XCO:0000500 paraquat A condition in which the main influencing factor is paraquat, a herbicidal organic cation used to model Parkinson's disease in mice. PMID:22108613 A condition in which the main influencing factor is rotenone, an insecticide and piscicide extracted from Leguminosa plants. Rotenone can be used to induce degeneration of dopaminergic neurons in animal models. jesmith 2016-04-25T15:41:51Z CHEBI:28201 experimental_condition_ontology XCO:0000501 rotenone A condition in which the main influencing factor is rotenone, an insecticide and piscicide extracted from Leguminosa plants. Rotenone can be used to induce degeneration of dopaminergic neurons in animal models. PMID:22108613 A condition characterized by an alteration in the placement, arrangement or orientation of any part of the body of an organism such as an organ or extremity. jesmith 2017-02-22T18:31:25Z experimental_condition_ontology XCO:0000502 body part position change A condition characterized by an alteration in the placement, arrangement or orientation of any part of the body of an organism such as an organ or extremity. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--5th_Ed https://en.wiktionary.org/wiki/body_part A condition characterized by an alteration in the placement, arrangement or orientation of the head of an organism. jesmith 2017-02-22T18:33:23Z change in position of the head experimental_condition_ontology XCO:0000503 head position change A condition characterized by an alteration in the placement, arrangement or orientation of the head of an organism. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--5th_Ed https://en.wiktionary.org/wiki/body_part A condition characterized by rotation or twisting of the head parallel to the coronal plane of the body (that is, the plane which separates the belly from the back of the organism) at an increasing velocity. jesmith 2017-02-22T18:34:51Z experimental_condition_ontology coronal plane angular acceleration of the head XCO:0000504 coronal plane rotational acceleration of the head A condition characterized by rotation or twisting of the head parallel to the coronal plane of the body (that is, the plane which separates the belly from the back of the organism) at an increasing velocity. PMID:27188340 A condition in which the main influencing factor is a chemical which counteracts or suppresses inflammation. jesmith 2017-02-22T18:36:33Z CHEBI:67079 antiinflammatory agent experimental_condition_ontology Not4Curation XCO:0000505 anti-inflammatory agent A condition in which the main influencing factor is a chemical which counteracts or suppresses inflammation. Mosby:Mosbys_Medical_Dictionary--8th_Ed This is any condition in which the main influencing factor is a non-steroidal anti-inflammatory drug. NSAIDs act by blocking the synthesis of prostaglandins by inhibiting cyclooxygenase, which converts arachidonic acid to cyclic endoperoxides, precursors of prostaglandins. jesmith 2017-02-22T18:40:46Z CHEBI:35475 NSAID experimental_condition_ontology XCO:0000506 non-steroidal anti-inflammatory drug This is any condition in which the main influencing factor is a non-steroidal anti-inflammatory drug. NSAIDs act by blocking the synthesis of prostaglandins by inhibiting cyclooxygenase, which converts arachidonic acid to cyclic endoperoxides, precursors of prostaglandins. CHEBI:35475 Mosby:Mosbys_Medical_Dictionary--8th_Ed Condition in which the main influencing factor is a non-steroidal anti-inflammatory drug with chemical formula C15H12ClNO2, used as a veterinary analgesic. jesmith 2017-02-22T18:45:59Z CHEBI:364453 experimental_condition_ontology XCO:0000507 carprofen Condition in which the main influencing factor is a non-steroidal anti-inflammatory drug with chemical formula C15H12ClNO2, used as a veterinary analgesic. https://en.wikipedia.org/wiki/Carprofen An auditory stimulus consisting of a sound which is at a frequency and level to be perceptible to the ear, especially the human ear. jesmith 2017-02-22T18:56:06Z experimental_condition_ontology XCO:0000508 audible tone stimulus An auditory stimulus consisting of a sound which is at a frequency and level to be perceptible to the ear, especially the human ear. Farlex:Farlex_Partner_Medical_Dictionary_2012 Mosby:Mosbys_Medical_Dictionary--8th_Ed An auditory stimulus consisting of sound waves which are beyond the upper limit of perception by the human ear. jesmith 2017-02-22T19:03:06Z experimental_condition_ontology XCO:0000509 ultrasonic stimulus An auditory stimulus consisting of sound waves which are beyond the upper limit of perception by the human ear. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 An experimental condition characterized by rotation or twisting of the head parallel to the coronal plane of the body (that is, the plane which separates the belly from the back of the organism) at a relatively constant velocity. jesmith 2017-04-21T13:27:10Z experimental_condition_ontology coronal plane angular velocity of the head XCO:0000510 coronal plane rotational velocity of the head An experimental condition characterized by rotation or twisting of the head parallel to the coronal plane of the body (that is, the plane which separates the belly from the back of the organism) at a relatively constant velocity. PMID:27188340 Any condition in which the main influencing factor is a substance is a chemical compound derived from the linkage of an organic or inorganic acid and an alcohol, phenol, heteroarenol, or enol with the loss of water (H2O) formed from one hydrogen derived from an acidic hydroxy group of the acid and an -OH (hydroxy) group of the alcohol. jesmith 2017-07-18T12:56:04Z CHEBI:35701 experimental_condition_ontology XCO:0000511 ester Any condition in which the main influencing factor is a substance is a chemical compound derived from the linkage of an organic or inorganic acid and an alcohol, phenol, heteroarenol, or enol with the loss of water (H2O) formed from one hydrogen derived from an acidic hydroxy group of the acid and an -OH (hydroxy) group of the alcohol. https://en.wikipedia.org/wiki/Ester Any condition in which the main influencing factor is a substance with adverse or toxic effects on an embryo or fetus resulting in birth defects, specifically, altered development, growth retardation, functional defect and/or embryo death. jesmith 2017-07-18T12:58:04Z CHEBI:50905 teratogenic agent experimental_condition_ontology XCO:0000512 teratogen Any condition in which the main influencing factor is a substance with adverse or toxic effects on an embryo or fetus resulting in birth defects, specifically, altered development, growth retardation, functional defect and/or embryo death. https://en.wikipedia.org/wiki/Teratology A condition in which the main influencing factor is dibutyl phthalate (DBP), the diester obtained by the formal condensation of the carboxy groups of phthalic acid with two molecules of butan-1-ol. DBP has been used as a plasticizer and as an antiparasitic drug used to treat infestation of parasites on the surface of the body, and is suspected of being an endocrine disruptor and teratogen. jesmith 2017-07-18T13:00:07Z CHEBI:34687 di-n-butyl phthalate experimental_condition_ontology DBP XCO:0000513 dibutyl phthalate A condition in which the main influencing factor is dibutyl phthalate (DBP), the diester obtained by the formal condensation of the carboxy groups of phthalic acid with two molecules of butan-1-ol. DBP has been used as a plasticizer and as an antiparasitic drug used to treat infestation of parasites on the surface of the body, and is suspected of being an endocrine disruptor and teratogen. https://en.wikipedia.org/wiki/Dibutyl_phthalate A condition in which the main influencing factor is metoprolol, a selective beta-1 adrenergic receptor blocker used to treat hypertension, angina, acute myocardial infarction, tachycardia, and congestive heart failure, and to prevent migraine headaches. jesmith 2017-07-18T13:05:03Z MESH:D008790 experimental_condition_ontology XCO:0000514 metoprolol A condition in which the main influencing factor is metoprolol, a selective beta-1 adrenergic receptor blocker used to treat hypertension, angina, acute myocardial infarction, tachycardia, and congestive heart failure, and to prevent migraine headaches. MESH:D008790 https://en.wikipedia.org/wiki/Metoprolol A condition in which the main influencing factor is metoprolol tartrate, an immediate-release formulation of metoprolol. Metoprolol is a selective beta-1 adrenergic receptor blocker used to treat hypertension, angina, acute myocardial infarction, tachycardia, and congestive heart failure, and to prevent migraine headaches. jesmith 2017-07-18T13:06:13Z experimental_condition_ontology XCO:0000515 metoprolol tartrate A condition in which the main influencing factor is metoprolol tartrate, an immediate-release formulation of metoprolol. Metoprolol is a selective beta-1 adrenergic receptor blocker used to treat hypertension, angina, acute myocardial infarction, tachycardia, and congestive heart failure, and to prevent migraine headaches. MESH:D008790 https://en.wikipedia.org/wiki/Metoprolol A condition in which the main influencing factor is metoprolol succinate, an extended-release formulation of metoprolol. Metoprolol is a selective beta-1 adrenergic receptor blocker used to treat hypertension, angina, acute myocardial infarction, tachycardia, and congestive heart failure, and to prevent migraine headaches. jesmith 2017-07-18T13:06:16Z experimental_condition_ontology XCO:0000516 metoprolol succinate A condition in which the main influencing factor is metoprolol succinate, an extended-release formulation of metoprolol. Metoprolol is a selective beta-1 adrenergic receptor blocker used to treat hypertension, angina, acute myocardial infarction, tachycardia, and congestive heart failure, and to prevent migraine headaches. MESH:D008790 https://en.wikipedia.org/wiki/Metoprolol A condition in which the main influencing factor is an immunoglobulin molecule or a preparation of multiple antibody molecules having specific amino acid sequences with the ability to adhere to and interact specifically with any or all of the transforming growth factor beta cytokines. jesmith 2017-07-18T13:10:24Z 1D11 monoclonal antibody experimental_condition_ontology anti-TGFbeta antibody XCO:0000517 anti-transforming growth factor beta antibody A condition in which the main influencing factor is an immunoglobulin molecule or a preparation of multiple antibody molecules having specific amino acid sequences with the ability to adhere to and interact specifically with any or all of the transforming growth factor beta cytokines. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed A condition in which the main influencing factor is an immunoglobulin molecule or a preparation of multiple antibody molecules having specific amino acid sequences with the ability to adhere to and interact specifically with the beta subunit of Shiga toxin from Shigella dysenteriae 1. jesmith 2017-07-18T13:12:49Z experimental_condition_ontology anti-Shigatoxin 1B antibody XCO:0000518 anti-Shiga toxin 1 beta antibody A condition in which the main influencing factor is an immunoglobulin molecule or a preparation of multiple antibody molecules having specific amino acid sequences with the ability to adhere to and interact specifically with the beta subunit of Shiga toxin from Shigella dysenteriae 1. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed PMID:26904753 Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed A condition in which the main influencing factor is an immunoglobulin molecule having specific amino acid sequences with the ability to adhere to and interact specifically with the beta subunit of Shiga toxin from Shigella dysenteriae 1. This monoclonal antibody has been used as an IgG1 isotype control. jesmith 2017-07-18T13:14:54Z experimental_condition_ontology anti-Shigatoxin 1B monoclonal antibody 13C4 XCO:0000519 anti-Shiga toxin 1 beta monoclonal antibody 13C4 A condition in which the main influencing factor is an immunoglobulin molecule having specific amino acid sequences with the ability to adhere to and interact specifically with the beta subunit of Shiga toxin from Shigella dysenteriae 1. This monoclonal antibody has been used as an IgG1 isotype control. Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed PMID:14675041 PMID:26904753 Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed Any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of a stimulus, such as electrical stimulation or chemical agents, to specific neurological sites in the body. jesmith 2017-07-18T13:25:13Z experimental_condition_ontology XCO:0000520 neuromodulation Any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of a stimulus, such as electrical stimulation or chemical agents, to specific neurological sites in the body. https://en.wikipedia.org/wiki/Neuromodulation_(medicine) This is any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to a specific nerve or nerves, for example through the use of microelectrodes or an implanted device. jesmith 2017-07-18T13:25:52Z experimental_condition_ontology direct electrical nerve stimulus XCO:0000521 direct electrical nerve stimulation This is any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to a specific nerve or nerves, for example through the use of microelectrodes or an implanted device. https://en.wikipedia.org/wiki/Neurostimulation A condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to the common peroneal nerve(s), for example through the use of microelectrodes or an implanted device. The common peroneal nerve is one of the terminal divisions of the sciatic nerve, diverging from the tibial nerve at the upper end of the popliteal fossa, then coursing with the biceps tendon along the lateral portion of the popliteal space to wind around the neck of the fibula, where it divides into the superficial and deep peroneal nerves. jesmith 2017-07-18T13:27:01Z direct electrical stimulus of the common peroneal nerve experimental_condition_ontology XCO:0000522 common peroneal nerve direct electrical stimulation A condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to the common peroneal nerve(s), for example through the use of microelectrodes or an implanted device. The common peroneal nerve is one of the terminal divisions of the sciatic nerve, diverging from the tibial nerve at the upper end of the popliteal fossa, then coursing with the biceps tendon along the lateral portion of the popliteal space to wind around the neck of the fibula, where it divides into the superficial and deep peroneal nerves. Farlex:Farlex_Partner_Medical_Dictionary_2012 https://en.wikipedia.org/wiki/Common_peroneal_nerve https://en.wikipedia.org/wiki/Neurostimulation This is any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of an enzyme, a protein that catalyzes chemical reactions of other substances without itself being destroyed or altered upon completion of the reactions. jesmith 2017-07-18T13:31:10Z experimental_condition_ontology XCO:0000523 enzyme inhibitor This is any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of an enzyme, a protein that catalyzes chemical reactions of other substances without itself being destroyed or altered upon completion of the reactions. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 Any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of angiotensin converting enzyme (ACE). ACE is an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. ACE inhibitors are used in the treatment of hypertension, congestive heart failure, acute myocardial infarction and diabetic nephropathy. jesmith 2017-07-18T13:32:02Z experimental_condition_ontology ACE inhibitor XCO:0000524 angiotensin converting enzyme inhibitor Any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of angiotensin converting enzyme (ACE). ACE is an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. ACE inhibitors are used in the treatment of hypertension, congestive heart failure, acute myocardial infarction and diabetic nephropathy. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 https://en.wikipedia.org/wiki/ACE_inhibitor A condition in which the main influencing factor is benazepril, a benzazepine in which the carboxy group of the 2-amino-4-phenylbutanoic acid moiety of benazeprilat has been converted to the corresponding ethyl ester. Removal of the ester by the liver converts the prodrug back to its active form, benazeprilat. Benazepril is an angiotensin converting enzyme (ACE) inhibitor used in the treatment of hypertension, congestive heart failure, acute myocardial infarction and diabetic nephropathy. jesmith 2017-07-18T13:34:04Z CHEBI:3011 experimental_condition_ontology XCO:0000525 benazepril A condition in which the main influencing factor is benazepril, a benzazepine in which the carboxy group of the 2-amino-4-phenylbutanoic acid moiety of benazeprilat has been converted to the corresponding ethyl ester. Removal of the ester by the liver converts the prodrug back to its active form, benazeprilat. Benazepril is an angiotensin converting enzyme (ACE) inhibitor used in the treatment of hypertension, congestive heart failure, acute myocardial infarction and diabetic nephropathy. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 https://en.wikipedia.org/wiki/Benazepril A condition in which the main influencing factor is the action of moving one's appendages to propel oneself through water while carrying weights (for example, aquatic dumbbells, ankle cuffs, or weighted belt) to increase resistance and/or decrease buoyancy thereby increasing the difficulty of the action. jesmith 2017-07-18T13:50:19Z experimental_condition_ontology XCO:0000526 swimming with water weights A condition in which the main influencing factor is the action of moving one's appendages to propel oneself through water while carrying weights (for example, aquatic dumbbells, ankle cuffs, or weighted belt) to increase resistance and/or decrease buoyancy thereby increasing the difficulty of the action. American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--5th_Ed Encarta:Encarta_World_English_Dictionary A condition in which the genotype or the gene expression of an organism or a cell has been modified. jesmith 2017-08-11T16:51:14Z experimental_condition_ontology XCO:0000527 genetic manipulation A condition in which the genotype or the gene expression of an organism or a cell has been modified. Farlex:Farlex_Partner_Medical_Dictionary_2009 This is any condition in which copies of an exogenous gene have been transiently or stably inserted into a living cell or organism in order to induce synthesis of that gene's product or to block synthesis of some gene product. jesmith 2017-08-11T16:57:10Z experimental_condition_ontology horizontal gene transfer XCO:0000528 gene transfer This is any condition in which copies of an exogenous gene have been transiently or stably inserted into a living cell or organism in order to induce synthesis of that gene's product or to block synthesis of some gene product. Webster:Random_House_Kernerman_Websters_College_Dictionary_2010 This is any condition in which the main influencing factor is a gene transfer performed using an adenovirus as the carrier of the genetic material. An adenovirus is any of a group of medium-sized (90-100 nm) non-enveloped icosahedral viruses of the family Adenoviridae which are characterized by a nucleocapsid surrounding a double-stranded DNA genome. An adenovirus is a double-stranded DNA virus that can replicate independently. jesmith 2017-08-11T16:58:54Z AdV transfer adenoviral gene transfer adenovirus transfer experimental_condition_ontology XCO:0000529 gene transfer using an adenovirus vector This is any condition in which the main influencing factor is a gene transfer performed using an adenovirus as the carrier of the genetic material. An adenovirus is any of a group of medium-sized (90-100 nm) non-enveloped icosahedral viruses of the family Adenoviridae which are characterized by a nucleocapsid surrounding a double-stranded DNA genome. An adenovirus is a double-stranded DNA virus that can replicate independently. Segen:Segens_Medical_Dictionary_2012 A condition in which the mouse angiotensin I converting enzyme 2 (Ace2) gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. jesmith 2017-08-11T17:15:29Z MGI:1917258 RGD:1550521 adenoviral transfer of the murine Ace2 gene transfer of recombinant adenovirus containing the murine Ace2 gene experimental_condition_ontology Ad-Ace2 XCO:0000530 gene transfer of the murine angiotensin I converting enzyme 2 gene using an adenovirus vector A condition in which the mouse angiotensin I converting enzyme 2 (Ace2) gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. RGD:12879447 Webster:Random_House_Kernerman_Websters_College_Dictionary_2010 This is any condition in which the main influencing factor is the transfer (transiently or stably) of the enhanced green fluorescent protein (EGFP) gene, using an adenovirus carrier, into a cell or organism in order to induce synthesis of that gene's product in the recipient cell or organism. jesmith 2017-08-11T17:17:27Z adenoviral transfer of the EGFP gene transfer of recombinant adenovirus containing the EGFP gene experimental_condition_ontology Ad-EGFP XCO:0000531 gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector This is any condition in which the main influencing factor is the transfer (transiently or stably) of the enhanced green fluorescent protein (EGFP) gene, using an adenovirus carrier, into a cell or organism in order to induce synthesis of that gene's product in the recipient cell or organism. RGD:12879447 Webster:Random_House_Kernerman_Websters_College_Dictionary_2010 Any condition in which the main influencing factor is a substance which disrupts one or more of the processes that lead directly to the generation of new proteins, that is, that inhibits the process of translation of mRNAs into proteins. jesmith 2017-08-11T17:21:03Z experimental_condition_ontology XCO:0000532 protein synthesis inhibitor Any condition in which the main influencing factor is a substance which disrupts one or more of the processes that lead directly to the generation of new proteins, that is, that inhibits the process of translation of mRNAs into proteins. https://en.wikipedia.org/wiki/Protein_synthesis_inhibitor Condition in which the main influencing factor is puromycin, an aminonucleoside antibiotic derived from the Streptomyces alboniger bacterium, that causes premature chain termination during translation taking place in the ribosome. jesmith 2017-08-11T17:21:54Z CHEBI:17939 experimental_condition_ontology XCO:0000533 puromycin Condition in which the main influencing factor is puromycin, an aminonucleoside antibiotic derived from the Streptomyces alboniger bacterium, that causes premature chain termination during translation taking place in the ribosome. https://en.wikipedia.org/wiki/Puromycin A condition in which the main influencing factor is sunitinib, an antineoplastic agent which acts as a receptor tyrosine kinase inhibitor and an antagonist for multiple platelet-derived growth factor and vascular endothelial growth factor receptors. Sunitinib is used as a chemotherapy agent in the treatment of renal cell carcinoma and gastrointestinal stromal tumor. jesmith 2017-08-11T17:28:23Z CHEBI:38940 experimental_condition_ontology Sutent sunitinibum XCO:0000534 sunitinib A condition in which the main influencing factor is sunitinib, an antineoplastic agent which acts as a receptor tyrosine kinase inhibitor and an antagonist for multiple platelet-derived growth factor and vascular endothelial growth factor receptors. Sunitinib is used as a chemotherapy agent in the treatment of renal cell carcinoma and gastrointestinal stromal tumor. https://en.wikipedia.org/wiki/Sunitinib A condition in which the main influencing factor is lisinopril, an antihypertensive competitive inhibitor of angiotensin-converting enzyme (ACE). jrsmith 2018-05-11T10:54:07Z experimental_condition_ontology Prinivil Qbrelis Zestril XCO:0000535 lisinopril A condition in which the main influencing factor is lisinopril, an antihypertensive competitive inhibitor of angiotensin-converting enzyme (ACE). Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed ISBN:978-1416049982 This is any condition in which the main influencing factor is an angiotensin II receptor antagonist, an agent that blocks angiotensin II receptors and is used to treat high blood pressure and heart failure. jrsmith 2018-05-14T18:01:31Z ARB angiotensin II receptor blocker angiotensin receptor blocker sartan experimental_condition_ontology XCO:0000536 angiotensin II receptor antagonist This is any condition in which the main influencing factor is an angiotensin II receptor antagonist, an agent that blocks angiotensin II receptors and is used to treat high blood pressure and heart failure. https://en.wikipedia.org/wiki/Angiotensin_II_receptor_blocker This is any condition in which the main influencing factor is olmesartan medoxomil, an angiotensin II receptor blocker which is used as an antihypertensive agent. jrsmith 2018-05-14T18:27:28Z experimental_condition_ontology CS-866 XCO:0000537 olmesartan medoxomil This is any condition in which the main influencing factor is olmesartan medoxomil, an angiotensin II receptor blocker which is used as an antihypertensive agent. https://en.wikipedia.org/wiki/Olmesartan An experimental condition in which the main influencing factor is temocapril, an angiotensin-I converting enzyme (ACE) inhibitor consisting of a dipeptide prodrug with a thiazepine ring. jrsmith 2018-05-14T18:34:03Z alpha-((2S,6R)-6-((1S)-1-ethoxycarbonyl-3-phenylpropyl)amino-5-oxo-2-(2-thienyl)perhydro-1,4-thiazepin-4-yl)acetic acid.HCl experimental_condition_ontology Acecol CS-622 CS622 XCO:0000538 temocapril An experimental condition in which the main influencing factor is temocapril, an angiotensin-I converting enzyme (ACE) inhibitor consisting of a dipeptide prodrug with a thiazepine ring. https://en.wikipedia.org/wiki/Temocapril An experimental condition in which the main influencing factor is doxorubicin, a cytotoxic anthracycline antibiotic isolated from cultures of Streptomyces peucetius var. caesius and used as a chemotherapy medication. Doxorubicin binds to nucleic acids, presumably by specific intercalation of the planar anthracycline nucleus with the DNA double helix. jrsmith 2018-05-15T15:54:18Z CHEBI:28748 ADR Adriablastine DXR adriamycin experimental_condition_ontology XCO:0000539 doxorubicin An experimental condition in which the main influencing factor is doxorubicin, a cytotoxic anthracycline antibiotic isolated from cultures of Streptomyces peucetius var. caesius and used as a chemotherapy medication. Doxorubicin binds to nucleic acids, presumably by specific intercalation of the planar anthracycline nucleus with the DNA double helix. drugbank:DB00997 https://en.wikipedia.org/wiki/Doxorubicin An experimental condition in which the main influencing factor is delapril, an antihypertensive prodrug that, when converted to its active metabolites 5-hydroxy delapril diacid and delapril diacid, acts as an angiotensin-converting enzyme (ACE) inhibitor. jrsmith 2018-05-15T15:58:32Z CHEBI:135735 experimental_condition_ontology XCO:0000540 delapril An experimental condition in which the main influencing factor is delapril, an antihypertensive prodrug that, when converted to its active metabolites 5-hydroxy delapril diacid and delapril diacid, acts as an angiotensin-converting enzyme (ACE) inhibitor. https://en.wikipedia.org/wiki/Delapril An experimental condition in which the main influencing factor is bosentan, a competitive antagonist of endothelin-1 that blocks the binding of endothelin to both the endothelin-A (ET-A) and endothelin-B (ET-B)receptors. Bosentan is used in the treatment of pulmonary arterial hypertension. jrsmith 2018-05-15T16:06:25Z experimental_condition_ontology Tracleer bosentanum XCO:0000541 bosentan An experimental condition in which the main influencing factor is bosentan, a competitive antagonist of endothelin-1 that blocks the binding of endothelin to both the endothelin-A (ET-A) and endothelin-B (ET-B)receptors. Bosentan is used in the treatment of pulmonary arterial hypertension. https://en.wikipedia.org/wiki/Bosentan https://phassociation.org/patients/treatments/bosentan/ This is any condition in which the main influencing factor is enalapril, a prodrug that is rapidly metabolized in the liver to enalaprilat, a potent, competitive inhibitor of angiotensin-converting enzyme (ACE). jrsmith 2018-05-15T16:09:53Z experimental_condition_ontology Enacard Renitec Vasotec XCO:0000542 enalapril This is any condition in which the main influencing factor is enalapril, a prodrug that is rapidly metabolized in the liver to enalaprilat, a potent, competitive inhibitor of angiotensin-converting enzyme (ACE). https://en.wikipedia.org/wiki/Enalapril This is any condition in which the main influencing factor is one or more closely related forms (vitamers) of vitamin D, a group of fat-soluble vitamins (when ingested from dietary sources) and/or hormones (when produced by the skin in response to ultraviolet radiation). Vitamin D is involved in intestinal absorption of calcium, magnesium and phosphate, and in calcium homeostasis and metabolism. jrsmith 2018-05-15T16:17:43Z experimental_condition_ontology XCO:0000543 vitamin D This is any condition in which the main influencing factor is one or more closely related forms (vitamers) of vitamin D, a group of fat-soluble vitamins (when ingested from dietary sources) and/or hormones (when produced by the skin in response to ultraviolet radiation). Vitamin D is involved in intestinal absorption of calcium, magnesium and phosphate, and in calcium homeostasis and metabolism. https://en.wikipedia.org/wiki/Vitamin_D An experimental condition in which the main influencing factor is vitamin D2, a type of vitamin D found in food and used as a dietary supplement. The D2 vitamer has been found to be less efficiently absorbed in the human intestine and/or less biologically active than the D3 vitamer. jrsmith 2018-05-15T16:22:22Z calciferol ergocalciferol experimental_condition_ontology Calcidol Drisdol XCO:0000544 vitamin D2 An experimental condition in which the main influencing factor is vitamin D2, a type of vitamin D found in food and used as a dietary supplement. The D2 vitamer has been found to be less efficiently absorbed in the human intestine and/or less biologically active than the D3 vitamer. PMID:22552031 https://en.wikipedia.org/wiki/Ergocalciferol An experimental condition in which the main influencing factor is vitamin D3, a form of vitamin D which is naturally synthesized in the skin of animals by the action of ultraviolet B (UVB) radiation on 7-dehydrocholesterol. Vitamin D3 is also found in some foods and can be used as a dietary supplement. The D3 vitamer has been found to be more efficiently absorbed in the human intestine and/or more biologically active than the D2 vitamer. jrsmith 2018-05-15T16:35:39Z cholecalciferol colecalciferol experimental_condition_ontology XCO:0000545 vitamin D3 An experimental condition in which the main influencing factor is vitamin D3, a form of vitamin D which is naturally synthesized in the skin of animals by the action of ultraviolet B (UVB) radiation on 7-dehydrocholesterol. Vitamin D3 is also found in some foods and can be used as a dietary supplement. The D3 vitamer has been found to be more efficiently absorbed in the human intestine and/or more biologically active than the D2 vitamer. PMID:22552031 https://en.wikipedia.org/wiki/Cholecalciferol A condition in which the main influencing factor is a compound with structural and/or functional similarity to a vitamin and can therefore be substituted for the analogous vitamin. jrsmith 2018-05-15T16:41:42Z vitamin analogue experimental_condition_ontology XCO:0000546 vitamin analog A condition in which the main influencing factor is a compound with structural and/or functional similarity to a vitamin and can therefore be substituted for the analogous vitamin. https://en.wikipedia.org/wiki/Analog An experimental condition in which the main influencing factor is paricalcitol, an analog of vitamin D2 used for the prevention and treatment of secondary hyperparathyroidism. jrsmith 2018-05-15T16:44:29Z 19-nor-1,25-(OH)2-vitamin D2 experimental_condition_ontology Zemplar XCO:0000547 paricalcitol An experimental condition in which the main influencing factor is paricalcitol, an analog of vitamin D2 used for the prevention and treatment of secondary hyperparathyroidism. https://en.wikipedia.org/wiki/Paricalcitol An experimental condition in which the main influencing factor is ramipril, a prodrug that is metabolized in the liver to ramiprilat, a potent, competitive inhibitor of angiotensin-converting enzyme (ACE). jrsmith 2018-05-15T16:51:40Z CHEBI:8774 Altace Tritace experimental_condition_ontology XCO:0000548 ramipril An experimental condition in which the main influencing factor is ramipril, a prodrug that is metabolized in the liver to ramiprilat, a potent, competitive inhibitor of angiotensin-converting enzyme (ACE). MESH:D017257 drugbank:DB00178 A surgical manipulation causing blockage of the left anterior descending coronary artery, the artery supplying blood to approximately half of the left ventricle of the heart including the anterolateral myocardium, apex, and interventricular septum. jrsmith 2018-05-15T16:57:52Z LAD blockage LAD occlusion interventricular artery occlusion left anterior descending artery occlusion widow maker occlusion left coronary artery ligation experimental_condition_ontology XCO:0000549 left anterior descending coronary artery occlusion A surgical manipulation causing blockage of the left anterior descending coronary artery, the artery supplying blood to approximately half of the left ventricle of the heart including the anterolateral myocardium, apex, and interventricular septum. https://en.wikipedia.org/wiki/Anterior_interventricular_branch_of_left_coronary_artery An experimental condition in which the main influencing factor is reserpine, an indole alkaloid which irreversibly blocks the vesicular monoamine transporters (VMATs), SLC18A1 and SLC18A2. Reserpine has been used as both an antihypertensive drug and an antipsychotic drug. jrsmith 2018-05-15T17:19:06Z CHEBI:28487 MESH:D012110 Serpasil methyl (3beta,16beta,17alpha,18beta,20alpha)-11,17-dimethoxy-18-[(3,4,5-trimethoxybenzoyl)oxy]yohimban-16-carboxylate experimental_condition_ontology XCO:0000550 reserpine An experimental condition in which the main influencing factor is reserpine, an indole alkaloid which irreversibly blocks the vesicular monoamine transporters (VMATs), SLC18A1 and SLC18A2. Reserpine has been used as both an antihypertensive drug and an antipsychotic drug. PMID:7905859 drugbank:DB00206 https://en.wikipedia.org/wiki/Reserpine An experimental condition in which the main influencing factor is hydralazine, a vasodilator that appears to have multiple, direct effects on smooth muscles of the arterial vessels, thereby reducing systemic vascular resistance and arterial pressure. jrsmith 2018-05-15T17:22:47Z experimental_condition_ontology XCO:0000551 hydralazine An experimental condition in which the main influencing factor is hydralazine, a vasodilator that appears to have multiple, direct effects on smooth muscles of the arterial vessels, thereby reducing systemic vascular resistance and arterial pressure. drugbank:DB01275 http://cvpharmacology.com/vasodilator/direct This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of hydralazine in which the amount of hydralazine consumed is maintained at a specified level. jrsmith 2018-05-15T17:24:24Z CHEBI:5775 PMID:3611778 experimental_condition_ontology XCO:0000552 controlled hydralazine content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of hydralazine in which the amount of hydralazine consumed is maintained at a specified level. MESH:D006830 https://www.merriam-webster.com/ An experimental condition in which the main influencing factor is everolimus, a mammalian target of rapamycin (mTOR) inhibitor which is selective for the mTORC1 protein complex, with little or no effect on mTORC2. Everolimus is used as an antineoplastic and immunosuppressive agent. jrsmith 2018-05-31T13:41:07Z CHEBI:68478 experimental_condition_ontology XCO:0000553 everolimus An experimental condition in which the main influencing factor is everolimus, a mammalian target of rapamycin (mTOR) inhibitor which is selective for the mTORC1 protein complex, with little or no effect on mTORC2. Everolimus is used as an antineoplastic and immunosuppressive agent. https://en.wikipedia.org/wiki/Everolimus A regimen of solid food in which the amount of phosphorus consumed is controlled. sjwang 2018-11-14T15:58:10Z experimental_condition_ontology XCO:0000554 controlled phosphorus content diet A drink made up of water and a specified amount of lisinopril consumed by an organism as part of an experiment. sjwang 2018-11-14T16:04:27Z experimental_condition_ontology XCO:0000555 controlled lisinopril content drinking water Any amino sugar that is a monosaccharide in which one alcoholic hydroxy group is replaced by an amino group. sjwang 2018-11-16T10:50:55Z CHEBI:60926 experimental_condition_ontology XCO:0000556 amino monosaccharide Glucosamine, commonly used as a treatment for osteoarthritis, is an amino sugar and a prominent precursor in the biochemical synthesis of glycosylated proteins and lipids. Since glucosamine is a precursor for glycosaminoglycans, and glycosaminoglycans are a major component of joint cartilage, supplemental glucosamine may help to rebuild cartilage and treat arthritis. sjwang 2018-11-16T10:55:31Z 2-amino-2-deoxyglucose experimental_condition_ontology XCO:0000557 glucosamine Glucosamine, commonly used as a treatment for osteoarthritis, is an amino sugar and a prominent precursor in the biochemical synthesis of glycosylated proteins and lipids. Since glucosamine is a precursor for glycosaminoglycans, and glycosaminoglycans are a major component of joint cartilage, supplemental glucosamine may help to rebuild cartilage and treat arthritis. drugbank:DB01296 Taxifolin is a flavanonol and a non-steroidal anti-inflammatory agent. sjwang 2018-11-16T11:03:16Z CHEBI:38747 DHQ Distylin Taxifoliol catechin hydrate dihydroquercetin experimental_condition_ontology XCO:0000558 taxifolin Taxifolin is a flavanonol and a non-steroidal anti-inflammatory agent. https://en.wikipedia.org/wiki/Taxifolin A biogenic amine that is found in animals and plants. In mammals, melatonin is a hormone produced by the pineal gland. Its secretion increases in darkness and decreases during exposure to light. Melatonin is implicated in the regulation of sleep, mood, and reproduction. Melatonin is also an effective antioxidant. sjwang 2018-11-19T14:33:05Z CHEBI:16796 experimental_condition_ontology XCO:0000559 melatonin A biogenic amine that is found in animals and plants. In mammals, melatonin is a hormone produced by the pineal gland. Its secretion increases in darkness and decreases during exposure to light. Melatonin is implicated in the regulation of sleep, mood, and reproduction. Melatonin is also an effective antioxidant. https://druginfo.nlm.nih.gov/drugportal/name/melatonin https://meshb.nlm.nih.gov/record/ui?ui=D008550 A solid diet in which the amount of melatonin is maintained at a specified level. sjwang 2018-11-19T14:48:04Z experimental_condition_ontology XCO:0000560 controlled melatonin content diet This is any condition in which the main influencing factor is an antidepressant, a mood-stimulating drug used primarily in the treatment of affective disorders and related conditions. sjwang 2018-11-21T09:51:04Z MESH:D000928 experimental_condition_ontology Not4Curation XCO:0000561 antidepressant This is any condition in which the main influencing factor is an antidepressant, a mood-stimulating drug used primarily in the treatment of affective disorders and related conditions. CHEBI:35469 This is any condition in which the main influencing factor is salidroside, a glucoside of tyrosol found in the plant Rhodiola rosea. It is thought to be one of the compounds responsible for the antidepressant and anxiolytic actions of this plant. sjwang 2018-11-21T09:53:27Z CHEBI:9009 MESH:C009172 2-(4-Hydroxyphenyl)ethyl &#946;-D-glucopyranoside rhodioloside rhodosin sallidroside tyrosol glucoside experimental_condition_ontology XCO:0000562 salidroside This is any condition in which the main influencing factor is salidroside, a glucoside of tyrosol found in the plant Rhodiola rosea. It is thought to be one of the compounds responsible for the antidepressant and anxiolytic actions of this plant. https://druginfo.nlm.nih.gov/drugportal/name/salidroside OMACOR is a prescription medicine for adults called a lipid-regulating medicine. It is a mix of docosahexaenoic acid [DHA] (~ 50%) + eicosapentaenoic acid [EPA] (~40%) ethylesters. sjwang 2018-11-27T13:04:58Z Lovaza Omega-3-Acid Ethyl Esters (eicosapentaenoic acid and docosahexaenoic acid) Omytrg experimental_condition_ontology XCO:0000563 Omacor OMACOR is a prescription medicine for adults called a lipid-regulating medicine. It is a mix of docosahexaenoic acid [DHA] (~ 50%) + eicosapentaenoic acid [EPA] (~40%) ethylesters. https://www.nlm.nih.gov/medlineplus/ A member of the anthranilic acid derivatives class of NSAID drug used for joint, muscular pain, arthritis and dysmenorrhea. sjwang 2018-11-27T14:31:01Z experimental_condition_ontology XCO:0000564 meclofenamate A member of the anthranilic acid derivatives class of NSAID drug used for joint, muscular pain, arthritis and dysmenorrhea. https://en.wikipedia.org/wiki/Meclofenamic_acid A pharmaceutical drug for treatment of type 2 diabetes. Ipragliflozin reduces blood glucose levels by inhibiting the reuptake of glucose by selectively inhibiting SGLT2. sjwang 2018-11-30T14:59:25Z experimental_condition_ontology XCO:0000565 ipragliflozin A pharmaceutical drug for treatment of type 2 diabetes. Ipragliflozin reduces blood glucose levels by inhibiting the reuptake of glucose by selectively inhibiting SGLT2. https://en.wikipedia.org/wiki/Ipragliflozin A solid diet in which the amount of ipragliflozin, an oral antidiabetic drug, is maintained at a specified level. sjwang 2018-11-30T15:02:35Z experimental_condition_ontology XCO:0000566 controlled ipragliflozin content diet sjwang 2018-12-05T14:02:20Z experimental_condition_ontology XCO:0000567 adrenomedulin A vasodilator and an antioxidant. It relaxes arteries and inhibits membrane-bound enzymes that form reactive oxygen species, such as superoxides. sjwang 2018-12-05T14:06:11Z experimental_condition_ontology XCO:0000568 hydralazine hydrochloride sjwang 2018-12-05T14:21:28Z experimental_condition_ontology XCO:0000569 controlled hydralazine hydrochloride content drinking water A selective and competitive arginine vasopressin receptor 2 antagonist. sjwang 2018-12-05T14:25:32Z experimental_condition_ontology XCO:0000570 tolvaptan sjwang 2018-12-05T14:27:59Z experimental_condition_ontology XCO:0000571 controlled tolvaptan content diet This is any condition in which the main influencing factor is vancomycin, a complex glycopeptide from Streptomyces orientalis. Vancomycin inhibits a specific step in the synthesis of the peptidoglycan layer in the Gram-positive bacteria Staphylococcus aureus and Clostridium difficile. sjwang 2018-12-05T14:37:41Z MESH:D014640 experimental_condition_ontology XCO:0000572 vancomycin This is any condition in which the main influencing factor is vancomycin, a complex glycopeptide from Streptomyces orientalis. Vancomycin inhibits a specific step in the synthesis of the peptidoglycan layer in the Gram-positive bacteria Staphylococcus aureus and Clostridium difficile. CHEBI:28001 sjwang 2018-12-05T14:41:59Z experimental_condition_ontology XCO:0000573 null true sjwang 2018-12-05T14:42:50Z experimental_condition_ontology XCO:0000574 controlled vancomycin content drinking water Meropenem is a broad-spectrum antibiotic used to treat a variety of bacterial infections. sjwang 2018-12-05T15:07:54Z CHEBI:43968 MESH:D000077731 3-(5-Dimethylcarbamoylpyrrolidin-3-ylthio)-6-(1-hydroxyethyl)-4-methyl-7-oxo-1-azabicyclo(3.2.0)hept-2-ene-2-carboxylic acid Merrem Merrem Novaplus Penem Ronem SM 7338 experimental_condition_ontology XCO:0000575 meropenem Meropenem is a broad-spectrum antibiotic used to treat a variety of bacterial infections. https://en.wikipedia.org/wiki/Meropenem sjwang 2018-12-05T15:12:42Z experimental_condition_ontology XCO:0000576 controlled meropenem content drinking water Proton pump inhibitors (PPIs) reduce the production of acid by blocking H+/K+ ATPase in the wall of the stomach. sjwang 2018-12-05T15:17:00Z Synonym: PPI experimental_condition_ontology XCO:0000577 proton pump inhibitor This is any condition in which the main influencing factor is omeprazole, a highly effective inhibitor of gastric acid secretion used in the therapy of stomach ulcers and Zollinger-Ellison syndrome. sjwang 2018-12-05T15:19:50Z CHEBI:7772 CID:4594 OME rac-5-methoxy-2-{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl}-1H-benzimidazole experimental_condition_ontology XCO:0000578 omeprazole This is any condition in which the main influencing factor is omeprazole, a highly effective inhibitor of gastric acid secretion used in the therapy of stomach ulcers and Zollinger-Ellison syndrome. MESH:D009853 Any experimental condition in which the internal or external environment of the gastrointestinal system is altered. sjwang 2018-12-05T15:24:01Z experimental_condition_ontology XCO:0000579 controlled in situ gastrointestinal condition Any experimental condition in which the internal or external environment of the gastrointestinal system is altered. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is the administration of food or drug by force, especially to a laboratory animal, typically through a tube leading down the throat to the stomach. sjwang 2018-12-05T15:43:29Z gavage experimental_condition_ontology XCO:0000580 forced feeding This is any condition in which the main influencing factor is the introduction of material, food, or drug into the stomach by a tube via the oral cavity. sjwang 2018-12-05T15:45:21Z XCO:0000582 XCO:0000583 XCO:0000584 controlled content oral gavage controlled cecal material content oral gavage controlled omeprazole content oral gavage experimental_condition_ontology XCO:0000581 oral gavage Oral gavage in which the amount of one or more solutes are adjusted to a requirement. sjwang 2018-12-05T15:49:29Z experimental_condition_ontology XCO:0000582 controlled content oral gavage true An oral gavage solution made up of solvent and a specified amount of omeprazole. sjwang 2018-12-05T15:51:33Z experimental_condition_ontology XCO:0000583 controlled omeprazole content oral gavage true An oral gavage delivery made up of a specified amount of harvested cecal material. sjwang 2018-12-05T15:55:37Z experimental_condition_ontology XCO:0000584 controlled cecal material content oral gavage true A control oligodeoxynucleotide with a non-specific scrambled sequence. sjwang 2018-12-06T15:58:27Z experimental_condition_ontology SCR ODN scrambled control ODN XCO:0000585 scrambled control oligodeoxynucleotide sjwang 2018-12-06T16:40:39Z Gnai2 ODN experimental_condition_ontology G&#945;i2 ODN G&#945;i2 oligodeoxynucleotide Gnai2 AS-ODN Gnai2 antisense oligodeoxynucleotide XCO:0000586 Gnai2 antisense oligonucleotide Stereotaxic implant with a stainless steel cannula into a cerebral ventricle, which can be connected via silastic tubing to a miniosmotic pump for chronic infusion. sjwang 2018-12-06T16:45:37Z experimental_condition_ontology i.c.v. cannula implantation XCO:0000587 intracerebroventricular cannula implantation Stereotaxic implant with a stainless steel cannula into a cerebral ventricle, which can be connected via silastic tubing to a miniosmotic pump for chronic infusion. PMID:25312437 Perindopril is a nonsulfhydryl prodrug that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications. It is rapidly metabolized in the liver to perindoprilat, a potent, competitive inhibitor of ACE. sjwang 2018-12-07T15:47:47Z CHEBI:8024 MESH:D020913 PMID:12376396 Aceon Coversum Coversyl ethyl N-{(2S)-1-[(2S,3aS,7aS)-2-carboxyoctahydro-1H-indol-1-yl]-1-oxopropan-2-yl}-L-norvalinate experimental_condition_ontology XCO:0000588 perindopril Perindopril is a nonsulfhydryl prodrug that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications. It is rapidly metabolized in the liver to perindoprilat, a potent, competitive inhibitor of ACE. drugbank:DB00790 A condition in which the main influencing factor is Moexipril, a non-sulfhydryl-containing precursor of the active angiotensin-converting enzyme (ACE) inhibitor Moexiprilat and a vasodilatory antihypertensive drug. sjwang 2018-12-07T16:00:47Z experimental_condition_ontology XCO:0000589 Moexipril A synthetic decapeptide that is a bradykinin receptor antagonist used for the treatment of hereditary angioedema. sjwang 2018-12-07T16:19:30Z experimental_condition_ontology XCO:0000590 icatibant A prodrug that is metabolized to quinaprilat (quinapril diacid), a competitive inhibitor of angiotensin-converting enzyme (ACE). sjwang 2018-12-07T16:22:09Z experimental_condition_ontology XCO:0000591 quinapril A prodrug that is hydrolyzed to its main metabolite cilazaprilat, an inhibitor of angiotensin-converting enzyme (ACE). sjwang 2018-12-20T15:23:56Z Dynorm Inhibace Vascace experimental_condition_ontology XCO:0000592 cilazapril The aminonucleoside portion of the antibiotic puromycin. NOTE: This molecule does not induce apoptosis and does not inhibit protein synthesis. sjwang 2018-12-27T10:28:04Z 3'-Amino-3'-deoxy-N6,N6-dimethyladenosine experimental_condition_ontology XCO:0000593 puromycin aminonucleoside This is any condition in which the main influencing factor is saralasin, a competitive angiotensin II receptor antagonist with partial agonistic activity previously used to distinguish renovascular hypertension from essential hypertension. sjwang 2018-12-27T13:23:15Z CHEBI:135894 CID:6324663 Sar-Arg-Val-Tyr-Val-His-Pro-Ala experimental_condition_ontology XCO:0000594 saralasin This is any condition in which the main influencing factor is saralasin, a competitive angiotensin II receptor antagonist with partial agonistic activity previously used to distinguish renovascular hypertension from essential hypertension. https://en.wikipedia.org/wiki/Saralasin sjwang 2018-12-27T14:59:42Z experimental_condition_ontology XCO:0000595 surgical manipulation of blood vessels This is any condition in which the main influencing factor is surgical narrowing of the lumen of a blood vessel. This lumen narrowing could be accomplished by circumferential suturing, use of a manipulatable sleeve, or some other method. sjwang 2018-12-27T15:05:18Z experimental_condition_ontology XCO:0000596 blood vessel constriction This is any condition in which the main influencing factor is surgical narrowing of the lumen of the abdominal aorta. The abdominal aorta consists of the suprarenal abdominal aorta and the infrarenal aorta. sjwang 2018-12-27T15:08:06Z AAC abdominal aortic constriction experimental_condition_ontology XCO:0000597 abdominal aorta constriction This is any condition in which the main influencing factor is surgical narrowing of the lumen of the abdominal aorta. The abdominal aorta consists of the suprarenal abdominal aorta and the infrarenal aorta. PMID:28060255 This is any condition in which the main influencing factor is surgical narrowing of the lumen of the thoracic aorta. The thoracic aorta consists of the ascending aorta, the aortic arch, and the descending thoracic aorta. sjwang 2018-12-27T15:10:16Z thoracic aortic constriction TAC transverse aortic constriction experimental_condition_ontology XCO:0000598 thoracic aorta constriction This is any condition in which the main influencing factor is surgical narrowing of the lumen of the thoracic aorta. The thoracic aorta consists of the ascending aorta, the aortic arch, and the descending thoracic aorta. https://en.wikipedia.org/wiki/Aorta A pregnane-based steroidal hormone produced by the outer-section (zona glomerulosa) of the adrenal cortex in the adrenal gland, and acts on the distal tubules and collecting ducts of the kidney to cause the conservation of sodium, secretion of potassium, increased water retention, and increased blood pressure. sjwang 2018-12-27T15:39:58Z MESH:D000450 PMID:8770880 11beta,21-dihydroxy-3,20-dioxopregn-4-en-18-al experimental_condition_ontology XCO:0000599 aldosterone A pregnane-based steroidal hormone produced by the outer-section (zona glomerulosa) of the adrenal cortex in the adrenal gland, and acts on the distal tubules and collecting ducts of the kidney to cause the conservation of sodium, secretion of potassium, increased water retention, and increased blood pressure. CHEBI:27584 This is any condition in which the main influencing factor is 2,3,7,8-tetrachlorodibenzo-p-dioxin, a polychlorinated dibenzo-p-dioxin that activates the aryl hydrocarbon (AH) receptor, a transcription factor. sjwang 2019-01-21T12:54:07Z CHEBI:28119 CID:15625 2,3,7,8-Tetrachlorodibenzo[b,e][1,4]dioxine 2,3,7,8-tetrachlorooxanthrene TCDD tetrachlorodibenzo-p-dioxin tetrachlorodibenzodioxin tetradioxin experimental_condition_ontology XCO:0000600 2,3,7,8-tetrachlorodibenzo-p-dioxin This is any condition in which the main influencing factor is 2,3,7,8-tetrachlorodibenzo-p-dioxin, a polychlorinated dibenzo-p-dioxin that activates the aryl hydrocarbon (AH) receptor, a transcription factor. https://en.wikipedia.org/wiki/2,3,7,8-Tetrachlorodibenzodioxin A condition in which the rat natriuretic peptide B gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. sjwang 2019-01-22T13:43:52Z gene transfer of adenovirus-NPPB gene transfer of the rat BNP gene using an adenovirus vector gene transfer of the rat Nppb gene using an adenovirus vector experimental_condition_ontology XCO:0000601 gene transfer of the rat natriuretic peptide B gene using an adenovirus vector A peroxisome proliferator-activated receptor gamma agonist; reduces lipid availability, improves insulin action & glucoregulation sjwang 2019-01-22T13:55:58Z CHEBI:50122 experimental_condition_ontology XCO:0000602 rosiglitazone A peroxisome proliferator-activated receptor gamma agonist; reduces lipid availability, improves insulin action & glucoregulation https://druginfo.nlm.nih.gov/drugportal/name/rosiglitazone Hesperetin belongs to the flavanone class of flavonoids. Hesperetin, in the form of its glycoside Hesperidin, is the predominant flavonoid in lemons and oranges. sjwang 2019-01-22T14:38:41Z CHEBI:28230 MESH:C013015 experimental_condition_ontology XCO:0000603 hesperetin Hesperetin belongs to the flavanone class of flavonoids. Hesperetin, in the form of its glycoside Hesperidin, is the predominant flavonoid in lemons and oranges. drugbank:DB01094 Any condition in which the main influencing factor is Aprotinin, also known as bovine pancreatic trypsin inhibitor (BPTI), a proteinase inhibitor used as medication administered by injection to reduce bleeding during complex surgery, such as heart and liver surgery. sjwang 2019-02-15T16:27:32Z C284H432N84O79S7 Trasylol experimental_condition_ontology XCO:0000604 Aprotinin Any condition in which the main influencing factor is Aprotinin, also known as bovine pancreatic trypsin inhibitor (BPTI), a proteinase inhibitor used as medication administered by injection to reduce bleeding during complex surgery, such as heart and liver surgery. drugbank:DB06692 An aflatoxin having a tetrahydrocyclopenta[c]furo[3',2':4,5]furo[2,3-h]chromene skeleton with oxygen functionality at positions 1, 4 and 11. sjwang 2019-02-26T11:26:05Z experimental_condition_ontology XCO:0000605 aflatoxin B1 An aflatoxin having a tetrahydrocyclopenta[c]furo[3',2':4,5]furo[2,3-h]chromene skeleton with oxygen functionality at positions 1, 4 and 11. CHEBI:2504 AMG-8718 is the inhibitor of &#946;-site amyloid precursor protein cleaving enzyme (BACE1). sjwang 2019-03-18T16:27:59Z experimental_condition_ontology XCO:0000606 AMG-8718 AMG-8718 is the inhibitor of &#946;-site amyloid precursor protein cleaving enzyme (BACE1). PMID:25363711 This is any condition in which the main influencing factor is acetic acid, the product of the oxidation of ethanol and of the destructive distillation of wood. Acetic acid is used locally, occasionally internally, as a counterirritant and also as a reagent. sjwang 2019-03-19T17:06:26Z MESH:D019342 ethanoic acid ethylic acid methane carboxylic acid vinegar acid experimental_condition_ontology XCO:0000607 acetic acid This is any condition in which the main influencing factor is acetic acid, the product of the oxidation of ethanol and of the destructive distillation of wood. Acetic acid is used locally, occasionally internally, as a counterirritant and also as a reagent. CHEBI:15366 Stedman:Stedmans_Medical_Dictionary_26th_ed An isothiocyanate with the formula CH2=CHCH2N=C=S. A colorless oil with boiling point 152degreeC, it is responsible for the pungent taste of mustard, horseradish, and wasabi. sjwang 2019-03-27T15:27:46Z CHEBI:73224 pubchem.compound:5971 experimental_condition_ontology MO mustard oil XCO:0000608 Allyl isothiocyanate An isothiocyanate with the formula CH2=CHCH2N=C=S. A colorless oil with boiling point 152degreeC, it is responsible for the pungent taste of mustard, horseradish, and wasabi. CHEBI:73224 A potent and selective blocker of TRPC4 channels. sjwang 2019-03-27T15:43:10Z CID:230710 4-methyl-2-(piperidin-1-yl)quinoline 4-methyl-2-piperidin-1-ylquinoline ML-204 ML204 experimental_condition_ontology XCO:0000609 4-methyl-2-(piperidin-1-yl)-quinoline A potent and selective blocker of TRPC4 channels. PMID:24388923 This is any condition in which the main influencing factor is morphine, the main alkaloid of opium that is a highly potent opiate analgesic psychoactive drug. Morphine acts directly on the central nervous system (CNS) to relieve pain but has a high potential for addiction, with tolerance and both physical and psychological dependence developing rapidly. Morphine is the most abundant opiate found in Papaver somniferum (the opium poppy). sjwang 2019-03-27T15:52:55Z CHEBI:17303 MESH:D009020 experimental_condition_ontology XCO:0000610 morphine This is any condition in which the main influencing factor is morphine, the main alkaloid of opium that is a highly potent opiate analgesic psychoactive drug. Morphine acts directly on the central nervous system (CNS) to relieve pain but has a high potential for addiction, with tolerance and both physical and psychological dependence developing rapidly. Morphine is the most abundant opiate found in Papaver somniferum (the opium poppy). CHEBI:17303 CID:5288826 This is any condition in which the main influencing factor is nifedipine, a potent vasodilator agent with calcium antagonistic action. It is a useful anti-anginal agent that also lowers blood pressure. sjwang 2019-04-22T16:41:50Z CHEBI:7565 CID:4485 dimethyl 2,6-dimethyl-4-(2-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate experimental_condition_ontology XCO:0000611 nifedipine This is any condition in which the main influencing factor is nifedipine, a potent vasodilator agent with calcium antagonistic action. It is a useful anti-anginal agent that also lowers blood pressure. MESH:D009543 This is any condition in which the main influencing factor is endothelin-1, a 21-amino acid peptide produced in a variety of tissues including endothelial and vascular smooth-muscle cells, neurons and astrocytes in the central nervous system, and endometrial cells. It acts as a modulator of vasomotor tone, cell proliferation, and hormone production. sjwang 2019-05-08T14:50:29Z CHEBI:80240 CID:16212950 PMID:12070093 ET-1 Edn1 Et1 experimental_condition_ontology XCO:0000612 endothelin-1 This is any condition in which the main influencing factor is endothelin-1, a 21-amino acid peptide produced in a variety of tissues including endothelial and vascular smooth-muscle cells, neurons and astrocytes in the central nervous system, and endometrial cells. It acts as a modulator of vasomotor tone, cell proliferation, and hormone production. PMID:7609754 Adenosine Triphosphate (ATP) is an adenine nucleotide comprised of three phosphate groups esterified to the sugar moiety, found in all living cells. Adenosine triphosphate is involved in energy production for metabolic processes and RNA synthesis. In addition, this substance acts as a neurotransmitter. In cancer studies, adenosine triphosphate is synthesized to examine its use to decrease weight loss and improve muscle strength. sjwang 2019-05-08T15:10:50Z CHEBI:15422 pubchem.compound:5957 experimental_condition_ontology XCO:0000613 adenosine triphosphate Adenosine Triphosphate (ATP) is an adenine nucleotide comprised of three phosphate groups esterified to the sugar moiety, found in all living cells. Adenosine triphosphate is involved in energy production for metabolic processes and RNA synthesis. In addition, this substance acts as a neurotransmitter. In cancer studies, adenosine triphosphate is synthesized to examine its use to decrease weight loss and improve muscle strength. https://ncit.nci.nih.gov/ncitbrowser/ A phosphodiesterase 4 inhibitor with antidepressant properties. sjwang 2019-05-22T13:50:17Z CHEBI:104872 experimental_condition_ontology XCO:0000614 rolipram A phosphodiesterase 4 inhibitor with antidepressant properties. https://www.ncbi.nlm.nih.gov/mesh/68020889 This is a condition in which the main influencing factor is an injection of a coagulated blood clot to the middle cerebral artery to induce an embolic stroke in an experimental subject. sjwang 2019-05-22T14:06:17Z experimental_condition_ontology XCO:0000615 embolism injection of middle cerebral artery Verapamil is a calcium channel blocker that is a class IV anti-arrhythmia agent. sjwang 2019-05-23T14:15:07Z CHEBI:9948 pubchem.compound:2520 experimental_condition_ontology XCO:0000616 verapamil Verapamil is a calcium channel blocker that is a class IV anti-arrhythmia agent. https://www.ncbi.nlm.nih.gov/mesh?Db=mesh&Cmd=DetailsSearch&Term=%22Verapamil%22%5BMeSH+Terms%5D This is any condition in which the main influencing factor is quinidine, a stereoisomer of quinine which dampens the excitability of cardiac and skeletal muscles by blocking voltage-gated sodium channels and potassium channels. Quinidine prolongs action potentials, blocks muscarinic and alpha-adrenergic neurotransmission, and inhibits multiple enzymes. sjwang 2019-05-23T14:24:09Z CHEBI:28593 CID:441074 MESH:68011802 (9S)-6'-methoxycinchonan-9-ol alpha-(6-Methoxy-4-quinolyl)-5-vinyl-2-quinuclidinemethanol experimental_condition_ontology XCO:0000617 quinidine This is any condition in which the main influencing factor is quinidine, a stereoisomer of quinine which dampens the excitability of cardiac and skeletal muscles by blocking voltage-gated sodium channels and potassium channels. Quinidine prolongs action potentials, blocks muscarinic and alpha-adrenergic neurotransmission, and inhibits multiple enzymes. MESH:68011802 A class of drugs that act by inhibition of sodium influx through cell membranes. Blockade of sodium channels slows the rate and amplitude of initial rapid depolarization, reduces cell excitability, and reduces conduction velocity. sjwang 2019-05-23T14:37:49Z Sodium Channel Blockers experimental_condition_ontology XCO:0000618 sodium channel inhibitor A class of drugs that act by inhibition of sodium influx through cell membranes. Blockade of sodium channels slows the rate and amplitude of initial rapid depolarization, reduces cell excitability, and reduces conduction velocity. drugbank.category:DBCAT000600 A cardenolide glycoside that is digitoxin &#946;-hydroxylated at C-12. A cardiac glycoside extracted from the foxglove plant, Digitalis lanata, it is used to control ventricular rate in atrial fibrillation and in the management of congestive heart failure with atrial fibrillation, but the margin between toxic and therapeutic doses is small. sjwang 2019-05-23T14:45:00Z CHEBI:4551 pubchem.compound:2724385 experimental_condition_ontology XCO:0000619 digoxin Vinblastine is a natural alkaloid isolated from the plant Vinca rosea Linn. Vinblastine binds to tubulin and inhibits microtubule formation, resulting in disruption of mitotic spindle assembly and arrest of tumor cells in the M phase of the cell cycle. This agent may also interfere with amino acid, cyclic AMP, and glutathione metabolism; calmodulin-dependent Ca++ -transport ATPase activity; cellular respiration; and nucleic acid and lipid biosynthesis. sjwang 2019-05-23T15:08:50Z CHEBI:1322 pubchem.compound:13342 experimental_condition_ontology XCO:0000620 vinblastine Vinblastine is a natural alkaloid isolated from the plant Vinca rosea Linn. Vinblastine binds to tubulin and inhibits microtubule formation, resulting in disruption of mitotic spindle assembly and arrest of tumor cells in the M phase of the cell cycle. This agent may also interfere with amino acid, cyclic AMP, and glutathione metabolism; calmodulin-dependent Ca++ -transport ATPase activity; cellular respiration; and nucleic acid and lipid biosynthesis. https://ncit-stage.nci.nih.gov/ncitbrowser/ConceptReport.jsp?dictionary=NCI_Thesaurus&code=C930&ns=ncit Verapamil hydrochloride, tritiated on the N-methyl group. Verapamil acts as a calcium channel blocker sjwang 2019-05-23T15:20:09Z [Nmethyl- 3H]verapamil hydrochloride experimental_condition_ontology XCO:0000621 tritiated verapamil sjwang 2019-05-23T15:28:31Z p-3H]quinidine experimental_condition_ontology XCO:0000622 tritiated quinidine sjwang 2019-05-23T15:34:38Z Digoxin, [3H(G)]- experimental_condition_ontology XCO:0000623 tritiated digoxin A short-acting barbiturate derivative invented in the 1950s. It has sedative, anticonvulsant and hypnotic effects, and is still used in veterinary medicine for induction in surgical anaesthesia. sjwang 2019-07-17T10:08:35Z experimental_condition_ontology Brevinarcon Inactin XCO:0000624 thiobutabarbital A short-acting barbiturate derivative invented in the 1950s. It has sedative, anticonvulsant and hypnotic effects, and is still used in veterinary medicine for induction in surgical anaesthesia. https://en.wikipedia.org/wiki/Thiobutabarbital Antineoplastic agent that is also used as a veterinary anesthetic. sjwang 2019-07-17T10:12:04Z CHEBI:17967 MESH:D014520 experimental_condition_ontology XCO:0000625 urethane Surgical removal of a maxillary molar crown at the gingival line. sjwang 2019-07-17T10:22:31Z experimental_condition_ontology XCO:0000626 removal of maxillary molar crown Any condition in which the main influencing factor is spironolactone, a potassium-sparing diuretic that competitively inhibits mineralocorticoid receptors in the distal convoluted tubule to promote sodium and water excretion and potassium retention. Spironolactone is indicated to treat a number of conditions including heart failure, edema, hyperaldosteronism, adrenal hyperplasia, hypertension, and nephrotic syndrome. sjwang 2019-07-24T14:33:14Z CHEBI:9241 MESH:D013148 7alpha-(acetylsulfanyl)-3-oxo-17alpha-pregn-4-ene-21,17-carbolactone experimental_condition_ontology XCO:0000627 spironolactone Any condition in which the main influencing factor is spironolactone, a potassium-sparing diuretic that competitively inhibits mineralocorticoid receptors in the distal convoluted tubule to promote sodium and water excretion and potassium retention. Spironolactone is indicated to treat a number of conditions including heart failure, edema, hyperaldosteronism, adrenal hyperplasia, hypertension, and nephrotic syndrome. drugbank:DB00421 Atorvastatin (Lipitor) is a member of the drug class known as statins. It is used for lowering cholesterol. Atorvastatin is a competitive inhibitor of hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase, the rate-determining enzyme in cholesterol biosynthesis via the mevalonate pathway. HMG-CoA reductase catalyzes the conversion of HMG-CoA to mevalonate. Atorvastatin acts primarily in the liver. Decreased hepatic cholesterol levels increases hepatic uptake of cholesterol and reduces plasma cholesterol levels. sjwang 2019-07-24T15:29:21Z CHEBI:39548 (3R,5R)-7-[3-(anilinocarbonyl)-5-(4-fluorophenyl)-4-phenyl-2-(propan-2-yl)-1H-pyrrol-1-yl]-3,5-dihydroxyheptanoic acid Lipitor experimental_condition_ontology XCO:0000628 atorvastatin Atorvastatin (Lipitor) is a member of the drug class known as statins. It is used for lowering cholesterol. Atorvastatin is a competitive inhibitor of hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase, the rate-determining enzyme in cholesterol biosynthesis via the mevalonate pathway. HMG-CoA reductase catalyzes the conversion of HMG-CoA to mevalonate. Atorvastatin acts primarily in the liver. Decreased hepatic cholesterol levels increases hepatic uptake of cholesterol and reduces plasma cholesterol levels. https://en.wikipedia.org/wiki/Atorvastatin An agent derived from licorice root. It is used for the treatment of digestive tract ulcers, especially in the stomach. Antidiuretic side effects are frequent, but otherwise the drug is low in toxicity. sjwang 2019-07-24T16:11:51Z MESH:D002229 pubchem.compound:636403 experimental_condition_ontology XCO:0000629 carbenoxolone Agents that bind to cholinoceptors (muscarinic or nicotinic) and prevent the effects of acetylcholine (ACh) and other cholinergic agonists. sjwang 2019-07-30T14:47:58Z experimental_condition_ontology XCO:0000630 cholinergic antagonist A naturally occurring belladonna alkaloid, is a racemic mixture of equal parts of d- and l-hyoscyamine, whose activity is due almost entirely to the levo isomer of the drug. Atropine is commonly classified as an anticholinergic or antiparasympathetic (parasympatholytic) drug. More precisely, however, it is termed an antimuscarinic agent since it antagonizes the muscarine-like actions of acetylcholine and other choline esters. sjwang 2019-07-30T14:53:02Z CHEBI:16684 experimental_condition_ontology XCO:0000631 atropine A naturally occurring belladonna alkaloid, is a racemic mixture of equal parts of d- and l-hyoscyamine, whose activity is due almost entirely to the levo isomer of the drug. Atropine is commonly classified as an anticholinergic or antiparasympathetic (parasympatholytic) drug. More precisely, however, it is termed an antimuscarinic agent since it antagonizes the muscarine-like actions of acetylcholine and other choline esters. drugbank:DB00572 A monocarboxylic acid amide obtained by formal condensation of the carboxy group of (2S)-amino(3-hydroxyadamantan-1-yl)acetic acid with the amino group of (1S,3S,5S)-2-azabicyclo[3.1.0]hexane-3-carbonitrile. Used in its monohydrate form for the treatment of Type II diabetes. It belongs to the biological class EC 3.4.14.5 (dipeptidyl-peptidase IV) inhibitor . sjwang 2019-07-30T14:58:42Z CHEBI:71272 MESH:C502994 3-hydroxyadamantylglycine-4,5-methanoprolinenitrile hydrate BMS 477118 Onglyza experimental_condition_ontology XCO:0000632 saxagliptin A monocarboxylic acid amide obtained by formal condensation of the carboxy group of (2S)-amino(3-hydroxyadamantan-1-yl)acetic acid with the amino group of (1S,3S,5S)-2-azabicyclo[3.1.0]hexane-3-carbonitrile. Used in its monohydrate form for the treatment of Type II diabetes. It belongs to the biological class EC 3.4.14.5 (dipeptidyl-peptidase IV) inhibitor . CHEBI:71272 Cortisol is a steroid hormone, in the glucocorticoid class of hormones. When used as a medication, it is known as hydrocortisone. It is produced in many animals mainly by the zona fasciculata of the adrenal cortex within the adrenal gland. sjwang 2019-07-30T16:03:10Z experimental_condition_ontology cortisol XCO:0000633 hydrocortisone Cortisol is a steroid hormone, in the glucocorticoid class of hormones. When used as a medication, it is known as hydrocortisone. It is produced in many animals mainly by the zona fasciculata of the adrenal cortex within the adrenal gland. https://en.wikipedia.org/wiki/Cortisol This is a condition in which the main influencing factor is an antidiuretic, a substance that helps to control fluid balance in an animal's body by reducing urination, opposing diuresis. Its effects are opposite that of a diuretic. sjwang 2019-07-30T16:16:56Z experimental_condition_ontology XCO:0000634 antidiuretic A naturally occurring sugar polymer that acts as an energy storage molecule in plants. It is an inulin analogue and highly soluble in water . sjwang 2019-07-30T16:18:43Z Inutest Polyfructosan-S Sinistrin experimental_condition_ontology XCO:0000635 polyfructosan A naturally occurring sugar polymer that acts as an energy storage molecule in plants. It is an inulin analogue and highly soluble in water . https://en.wikipedia.org/wiki/Sinistrin This is any condition in which the main influencing factor is an agent that suppresses immune function by one of several mechanisms of action. Classical cytotoxic immunosuppressants act by inhibiting DNA synthesis. Others may act through activation of T-cells or by inhibiting the activation of helper cells. In addition, an immunosuppressive agent is a role played by a compound which is exhibited by a capability to diminish the extent and/or voracity of an immune response. sjwang 2019-08-01T12:47:37Z CHEBI:35705 experimental_condition_ontology XCO:0000636 immunosuppressive agent This is any condition in which the main influencing factor is an agent that suppresses immune function by one of several mechanisms of action. Classical cytotoxic immunosuppressants act by inhibiting DNA synthesis. Others may act through activation of T-cells or by inhibiting the activation of helper cells. In addition, an immunosuppressive agent is a role played by a compound which is exhibited by a capability to diminish the extent and/or voracity of an immune response. CHEBI:35705 A cyclic nonribosomal peptide of eleven amino acids; an immunosuppressant drug widely used in post-allogeneic organ transplant to reduce the activity of the patient's immune system, and therefore the risk of organ rejection. Also causes reversible inhibition of immunocompetent lymphocytes in the G0- and G1-phase of the cell cycle. sjwang 2019-08-01T12:50:36Z CHEBI:4031 experimental_condition_ontology cyclosporine XCO:0000637 cyclosporine A A cyclic nonribosomal peptide of eleven amino acids; an immunosuppressant drug widely used in post-allogeneic organ transplant to reduce the activity of the patient's immune system, and therefore the risk of organ rejection. Also causes reversible inhibition of immunocompetent lymphocytes in the G0- and G1-phase of the cell cycle. CHEBI:4031 A benzazepine that is 2,3,4,5-tetrahydro-1H-2-benzazepine which is substituted by hydroxy groups at positions 7 and 8 and on the nitrogen atom by a 2-(p-chlorophenyl)ethylaminothiocarbonyl group. A synthetic analogue of capsaicin, it was the first reported capsaicin receptor antagonist. sjwang 2019-08-01T12:59:35Z CHEBI:70773 experimental_condition_ontology XCO:0000638 Capsazepine A benzazepine that is 2,3,4,5-tetrahydro-1H-2-benzazepine which is substituted by hydroxy groups at positions 7 and 8 and on the nitrogen atom by a 2-(p-chlorophenyl)ethylaminothiocarbonyl group. A synthetic analogue of capsaicin, it was the first reported capsaicin receptor antagonist. CHEBI:70773 Peptides developed according to the calcineurin A-interacting site on the C-terminus of Trpv1 was were synthesized as 1 polypeptide with transactivator of transcription (TAT)47&#8208;57 carrier in the following order: N&#8208;terminus–TAT47&#8208;57–spacer (Gly&#8208;Gly)–cargo–C terminus. sjwang 2019-08-01T14:16:00Z experimental_condition_ontology XCO:0000639 V1-Cal Peptides developed according to the calcineurin A-interacting site on the C-terminus of Trpv1 was were synthesized as 1 polypeptide with transactivator of transcription (TAT)47&#8208;57 carrier in the following order: N&#8208;terminus–TAT47&#8208;57–spacer (Gly&#8208;Gly)–cargo–C terminus. PMID:27671317 Any experimental condition in which the internal or external environment of the myocardial system is altered. sjwang 2019-08-01T14:40:57Z experimental_condition_ontology XCO:0000640 controlled in situ myocardial condition Any experimental condition in which the internal or external environment of the myocardial system is altered. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is myocardial reperfusion, any situation in which the flow of blood to the heart is restored after a period of blood vessel occlusion occurring experimentally. sjwang 2019-08-01T14:50:02Z PMID:26448786 PMID:27671317 myocardial ischemia-reperfusion myocardial ischemia/reperfusion myocardium ischemia-reperfusion myocardium ischemia/reperfusion experimental_condition_ontology XCO:0000641 myocardial reperfusion This is any condition in which the main influencing factor is myocardial reperfusion, any situation in which the flow of blood to the heart is restored after a period of blood vessel occlusion occurring experimentally. ISBN-13:978-1455756438 https://www.merriam-webster.com/ Monocrotaline is a pyrrolizidine alkaloid and a toxic plant constituent that poisons livestock and humans through the ingestion of contaminated grains and other foods. The alkaloid causes pulmonary artery hypertension, right ventricular hypertrophy, and pathological changes in the pulmonary vasculature. Significant attenuation of the cardiopulmonary changes are noted after oral magnesium treatment. sjwang 2019-08-01T17:00:38Z CHEBI:6980 CID:9415 MESH:D016686 MCT crotaline experimental_condition_ontology XCO:0000642 monocrotaline Monocrotaline is a pyrrolizidine alkaloid and a toxic plant constituent that poisons livestock and humans through the ingestion of contaminated grains and other foods. The alkaloid causes pulmonary artery hypertension, right ventricular hypertrophy, and pathological changes in the pulmonary vasculature. Significant attenuation of the cardiopulmonary changes are noted after oral magnesium treatment. https://www.ncbi.nlm.nih.gov/mesh/68016686 sjwang 2019-10-03T15:41:29Z experimental_condition_ontology XCO:0000643 controlled exposure to a foster mother of a different strain within the same species. A monoclonal antibody that appears to be specific for a constant determinant of the rat alpha/beta heterodimeric T cell receptor. sjwang 2019-11-05T10:21:40Z R73 experimental_condition_ontology XCO:0000644 anti-T cell receptor antibody This is any condition in which the main influencing factor is propofol, an intravenous anesthetic agent which has a very rapid onset after infusion or bolus injection plus a very short recovery period of a couple of minutes. Propofol has also been used as an anticonvulsant and antiemetic. sjwang 2019-11-27T12:37:25Z CHEBI:44915 CID:4943 2,6-DIISOPROPYLPHENOL 2,6-bis(propan-2-yl)phenol experimental_condition_ontology XCO:0000645 propofol This is any condition in which the main influencing factor is propofol, an intravenous anesthetic agent which has a very rapid onset after infusion or bolus injection plus a very short recovery period of a couple of minutes. Propofol has also been used as an anticonvulsant and antiemetic. MESH:D015742 This is any condition in which the main influencing factor is azoxymethane (AOM), a gene mutation agent that may be used with dextran sulfate sodium (DSS) to create colon cancer models in laboratory animals. sjwang 2019-12-04T15:04:39Z CAS:25843-45-2 CID:33184 MDL:MFCD00126912 PMID:16928827 AOM experimental_condition_ontology XCO:0000646 azoxymethane A selective endothelin ETA receptor antagonist. It is being evaluated as a treatment for congestive heart failure and hypertension. slaulede 2019-12-09T18:27:43Z experimental_condition_ontology XCO:0000647 darusentan A selective endothelin ETA receptor antagonist. It is being evaluated as a treatment for congestive heart failure and hypertension. drugbank:DB04883 An organochlorine compound that is methylene chloride in which both hydrogens are replaced by phosphonic acid groups. It inhibits bone resorption and soft tissue calcification, and is used (often as the disodium salt tetrahydrate) as an adjunct in the treatment of severe hypercalcemia associated with malignancy, and in the management of osteolytic lesions and bone pain associated with skeletal metastases. slaulede 2019-12-10T17:07:59Z (dichloromethanediyl)bis(phosphonic acid) clodronate experimental_condition_ontology XCO:0000648 clodronic acid An organochlorine compound that is methylene chloride in which both hydrogens are replaced by phosphonic acid groups. It inhibits bone resorption and soft tissue calcification, and is used (often as the disodium salt tetrahydrate) as an adjunct in the treatment of severe hypercalcemia associated with malignancy, and in the management of osteolytic lesions and bone pain associated with skeletal metastases. CHEBI:110423 This is any condition in which the main influencing factor is trans-4-hydroxy-L-proline, an optically active form of 4-hydroxyproline having L-trans-configuration. Trans-4-hydroxy-L-proline is a human, mouse, and plant metabolite that is also used to cause disease in a rat model of urolithiasis. sjwang 2019-12-12T13:16:31Z CHEBI:18095 experimental_condition_ontology XCO:0000649 trans-4-hydroxy-L-proline This is any condition in which the main influencing factor is trans-4-hydroxy-L-proline, an optically active form of 4-hydroxyproline having L-trans-configuration. Trans-4-hydroxy-L-proline is a human, mouse, and plant metabolite that is also used to cause disease in a rat model of urolithiasis. CHEBI:18095 PMID:37334022 A drink made up of water and a specified amount of cilazapril consumed by an organism as part of an experiment. Cilazapril is a prodrug that is hydrolyzed to its main metabolite cilazaprilat, an inhibitor of angiotensin-converting enzyme (ACE). slaulede 2019-12-16T15:56:17Z experimental_condition_ontology XCO:0000650 controlled cilazapril content drinking water A condition in which the main influencing factor is E4177, an agent that blocks one or more angiotensin II receptors. slaulede 2019-12-16T16:34:05Z 4'-((2-cyclopropyl-7-methyl-3H-imidazo[4,5-b]pyridin-3-yl)methyl)-[1,1'-biphenyl]-2-carboxylic acid E-4177 experimental_condition_ontology XCO:0000651 E4177 A drink made up of water and a specified amount of E4177 consumed by an organism as part of an experiment. E4177 is an agent that blocks one or more angiotensin II receptors. slaulede 2019-12-16T16:39:42Z controlled 4'-((2-cyclopropyl-7-methyl-3H-imidazo[4,5-b]pyridin-3-yl)methyl)-[1,1'-biphenyl]-2-carboxylic acid content drinking water controlled E-4177 content drinking water experimental_condition_ontology XCO:0000652 controlled E4177 content drinking water Any condition in which the main influencing factor is an agent that blocks the transmembrane transfer of an ion by a channel that opens when glutamate has been bound by the channel complex or one of its constituent parts. slaulede 2019-12-16T17:38:36Z experimental_condition_ontology XCO:0000653 ionotropic glutamate receptor antagonist Kynurenate is a product of the metabolism of L-Tryptophan and appears in urine in Vitamin B6 deficiencies. Kynurenate is an endogenous antagonist of the ionotropic glutamate receptors. slaulede 2019-12-16T17:41:34Z experimental_condition_ontology XCO:0000654 kynurenate An abnormal form of prion protein that in mammals includes pathogenic forms which arise sporadically, as a result of genetic mutation, or by transmission (as by ingestion of infected tissue) and which upon accumulation in the brain cause a prion disease (such as bovine spongiform encephalopathy or Creutzfeldt-Jakob disease. slaulede 2019-12-19T11:45:30Z proteinacious infectious particle experimental_condition_ontology XCO:0000655 prion An abnormal form of prion protein that in mammals includes pathogenic forms which arise sporadically, as a result of genetic mutation, or by transmission (as by ingestion of infected tissue) and which upon accumulation in the brain cause a prion disease (such as bovine spongiform encephalopathy or Creutzfeldt-Jakob disease. https://www.merriam-webster.com/dictionary/prion An oxopurine that is guanine substituted by a [(1,3-dihydroxypropan-2-yl)oxy]methyl group at position 9. Ganciclovir is an antiviral drug used to treat or prevent AIDS-related cytomegalovirus infections sjwang 2020-01-28T10:22:22Z experimental_condition_ontology XCO:0000656 ganciclovir A substance that kills or slows the growth of a virus. sjwang 2020-01-28T10:24:15Z experimental_condition_ontology XCO:0000657 antiviral agent A racemate consisting of equimolar amounts of (R)- and (S)-nisoldipine. A calcium channel blocker, it is used in the treatment of hypertension and angina pectoris. slaulede 2020-01-28T16:25:54Z MESH:D015737 rac-methyl 2-methylpropyl 2,6-dimethyl-4-(2-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate experimental_condition_ontology XCO:0000658 nisoldipine A racemate consisting of equimolar amounts of (R)- and (S)-nisoldipine. A calcium channel blocker, it is used in the treatment of hypertension and angina pectoris. CHEBI:7577 A regimen of solid food in which the amount of nisoldipine consumed is maintained at a specified level. slaulede 2020-01-28T16:42:16Z experimental_condition_ontology XCO:0000659 controlled nisoldipine content diet A drink made up of water and a specified amount of nisoldipine in which the amount of nisoldipine consumed is maintained at a specified level. slaulede 2020-01-28T16:53:19Z experimental_condition_ontology XCO:0000660 controlled nisoldipine content drinking water A surgical manipulation causing blood vessel blockage by the clipping of one renal artery and surgical removal of the contralateral kidney. slaulede 2020-01-31T09:44:27Z 1k1c experimental_condition_ontology XCO:0000661 one-kidney, one-clip occlusion A surgical manipulation causing blood vessel blockage by the clipping of one renal artery and surgical removal of the contralateral kidney. https://www.hindawi.com/journals/bmri/2015/528757/tab1/ A surgical manipulation causing blood vessel blockage by the clipping of one renal artery. slaulede 2020-01-31T09:55:35Z 2K1C Goldblatt method experimental_condition_ontology renal artery ligation XCO:0000662 two-kidney, one-clip occlusion A surgical manipulation causing blood vessel blockage by the clipping of one renal artery. https://www.hindawi.com/journals/bmri/2015/528757/tab1/ A surgical manipulation causing blood vessel blockage by the dissection and clipping of both renal arteries. slaulede 2020-01-31T10:08:45Z 2K2C experimental_condition_ontology XCO:0000663 two-kidney, two-clip occlusion A surgical manipulation causing blood vessel blockage by the dissection and clipping of both renal arteries. https://www.hindawi.com/journals/bmri/2015/528757/tab1/ An agent that selectively binds to and activates adrenergic receptors. slaulede 2020-02-11T14:23:32Z adrenergic agonists adrenoceptor agonists adrenomimetic adrenomimetics experimental_condition_ontology XCO:0000664 adrenergic receptor agonist An agent that selectively binds to and activates adrenergic receptors. CHEBI:37886 A substance that selectively binds to and activates beta-adrenergic receptors. slaulede 2020-02-11T14:28:45Z CHEBI:35522 beta-adrenergic agonists beta-adrenergic receptor agonist beta-adrenergic receptor agonists beta-adrenoceptor agonists experimental_condition_ontology XCO:0000665 beta-adrenergic agonist A substance that selectively binds to and activates beta-adrenergic receptors. CHEBI:35522 Any condition in which the main influencing factor is a substance that causes an increase in the expansion of a bronchus or bronchial tubes. slaulede 2020-02-11T14:48:25Z bronchodilator bronchodilator agents broncholytic agent experimental_condition_ontology XCO:0000666 bronchodilator agent A beta-adrenergic receptor agonist that is 2,6-dichloroaniline in which the hydrogen at position 4 has been replaced by a 2-(tert-butylamino)-1-hydroxyethyl group. slaulede 2020-02-11T14:51:50Z MESH:D002976 CHEBI:174690 1-(4-amino-3,5-dichlorophenyl)-2-(tert-butylamino)ethanol experimental_condition_ontology XCO:0000667 clenbuterol A beta-adrenergic receptor agonist that is 2,6-dichloroaniline in which the hydrogen at position 4 has been replaced by a 2-(tert-butylamino)-1-hydroxyethyl group. CHEBI:174690 The insertion of a tubular, flexible surgical instrument into an artery to withdraw a substantial, yet controlled, amount of blood. slaulede 2020-02-11T16:01:15Z arterial catheter implantation and bleeding arterial catheter implantation and hemorrhaging experimental_condition_ontology XCO:0000668 arterial catheter implantation and controlled hemorrhage Any condition in which the main influencing factor is diazoxide, a benzothiadiazine that is the S,S-dioxide of 2H-1,2,4-benzothiadiazine which is substituted at position 3 by a methyl group and at position 7 by chlorine. A peripheral vasodilator, it increases the concentration of glucose in the plasma and inhibits the secretion of insulin by the beta- cells of the pancreas. It is used orally in the management of intractable hypoglycaemia and intravenously in the management of hypertensive emergencies. slaulede 2020-03-05T14:07:13Z CHEBI:4495 Proglycem experimental_condition_ontology XCO:0000669 diazoxide Any condition in which the main influencing factor is diazoxide, a benzothiadiazine that is the S,S-dioxide of 2H-1,2,4-benzothiadiazine which is substituted at position 3 by a methyl group and at position 7 by chlorine. A peripheral vasodilator, it increases the concentration of glucose in the plasma and inhibits the secretion of insulin by the beta- cells of the pancreas. It is used orally in the management of intractable hypoglycaemia and intravenously in the management of hypertensive emergencies. CHEBI:4495 A technique in which the amount of food provided to a control group of animals is matched to that consumed by the experimental group, so as to determine the extent to which the effect of a treatment on body weight or body composition occurred independently of changes of energy intake. slaulede 2020-03-05T14:46:27Z experimental_condition_ontology XCO:0000670 Pair-fed diet A technique in which the amount of food provided to a control group of animals is matched to that consumed by the experimental group, so as to determine the extent to which the effect of a treatment on body weight or body composition occurred independently of changes of energy intake. PMID:20620991 A tetracycline in which the 5beta-hydrogen is replaced by a hydroxy group, while the 6alpha-hydroxy group is replaced by hydrogen. A semi-synthetic tetracycline antibiotic, it is used to inhibit bacterial protein synthesis and treat non-gonococcal urethritis and cervicitis, exacerbations of bronchitis in patients with chronic obstructive pulmonary disease (COPD), and adult periodontitis. slaulede 2020-03-05T15:49:21Z CHEBI:50845 Doryx Doxyhexal Doxylin experimental_condition_ontology XCO:0000671 doxycycline A tetracycline in which the 5beta-hydrogen is replaced by a hydroxy group, while the 6alpha-hydroxy group is replaced by hydrogen. A semi-synthetic tetracycline antibiotic, it is used to inhibit bacterial protein synthesis and treat non-gonococcal urethritis and cervicitis, exacerbations of bronchitis in patients with chronic obstructive pulmonary disease (COPD), and adult periodontitis. CHEBI:50845 This is any condition in which the main influencing factor is a subclass of polyketides having an octahydrotetracene-2-carboxamide skeleton, substituted with many hydroxy and other groups. slaulede 2020-03-05T16:13:01Z MESH:D013754 CHEBI:26895 experimental_condition_ontology XCO:0000672 tetracyclines This is any condition in which the main influencing factor is a subclass of polyketides having an octahydrotetracene-2-carboxamide skeleton, substituted with many hydroxy and other groups. CHEBI:26895 This is any condition in which the main influencing factor is an alpha-adrenergic agonist, an agent that selectively binds to and activates alpha-adrenergic receptors. slaulede 2020-03-05T16:49:13Z CHEBI:35569 alpha-adrenergic agonists alpha-adrenergic receptor agonist alpha-adrenoceptor agonists experimental_condition_ontology XCO:0000673 alpha-adrenergic agonist This is any condition in which the main influencing factor is an alpha-adrenergic agonist, an agent that selectively binds to and activates alpha-adrenergic receptors. CHEBI:35569 This is any condition in which the main influencing factor is clonidine, an imidazoline sympatholytic agent that stimulates alpha-2 adrenergic receptors and central imidazoline receptors. It is commonly used in the management of hypertension. slaulede 2020-03-05T16:56:21Z CHEBI:46631 MESH:D003000 Catapres Kapvay Nexiclon experimental_condition_ontology XCO:0000674 clonidine This is any condition in which the main influencing factor is clonidine, an imidazoline sympatholytic agent that stimulates alpha-2 adrenergic receptors and central imidazoline receptors. It is commonly used in the management of hypertension. MESH:D003000 A condition in which gene transfer has been performed using a retrovirus as the carrier of the genetic material. A retrovirus is any of a family (Retroviridae) of single-stranded RNA viruses that produce reverse transcriptase by means of which DNA is produced using their RNA as a template and incorporated into the genome of infected cells. slaulede 2020-03-06T11:39:41Z retroviral gene transfer retrovirus transfer experimental_condition_ontology XCO:0000675 gene transfer using a retrovirus vector A condition in which gene transfer has been performed using a retrovirus as the carrier of the genetic material. A retrovirus is any of a family (Retroviridae) of single-stranded RNA viruses that produce reverse transcriptase by means of which DNA is produced using their RNA as a template and incorporated into the genome of infected cells. https://www.merriam-webster.com/dictionary/retrovirus A condition in which the rat erb-b2 receptor tyrosine kinase 2 gene (Erbb2) gene has been (transiently or stably) transferred into a cell or organism using a retrovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulede 2020-03-06T12:01:39Z retroviral transfer of the rat Erbb2 gene transfer of recombinant retrovirus containing the rat Erbb2 gene experimental_condition_ontology pJR-neu XCO:0000676 gene transfer of the rat erb-b2 receptor tyrosine kinase 2 gene using a retrovirus vector A condition in which the rat erb-b2 receptor tyrosine kinase 2 gene (Erbb2) gene has been (transiently or stably) transferred into a cell or organism using a retrovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:1913683 A drink made up of water and a specified amount of enalapril consumed by an organism as part of an experiment. Enalapril, a prodrug that is rapidly metabolized in the liver to enalaprilat, is a potent, competitive inhibitor of angiotensin-converting enzyme (ACE). slaulede 2020-03-06T13:46:09Z controlled Enacard content drinking water controlled Renitec content drinking water controlled Vasotec content drinking water experimental_condition_ontology XCO:0000677 controlled enalapril content drinking water A drink made up of water and a specified amount of enalapril consumed by an organism as part of an experiment. Enalapril, a prodrug that is rapidly metabolized in the liver to enalaprilat, is a potent, competitive inhibitor of angiotensin-converting enzyme (ACE). American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed https://en.wikipedia.org/wiki/Enalapril This is any condition in which the main influencing factor is the transfer (transiently or stably) of the rat MER proto-oncogene, tyrosine kinase gene into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulede 2020-03-13T14:57:43Z PMID:11592982 RGD:69283 adenoviral transfer of the rat Mertk gene transfer of recombinant adenovirus containing the rat Mertk gene experimental_condition_ontology Ad-Mertk XCO:0000678 gene transfer of the rat MER proto-oncogene, tyrosine kinase gene using an adenovirus vector This is any condition in which the main influencing factor is the transfer (transiently or stably) of the rat MER proto-oncogene, tyrosine kinase gene into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:11592982 Webster:Random_House_Kernerman_Websters_College_Dictionary_2010 A chlorobenzophenone that is (4-chlorophenyl)(phenyl)methanone substituted by a [2-methyl-1-oxo-1-(propan-2-yloxy)propan-2-yl]oxy group at position 1 on the phenyl ring. Used as a lipid -lowering drug. slaulede 2020-04-20T13:16:09Z CHEBI:5001 MESH:D011345 experimental_condition_ontology XCO:0000679 fenofibrate A chlorobenzophenone that is (4-chlorophenyl)(phenyl)methanone substituted by a [2-methyl-1-oxo-1-(propan-2-yloxy)propan-2-yl]oxy group at position 1 on the phenyl ring. Used as a lipid -lowering drug. CHEBI:5001 This is any condition in which the main influencing factor is a substance used to treat hyperlipidemia (an excess of lipids in the blood). slaulede 2020-04-20T13:26:24Z CHEBI:35679 antilipemic drug experimental_condition_ontology XCO:0000680 antilipemic agent This is any condition in which the main influencing factor is a substance used to treat hyperlipidemia (an excess of lipids in the blood). CHEBI:35679 This is any condition in which the main influencing factor is Medica 16, an &#945;,&#969;-dicarboxylic acid that is hexadecanedioic acid carrying methyl groups at positions 3 and 14. It is a free fatty acid 1 (FFA1/GPR40) receptor agonist and an ATP citrate lyase inhibitor, and exhibits hypolipidemic and antidiabetogenic properties. slaulede 2020-04-24T12:47:27Z CAS:87272-20-6 CHEBI:149582 3,3,14,14-Tetramethylhexadecanedioic acid Medic-16 experimental_condition_ontology XCO:0000681 Medica 16 This is any condition in which the main influencing factor is Medica 16, an &#945;,&#969;-dicarboxylic acid that is hexadecanedioic acid carrying methyl groups at positions 3 and 14. It is a free fatty acid 1 (FFA1/GPR40) receptor agonist and an ATP citrate lyase inhibitor, and exhibits hypolipidemic and antidiabetogenic properties. CHEBI:149582 A benzoate ester that has formula C19H20F3NO2. Functionally, it is an anorectic and hypolipidemic agent. slaulede 2020-04-27T18:51:37Z Mediator benzoic acid 2-[1-[3-(trifluoromethyl)phenyl]propan-2-ylamino]ethyl ester experimental_condition_ontology XCO:0000682 Benfluorex A benzoate ester that has formula C19H20F3NO2. Functionally, it is an anorectic and hypolipidemic agent. CHEBI:93826 https://en.wikipedia.org/wiki/Benfluorex A bile acid-binding anticholesteremic drug that helps decrease the risk for strokes and heart attacks. slaulede 2020-04-30T12:29:58Z Cholestyramine resin Prevalite Questran experimental_condition_ontology XCO:0000683 cholestyramine A bile acid-binding anticholesteremic drug that helps decrease the risk for strokes and heart attacks. https://www.webmd.com/drugs/2/drug-49/questran-light-oral/details A condition in which the main influencing factor is nateglinide, an N-acyl-D-phenylalanine resulting from the formal condensation of the amino group of D-phenylalanine with the carboxy group of trans-4-isopropylcyclohexanecarboxylic acid. An orally-administered, rapidly-absorbed, short-acting insulinotropic agent, it is used for the treatment of type 2 diabetes mellitus. slaulede 2020-04-30T14:19:39Z CHEBI:31897 N-[(trans-4-isopropylcyclohexyl)carbonyl]-D-phenylalanine experimental_condition_ontology XCO:0000684 nateglinide A condition in which the main influencing factor is nateglinide, an N-acyl-D-phenylalanine resulting from the formal condensation of the amino group of D-phenylalanine with the carboxy group of trans-4-isopropylcyclohexanecarboxylic acid. An orally-administered, rapidly-absorbed, short-acting insulinotropic agent, it is used for the treatment of type 2 diabetes mellitus. CHEBI:31897 A liquid composed of two immiscible substances, typically some form of fat and water. In parenteral nutrition, a fat emulsion may contain phospholipids, triglycerides and essential fatty acids. slaulede 2020-04-30T14:52:23Z lipid emulsion experimental_condition_ontology XCO:0000685 fat emulsion A liquid composed of two immiscible substances, typically some form of fat and water. In parenteral nutrition, a fat emulsion may contain phospholipids, triglycerides and essential fatty acids. https://www.cancer.gov/publications/dictionaries/cancer-drug/def/fat-emulsion A sterile, non&#8209;pyrogenic fat emulsion intended as a source of calories and essential fatty acids for use in a pharmacy admixture program. It is made up of 20% Soybean Oil, 1.2% Egg Yolk, Phospholipids, 2.25% Glycerin, and Water for Injection. In addition, sodium hydroxide has been added to adjust the pH so that the final product pH is 6 to 8.9. slaulede 2020-04-30T15:09:24Z PMID:12419950 Intralipid Intralipid 20% Intralipos emulsion 68890-65-3 experimental_condition_ontology XCO:0000686 Intralipid 20 A sterile, non&#8209;pyrogenic fat emulsion intended as a source of calories and essential fatty acids for use in a pharmacy admixture program. It is made up of 20% Soybean Oil, 1.2% Egg Yolk, Phospholipids, 2.25% Glycerin, and Water for Injection. In addition, sodium hydroxide has been added to adjust the pH so that the final product pH is 6 to 8.9. https://www.fresenius-kabi.com/en-ca/products/lipid-emulsions An experimental drug candidate for the treatment of HIV infection and in combination with Tropifexor for non-alcoholic steatohepatitis. It is an inhibitor of CCR2 and CCR5 receptors. slaulede 2020-05-01T16:51:23Z MESH:C506967 CVC TAK 652 TBR 652 TBR-652 TBR652 experimental_condition_ontology XCO:0000687 cenicriviroc An experimental drug candidate for the treatment of HIV infection and in combination with Tropifexor for non-alcoholic steatohepatitis. It is an inhibitor of CCR2 and CCR5 receptors. https://en.wikipedia.org/wiki/Cenicriviroc Myelin basic protein is a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon. Myelin basic protein may constitute as much as one-third of all protein in myelin. slaulede 2020-05-11T16:03:19Z RGD:736262 Golli-MBP MBP MBP S Mbps myelin A1 protein myelin basic protein S myelin membrane encephalitogenic protein experimental_condition_ontology XCO:0000688 myelin basic protein Myelin basic protein is a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon. Myelin basic protein may constitute as much as one-third of all protein in myelin. https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/myelin-basic-protein Vitamin C is a water-soluble vitamin that is naturally present in some foods, added to others, and available as a dietary supplement. Humans, unlike most animals, are unable to synthesize vitamin C endogenously, so it is an essential dietary component. slaulede 2020-05-11T17:25:22Z CHEBI:21241 MESH:D001205 L-ascorbic acid Sodium Ascorbate experimental_condition_ontology XCO:0000689 vitamin C Vitamin C is a water-soluble vitamin that is naturally present in some foods, added to others, and available as a dietary supplement. Humans, unlike most animals, are unable to synthesize vitamin C endogenously, so it is an essential dietary component. https://ods.od.nih.gov/factsheets/VitaminC-HealthProfessional/ A solid diet in which the amount of any vitamin is maintained at a specified level. Vitamins are organic substances that are required in small amounts for maintenance and growth, but which cannot be manufactured by the human body. slaulede 2020-05-11T17:39:15Z CHEBI:33229 MESH:D014815 experimental_condition_ontology XCO:0000690 controlled vitamin content diet A solid diet in which the amount of any vitamin is maintained at a specified level. Vitamins are organic substances that are required in small amounts for maintenance and growth, but which cannot be manufactured by the human body. MESH:D014815 A solid diet in which the amount of vitamin C is maintained at a specified level. Vitamin C is a water-soluble vitamin that is naturally present in some foods, added to others, and available as a dietary supplement. slaulede 2020-05-11T17:49:21Z controlled ascorbate content diet controlled ascorbic acid content diet experimental_condition_ontology XCO:0000691 controlled vitamin C content diet A solid diet in which the amount of vitamin C is maintained at a specified level. Vitamin C is a water-soluble vitamin that is naturally present in some foods, added to others, and available as a dietary supplement. https://ods.od.nih.gov/factsheets/VitaminC-HealthProfessional/ An ammonium salt that has formula C6H15N2O2. It is a slowly hydrolyzed cholinergic agonist that acts at both muscarinic receptors and nicotinic receptors. slaulede 2020-05-12T16:35:15Z CHEBI:3385 MESH:D002217 Isopto Carbachol Miostat carbamylcholine carbastat carboptic experimental_condition_ontology XCO:0000692 carbachol An agent that selectively binds to and activates cholinergic receptors. slaulede 2020-05-12T16:44:51Z CHEBI:38324 MESH:D018679 acetylcholine receptor agonist cholinomimetic experimental_condition_ontology XCO:0000693 cholinergic agonist An agent that selectively binds to and activates cholinergic receptors. CHEBI:38324 Any substance that combines with an enzyme to increase its catalytic activity. These molecules are often involved in the allosteric regulation of enzymes in the control of metabolism slaulede 2020-05-15T09:27:57Z experimental_condition_ontology XCO:0000694 enzyme activator Any substance that combines with an enzyme to increase its catalytic activity. These molecules are often involved in the allosteric regulation of enzymes in the control of metabolism Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed https://en.wikipedia.org/wiki/Enzyme_activator An effector that binds to and activates soluble guanylate cyclase (EC 4.6.1.2). It increases the activity of the enzyme only when the heme iron is oxidized (Fe3+) or the heme group is missing. slaulede 2020-05-15T09:38:35Z CHEBI:76022 sGC activator experimental_condition_ontology XCO:0000695 soluble guanylate cyclase activator An effector that binds to and activates soluble guanylate cyclase (EC 4.6.1.2). It increases the activity of the enzyme only when the heme iron is oxidized (Fe3+) or the heme group is missing. CHEBI:76022 https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/enzyme-activator An allosteric enzyme activator that increases guanylate cyclase activity only when the heme iron is in its reduced state (Fe2+). slaulede 2020-05-15T09:53:41Z CHEBI:76022 sGC stimulator experimental_condition_ontology XCO:0000696 soluble guanylate cyclase stimulator An allosteric enzyme activator that increases guanylate cyclase activity only when the heme iron is in its reduced state (Fe2+). CHEBI:76022 https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/enzyme-activator This is any condition in which the main influencing factor is GSK2181236A, a small molecule actvator of soluble guanylate cyclase. slaulede 2020-05-15T10:01:48Z PMID:22783192 1-(6-{2-[({3-methyl-4 -[(trifluoromethyl)oxy]-4-biphenylyl}methyl)oxy] phenyl}-2-pyridinyl)-5-(trifluoromethyl)-1H-pyrazole-4-carboxylic acid experimental_condition_ontology XCO:0000697 GSK2181236A This is any condition in which the main influencing factor is GSK2181236A, a small molecule actvator of soluble guanylate cyclase. PMID:22783192 This chemical belongs to a novel group of small molecule compounds which increase the enzymatic activity of soluble guanylate cyclase. slaulede 2020-05-15T10:36:38Z PMID:22783192 Nelociguat experimental_condition_ontology XCO:0000698 BAY60-4552 This chemical belongs to a novel group of small molecule compounds which increase the enzymatic activity of soluble guanylate cyclase. PMID:22783192 This is any condition in which the main influencing factor is a controlled GSK2181236A content diet, a regimen of solid food in which the amount of GSK2181236A consumed is controlled. slaulede 2020-05-15T11:12:27Z PMID:22783192 controlled 1-(6-{2-[({3-methyl-4 -[(trifluoromethyl)oxy]-4-biphenylyl}methyl)oxy] phenyl}-2-pyridinyl)-5-(trifluoromethyl)-1H-pyrazole-4-carboxylic acid content diet experimental_condition_ontology XCO:0000699 controlled GSK2181236A content diet This is any condition in which the main influencing factor is a controlled GSK2181236A content diet, a regimen of solid food in which the amount of GSK2181236A consumed is controlled. PMID:22783192 A regimen of solid food in which the amount of BAY60-4552 consumed is controlled. slaulede 2020-05-15T11:16:58Z PMID:22783192 controlled Nelociguat content diet experimental_condition_ontology XCO:0000700 controlled BAY60-4552 content diet A regimen of solid food in which the amount of BAY60-4552 consumed is controlled. PMID:22783192 An azole in which the five-membered heterocyclic aromatic skeleton contains a N atom and one S atom. slaulede 2020-05-21T14:51:33Z MESH:D013844 MESH:D013844 experimental_condition_ontology XCO:0000702 thiazoles An azole in which the five-membered heterocyclic aromatic skeleton contains a N atom and one S atom. CHEBI:48901 A constituent of fox urine and feces that may be an innately aversive odor to rodents. slaulede 2020-05-21T15:14:18Z MESH:C451263 2,4,5-Trimethyl-4,5-dihydro-1,3-thiazole TMT fox odor experimental_condition_ontology XCO:0000703 2,4,5 trimethylthiazoline A constituent of fox urine and feces that may be an innately aversive odor to rodents. https://en.wikipedia.org/wiki/Trimethylthiazoline A surgical manipulation causing blockage of one or both of the common carotid arteries, or of a branch (internal or external) of the common carotid arteries. slaulede 2020-05-21T15:46:29Z UCAO common carotid artery occlusion permanent carotid artery occlusion unilateral carotid artery occlusion experimental_condition_ontology XCO:0000704 carotid artery occlusion A surgical manipulation causing blockage of one or both of the common carotid arteries, or of a branch (internal or external) of the common carotid arteries. Mosby:Mosbys_Medical_Dictionary--8th_Ed Neutral organic radicals are subvalent molecules, i.e., they have unpaired electrons, and, as such, they are typically highly reactive, transient species with short lifetimes that tend to dimerize, disproportionate, or react with oxygen. slaulede 2020-05-22T12:37:56Z experimental_condition_ontology XCO:0000705 organic radical Neutral organic radicals are subvalent molecules, i.e., they have unpaired electrons, and, as such, they are typically highly reactive, transient species with short lifetimes that tend to dimerize, disproportionate, or react with oxygen. https://www.sciencedirect.com/topics/chemistry/organic-radical Physicochemically lithium phthalocyanine is very stable; its response to pO2 does not change with conditions and environments (e.g., pH, temperature, redox conditions) likely to occur in viable biological systems. It is an organic radical compound that forms metallic-organic, paramagnetic crystallites that appear very useful for in vitro and in vivo electron paramagnetic resonance oximetry. slaulede 2020-05-22T12:53:58Z LiPc experimental_condition_ontology XCO:0000706 lithium phthalocyanine Physicochemically lithium phthalocyanine is very stable; its response to pO2 does not change with conditions and environments (e.g., pH, temperature, redox conditions) likely to occur in viable biological systems. It is an organic radical compound that forms metallic-organic, paramagnetic crystallites that appear very useful for in vitro and in vivo electron paramagnetic resonance oximetry. PMID:8390665 Carvedilol is a beta-blocker that works by relaxing blood vessels and slowing heart rate to improve blood flow and decrease blood pressure. It is used to treat heart failure, high blood pressure, and heart attack patients. slaulede 2020-05-28T16:40:29Z CHEBI:3441 MESH:D000077261 1-(9H-carbazol-4-yloxy)-3-{[2-(2-methoxyphenoxy)ethyl]amino}propan-2-ol Coreg Coropres Dilatrend Eucardic Kredex Querto experimental_condition_ontology XCO:0000707 carvedilol Carvedilol is a beta-blocker that works by relaxing blood vessels and slowing heart rate to improve blood flow and decrease blood pressure. It is used to treat heart failure, high blood pressure, and heart attack patients. https://medlineplus.gov/druginfo/meds/a697042.html A regimen of solid food in which the amount of carvedilol consumed is controlled. slaulede 2020-05-28T16:52:10Z PMID:17551266 controlled Coreg content diet controlled Querto content diet experimental_condition_ontology XCO:0000708 controlled carvedilol content diet A regimen of solid food in which the amount of carvedilol consumed is controlled. PMID:17551266 A condition in which cells from one organism are used to cause cancer in another organism by injection of, or other means of transferring, live cells from the donor organism to the host organism. Cancer is a disease characterized by uncontrolled cellular proliferation, local cell invasion and metastasis. slaulede 2020-06-05T10:25:14Z tumor cells malignant neoplasm cells malignant tumor cells carcinoma cells primary cancer cells sarcoma cells experimental_condition_ontology XCO:0000709 cancer cells A condition in which cells from one organism are used to cause cancer in another organism by injection of, or other means of transferring, live cells from the donor organism to the host organism. Cancer is a disease characterized by uncontrolled cellular proliferation, local cell invasion and metastasis. DOID:162 A condition in which the main influencing factor is a rat colonic carcinoma cell line used to study biochemical correlates of metastasis. slaulede 2020-06-05T10:56:45Z ECACC:90062901 PMID:19850492 DHD K12/TRb cells DHD-K12 TRb cells DHD/K12 cells TRb cells experimental_condition_ontology XCO:0000710 DHD/K12/TRb cells A condition in which the main influencing factor is a rat colonic carcinoma cell line used to study biochemical correlates of metastasis. ECACC:90062901 An antimicrobial that is also being studied as a treatment for cancer. It is derived from the endogenous amino acid taurine. slaulede 2020-06-05T11:10:11Z CHEBI:135173 MESH:C012566 tauroflex taurolin tauroline experimental_condition_ontology XCO:0000711 taurolidine An antimicrobial that is also being studied as a treatment for cancer. It is derived from the endogenous amino acid taurine. https://en.wikipedia.org/wiki/Taurolidine Any drug which binds to vasopressin receptors and triggers a response. slaulede 2020-06-05T13:31:12Z CHEBI:59727 antidiuretic hormone agonist arginine vasopressin receptor agonist argipressin receptor agonist experimental_condition_ontology XCO:0000712 vasopressin receptor agonist Any drug which binds to vasopressin receptors and triggers a response. CHEBI:59727 A synthetic analogue of vasopressin in which 3-mercaptopropionic acid replaces the cysteine residue at position 1 and D-arginine replaces the residue at position 8. Its action is mediated by the vasopressin receptor V2. It has prolonged antidiuretic activity, but little pressor effects. slaulede 2020-06-05T13:42:43Z CHEBI:4450 MESH:D003894 1-Desamino-8-arginine Vasopressin Adiuretin Deamino Arginine Vasopressin Desmogalen dDAVP experimental_condition_ontology XCO:0000713 desmopressin A synthetic analogue of vasopressin in which 3-mercaptopropionic acid replaces the cysteine residue at position 1 and D-arginine replaces the residue at position 8. Its action is mediated by the vasopressin receptor V2. It has prolonged antidiuretic activity, but little pressor effects. CHEBI:4450 MESH:D003894 A member of the class of imidazoles carrying 4-hydroxycyclohexyl, 4-fluorophenyl and 2-methoxypyrimidin-4-yl substituents at positions 1, 4 and 5 respectively. It is a mitogen-activated protein kinase inhibitor. slaulede 2020-06-08T14:10:13Z CAS:193551-21-2 CHEBI:90681 CID:5166 MESH:C406525 Cyclohexanol, 4-(4-(4-fluorophenyl)-5-(2-methoxy-4-pyrimidinyl)-1H-imidazol-1-yl)-, trans- EC 2.7.11.24 inhibitor SB 239063 SB239063 trans-1-(4-hydroxycyclohexyl)-4-(4-fluorophenyl)-5-(2-methoxypyridimidin-4-yl)imidazole trans-4-[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]cyclohexan-1-ol experimental_condition_ontology XCO:0000714 SB-239063 A member of the class of imidazoles carrying 4-hydroxycyclohexyl, 4-fluorophenyl and 2-methoxypyrimidin-4-yl substituents at positions 1, 4 and 5 respectively. It is a mitogen-activated protein kinase inhibitor. CHEBI:90681 This is any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of a mitogen-activated protein kinase. slaulede 2020-06-08T14:19:35Z EC 2.7.11.24 inhibitor experimental_condition_ontology MAPK inhibitor XCO:0000715 mitogen-activated protein kinase inhibitor This is any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of a mitogen-activated protein kinase. Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed A regimen of solid food in which the amount of SB-239063 consumed is controlled. slaulede 2020-06-08T14:38:59Z controlled EC 2.7.11.24 inhibitor content diet PMID:14561850 experimental_condition_ontology XCO:0000716 controlled SB-239063 content diet MRI contrast agents are an indispensable part of magnetic resonance imaging. Contrast agents are used to improve the visibility of internal body structures in magnetic resonance imaging (MRI). slaulede 2020-06-08T14:55:27Z CHEBI:37335 experimental_condition_ontology XCO:0000717 MRI contrast agent MRI contrast agents are an indispensable part of magnetic resonance imaging. Contrast agents are used to improve the visibility of internal body structures in magnetic resonance imaging (MRI). https://en.wikipedia.org/wiki/MRI_contrast_agent https://radiopaedia.org/articles/mri-contrast-agents?lang=us This is any condition in which the main influencing factor is a Gadolinium-Based Contrast Agent (GBCA), an intravenous drug used in diagnostic imaging procedures to enhance the quality of magnetic resonance imaging (MRI) or magnetic resonance angiography (MRA). slaulede 2020-06-08T15:03:11Z GBCA experimental_condition_ontology XCO:0000718 gadolinium-based contrast agent This is any condition in which the main influencing factor is a Gadolinium-Based Contrast Agent (GBCA), an intravenous drug used in diagnostic imaging procedures to enhance the quality of magnetic resonance imaging (MRI) or magnetic resonance angiography (MRA). https://www.fda.gov/drugs/postmarket-drug-safety-information-patients-and-providers/information-gadolinium-based-contrast-agents A gadolinium coordination entity that has formula C28H54GdN5O20. slaulede 2020-06-08T15:14:36Z CHEBI:31797 Gd-DTPA Magnevist gadolinium (bis{2-[(carboxylatomethyl)(carboxymethyl)amino]ethyl}amino)acetate--1-deoxy-1-(methylamino)-D-glucitol (1:2) experimental_condition_ontology XCO:0000719 gadopentetate dimeglumine A gadolinium coordination entity that has formula C28H54GdN5O20. CHEBI:31797 A condition involving eye surgery using a laser to shrink or destroy abnormal structures in the retina, or to intentionally cause scarring. slaulede 2020-06-08T17:19:58Z laser coagulation laser eye surgery photocoagulation experimental_condition_ontology XCO:0000720 laser photocoagulation A condition involving eye surgery using a laser to shrink or destroy abnormal structures in the retina, or to intentionally cause scarring. https://medlineplus.gov/ency/article/007664.htm This is any condition whose main influencing factor is eprosartan, a member of the class of imidazoles and thiophenes that is an angiotensin II receptor antagonist used for the treatment of high blood pressure. slaulede 2020-06-11T17:41:02Z CHEBI:4814 Eprozar Teveten experimental_condition_ontology XCO:0000721 eprosartan This is any condition whose main influencing factor is eprosartan, a member of the class of imidazoles and thiophenes that is an angiotensin II receptor antagonist used for the treatment of high blood pressure. CHEBI:4814 This is any condition in which the main influencing factor is solid food deprivation, a condition in which solid food is withheld for a specified period of time, while nourishment through liquids is provided. slaulede 2020-06-12T17:33:11Z PMID:23955305 experimental_condition_ontology XCO:0000722 solid food deprivation This is any condition in which the main influencing factor is solid food deprivation, a condition in which solid food is withheld for a specified period of time, while nourishment through liquids is provided. PMID:23955305 https://www.merriam-webster.com/ A primary alcohol that is butane in which a hydrogen of one of the methyl groups is substituted by a hydroxy group. It it produced in small amounts in humans by the gut microbes. slaulede 2020-06-15T15:35:54Z CHEBI:28885 1-butanol 1-butyl alcohol butan-1-ol n-butanol experimental_condition_ontology XCO:0000723 butanol A primary alcohol that is butane in which a hydrogen of one of the methyl groups is substituted by a hydroxy group. It it produced in small amounts in humans by the gut microbes. CHEBI:28885 A primary alcohol that is butanol in which one or several of the carbon (C12) atoms is replaced by radioactive Carbon-14. slaulede 2020-06-15T16:30:42Z CHEBI:28885 https://arcinova.com/services/isotope-labelling C-14 butanol C14 butanol radiocarbon butanol experimental_condition_ontology XCO:0000724 Carbon-14 butanol A primary alcohol that is butanol in which one or several of the carbon (C12) atoms is replaced by radioactive Carbon-14. CHEBI:28885 https://arcinova.com/services/isotope-labelling Hesperetin is the aglycone of hesperidin - clathration by CD enhances hesperetin solubility. slaulede 2020-06-23T14:43:30Z PMID:19966469 experimental_condition_ontology XCO:0000725 cyclodextrin (CD)-clathrated hesperetin Hesperetin is the aglycone of hesperidin - clathration by CD enhances hesperetin solubility. PMID:19966469 A disaccharide derivative that consists of hesperetin substituted by a 6-O-(alpha-L-rhamnopyranosyl)-beta-D-glucopyranosyl moiety at position 7 via a glycosidic linkage. slaulede 2020-06-23T14:57:51Z CHEBI:28775 MESH:D006569 PMID:19966469 Hesperetin 7-O-Rutinoside Hesperidin 2S experimental_condition_ontology XCO:0000726 hesperidin A disaccharide derivative that consists of hesperetin substituted by a 6-O-(alpha-L-rhamnopyranosyl)-beta-D-glucopyranosyl moiety at position 7 via a glycosidic linkage. CHEBI:28775 Surgical removal of part or all of the spleen, the highly vascular lymphoid organ which serves to store blood, disintegrate old blood cells, filter foreign substances from the blood, and produce lymphocytes. slaulede 2020-06-25T12:48:31Z spleen removal experimental_condition_ontology XCO:0000727 splenectomy Surgical removal of part or all of the spleen, the highly vascular lymphoid organ which serves to store blood, disintegrate old blood cells, filter foreign substances from the blood, and produce lymphocytes. American_Heritage:The_American_Heritage_Medical_Dictionary_2007 Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed Surgical removal of a portion of the spleen, resulting in reduction but not elimination of the physiological functions of the spleen. slaulede 2020-06-25T12:58:14Z PS experimental_condition_ontology XCO:0000728 partial splenectomy Surgical removal of a portion of the spleen, resulting in reduction but not elimination of the physiological functions of the spleen. Gale:Gale_Encyclopedia_of_Medicine Enrasentan is an orally active mixed endothelin A/B receptor antagonist with a 100-fold greater affinity for the endothelin A receptor. slaulede 2020-07-27T15:38:14Z (1S,2R,3S)-3-(2-(2-HYDROXYETHOXY)-4-METHOXYPHENYL)-1-(3,4-(METHYLENEDIOXY)PHENYL)-5-PROPOXY-2-INDANCARBOXYLIC ACID SB-217242 experimental_condition_ontology XCO:0000729 enrasentan Enrasentan is an orally active mixed endothelin A/B receptor antagonist with a 100-fold greater affinity for the endothelin A receptor. https://drugs.ncats.io/drug/QG16H8A6ZH Any condition in which the main influencing factor is an agent that blocks one or more endothelin receptors. slaulede 2020-07-27T15:48:37Z CHEBI:51451 endothelin receptor blocker experimental_condition_ontology XCO:0000730 endothelin receptor antagonist Any condition in which the main influencing factor is an agent that blocks one or more endothelin receptors. XCO:0000536 A regimen of solid food in which the amount of enrasentan consumed is controlled. slaulede 2020-07-27T16:09:03Z RGD:36174026 controlled SB-217242 content diet experimental_condition_ontology XCO:0000731 controlled enrasentan content diet A regimen of solid food in which the amount of enrasentan consumed is controlled. RGD:36174026 A condition in which the main influencing factor is CC531, a rat colonic adenocarcinoma cell line used to study metastasis. slaulede 2020-08-18T16:56:25Z PMID:8225852 RRID:CVCL_0206 CC-531 experimental_condition_ontology XCO:0000732 CC531 cells This is any condition in which the main influencing factor is sanguinarine, a benzophenanthridine alkaloid derived from Sanguinaria canadensis and poppy Fumaria species, shown to exhibit anti-microbial, anti-tumoral, and anti-inflammatory activities. slaulede 2020-09-04T16:56:22Z CHEBI:17183 MESH:C005705 13-methyl-2H,10H-[1,3]dioxolo[4,5-i][1,3]dioxolo[4',5':4,5]benzo[1,2-c]phenanthridinium pseudochelerythrine experimental_condition_ontology XCO:0000733 sanguinarine This is any condition in which the main influencing factor is sanguinarine, a benzophenanthridine alkaloid derived from Sanguinaria canadensis and poppy Fumaria species, shown to exhibit anti-microbial, anti-tumoral, and anti-inflammatory activities. CHEBI:17183 PMID:21849887 https://www.sciencedirect.com/topics/agricultural-and-biological-sciences/sanguinarine A potent chemokine-like receptor 1 (CMKLR1) agonist that corresponds to C-terminal of full length human Chemerin (RARRES2), amino acids 149 - 157. Activates Gi/o signaling pathways in vitro; inhibits cAMP production and promotes phospholipase C production, Ca2+ mobilization, and smooth muscle contraction. slaulede 2020-09-04T17:26:44Z PMID:29906243 (149)YFPGQFAFS(157) YFPGQFAFS experimental_condition_ontology XCO:0000734 chemerin-9 A potent chemokine-like receptor 1 (CMKLR1) agonist that corresponds to C-terminal of full length human Chemerin (RARRES2), amino acids 149 - 157. Activates Gi/o signaling pathways in vitro; inhibits cAMP production and promotes phospholipase C production, Ca2+ mobilization, and smooth muscle contraction. PMID:29906243 RGD:1320450 https://www.rndsystems.com/products/chemerin-9-human_7116 A tetracyclic diterpenoid which is a mitotic inhibitor used in cancer chemotherapy. slaulede 2020-09-08T14:14:00Z CHEBI:45863 MESH:D017239 Taxol experimental_condition_ontology XCO:0000735 paclitaxel A tetracyclic diterpenoid which is a mitotic inhibitor used in cancer chemotherapy. CHEBI:45863 An ADP-ribosylating polypeptide produced by CORYNEBACTERIUM DIPHTHERIAE that can cause a localized infection of mucous membranes or skin (diphtheria), myocarditis, polyneuritis, and other systemic toxic effects. slaulede 2020-09-08T17:35:42Z DOID:11405 MESH:D004165 DT experimental_condition_ontology XCO:0000736 diphtheria toxin An ADP-ribosylating polypeptide produced by CORYNEBACTERIUM DIPHTHERIAE that can cause a localized infection of mucous membranes or skin (diphtheria), myocarditis, polyneuritis, and other systemic toxic effects. DOID:11405 MESH:D004165 A component of bacterial cells, an endotoxin can be a part of the outer membrane of gram-negative bacteria (lipopolysacharride) or a part or the "spore" of gram-positive bacteria (delta endotoxin). slaulede 2020-09-14T17:54:49Z experimental_condition_ontology XCO:0000737 endotoxin A component of bacterial cells, an endotoxin can be a part of the outer membrane of gram-negative bacteria (lipopolysacharride) or a part or the "spore" of gram-positive bacteria (delta endotoxin). PMID:11468393 https://www.horseshoecrab.org/med/endotoxin.html This is any condition in which the main influencing factor is lipopolysaccharide, the most common type of endotoxin, found in the outer membrane of gram-negative bacteria. Lipopolysaccharide consists of the lipid A portion containing fatty acids and disaccharide phosphates, core polysaccharides, and the O-antigen (repetitive glycan polymer). slaulede 2020-09-14T18:06:38Z endotoxin CHEBI:16412 MESH:D008070 LPS experimental_condition_ontology XCO:0000738 lipopolysaccharide This is any condition in which the main influencing factor is lipopolysaccharide, the most common type of endotoxin, found in the outer membrane of gram-negative bacteria. Lipopolysaccharide consists of the lipid A portion containing fatty acids and disaccharide phosphates, core polysaccharides, and the O-antigen (repetitive glycan polymer). PMID:8119492 https://www.horseshoecrab.org/med/endotoxin.html This is any condition in which the main influencing factor is housing in trios, a sutuation where subjects are housed in groups of three during a specified time period(s). slaulede 2020-09-15T14:52:57Z experimental_condition_ontology XCO:0000739 housing in trios This is any condition in which the main influencing factor is housing in trios, a sutuation where subjects are housed in groups of three during a specified time period(s). PMID:16197708 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is housing with pathogen-infected subject(s), a situation in which at least one subject in the housing had a pathogenic infection during the time period leading up to the specified housing period. slaulede 2020-09-15T15:27:06Z experimental_condition_ontology XCO:0000740 housing with pathogen-infected subject This is any condition in which the main influencing factor is housing with pathogen-infected subject(s), a situation in which at least one subject in the housing had a pathogenic infection during the time period leading up to the specified housing period. PMID:16197708 https://www.merriam-webster.com/ A condition in which subjects are maintained in housing groups in which at least one subject had a bacterial pathogenic infection during the time period leading up to the specified housing period. slaulede 2020-09-15T15:31:42Z experimental_condition_ontology XCO:0000741 housing with bacterial pathogen-infected subject A condition in which subjects are maintained in housing groups in which at least one subject had a bacterial pathogenic infection during the time period leading up to the specified housing period. PMID:16197708 https://www.merriam-webster.com/ A condition in which subjects are maintained in housing groups in which at least one subject had a Haemophilus infection during the time period leading up to the specified housing period. Haemophilus is a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic. slaulede 2020-09-15T15:38:24Z experimental_condition_ontology XCO:0000742 housing with Haemophilus-infected subject A condition in which subjects are maintained in housing groups in which at least one subject had a Haemophilus infection during the time period leading up to the specified housing period. Haemophilus is a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic. PMID:16197708 https://www.merriam-webster.com/ A condition in which the primary influencing factor is a species of Haemophilus, a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic. slaulede 2020-09-15T15:47:23Z experimental_condition_ontology XCO:0000743 Haemophilus A condition in which the primary influencing factor is a species of Haemophilus, a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic. PMID:16197708 https://en.wikipedia.org/wiki/Haemophilus https://www.merriam-webster.com/ A condition in which subjects are maintained in housing groups in which at least one subject had a Haemophilus H21 infection during the time period leading up to the specified housing period. Haemophilus H21 is a strain of Haemophilus, a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic. slaulede 2020-09-15T16:42:53Z experimental_condition_ontology XCO:0000744 housing with Haemophilus H21-infected subject A condition in which subjects are maintained in housing groups in which at least one subject had a Haemophilus H21 infection during the time period leading up to the specified housing period. Haemophilus H21 is a strain of Haemophilus, a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic. PMID:16197708 https://www.merriam-webster.com/ A condition in which subjects are maintained in housing groups in which at least one subject had a Haemophilus H35 infection during the time period leading up to the specified housing period. Haemophilus H35 is a strain of Haemophilus, a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic. slaulede 2020-09-15T16:46:22Z experimental_condition_ontology XCO:0000745 housing with Haemophilus H35-infected subject A condition in which subjects are maintained in housing groups in which at least one subject had a Haemophilus H35 infection during the time period leading up to the specified housing period. Haemophilus H35 is a strain of Haemophilus, a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic. PMID:16197708 https://www.merriam-webster.com/ A condition in which subjects are maintained in housing groups in which at least one subject had a Pasteurella pneumotropica infection during the time period leading up to the specified housing period. Pasteurella pneumotropica is a strain of Pasteurella, a genus Gram-negative, coccobacilli bacteria, some of which are pathogenic. slaulede 2020-09-15T17:00:42Z experimental_condition_ontology XCO:0000746 housing with Pasteurella pneumotropica-infected subject A condition in which subjects are maintained in housing groups in which at least one subject had a Pasteurella pneumotropica infection during the time period leading up to the specified housing period. Pasteurella pneumotropica is a strain of Pasteurella, a genus Gram-negative, coccobacilli bacteria, some of which are pathogenic. PMID:16197708 https://www.uptodate.com/contents/pasteurella-infections A condition in which subjects are maintained in housing groups in which at least one subject had a Pasteurellaceae infection during the time period leading up to the specified housing period. Pasteurellaceae is a large family of Gram-negative bacteria including the genera Pasteurella and Haemophilus, some of which are pathogenic. slaulede 2020-09-15T17:15:32Z experimental_condition_ontology XCO:0000747 housing with Pasteurellaceae-infected subject A condition in which subjects are maintained in housing groups in which at least one subject had a Pasteurellaceae infection during the time period leading up to the specified housing period. Pasteurellaceae is a large family of Gram-negative bacteria including the genera Pasteurella and Haemophilus, some of which are pathogenic. PMID:16197708 https://en.wikipedia.org/wiki/Pasteurellaceae Any condition in which the main influencing factor is a substance which decreases or interferes with the activity of a protease, any of numerous enzymes that hydrolyze proteins. slaulede 2020-09-22T15:03:07Z proteinase inhibitor experimental_condition_ontology peptidase inhibitor XCO:0000748 protease inhibitor Any condition in which the main influencing factor is a substance which decreases or interferes with the activity of a protease, any of numerous enzymes that hydrolyze proteins. ISBN-13:978-0877798071 ISBN-13:978-1416062578 Any condition in which the main influencing factor is phosphoramidon, a potent inhibitor of thermolysin and other metallo-endopeptidases, isolated from the cultures of Streptomyces tanashiensis. slaulede 2020-09-22T15:31:08Z CHEBI:45353 MESH:C008890 experimental_condition_ontology XCO:0000749 phosphoramidon Any condition in which the main influencing factor is phosphoramidon, a potent inhibitor of thermolysin and other metallo-endopeptidases, isolated from the cultures of Streptomyces tanashiensis. CHEBI:45353 https://www.sigmaaldrich.com/catalog/product/sigma/r7385?lang=en&region=US This is any condition in which the main influencing factor is diclofenac, a monocarboxylic acid consisting of phenylacetic acid having a (2,6-dichlorophenyl)amino group at the 2-position. It is a non-steroidal anti-inflammatory agent (NSAID) with antipyretic and analgesic actions. It is primarily available as the sodium salt. slaulede 2020-09-25T10:32:53Z CHEBI:47381 CID:3033 MESH:D004008 PMID:32119089 Diclofenac acid Voltaren experimental_condition_ontology XCO:0000750 diclofenac This is any condition in which the main influencing factor is diclofenac, a monocarboxylic acid consisting of phenylacetic acid having a (2,6-dichlorophenyl)amino group at the 2-position. It is a non-steroidal anti-inflammatory agent (NSAID) with antipyretic and analgesic actions. It is primarily available as the sodium salt. CHEBI:47381 MESH:D004008 A surgical manipulation causing blockage of one of the common carotid arteries, or of a branch (internal or external) of the common carotid arteries. slaulede 2020-09-25T13:30:19Z PMID:29486300 UCAO experimental_condition_ontology XCO:0000751 unilateral carotid artery occlusion A surgical manipulation causing blockage of one of the common carotid arteries, or of a branch (internal or external) of the common carotid arteries. ISBN-13:978-0323049375 PMID:29486300 A surgical manipulation causing blockage of the right common carotid artery, or a branch (internal or external) of the right common carotid artery. slaulede 2020-09-25T13:54:07Z experimental_condition_ontology XCO:0000752 right carotid artery occlusion A surgical manipulation causing blockage of the right common carotid artery, or a branch (internal or external) of the right common carotid artery. ISBN-13:978-0323049375 PMID:29486300 This is any condition in which the main influencing factor is surgical manipulation and left common carotid artery ligation to achieve partial or total blockage of blood flow from the left common carotid artery, or a branch (internal or external) of the left common carotid artery. The left common carotid artery may be clamped or tied with a suture(s) to achieve blockage of blood flow. slaulede 2020-09-25T14:00:57Z left common carotid artery occlusion left carotid artery constriction left carotid artery ligation left common carotid artery constriction experimental_condition_ontology XCO:0000753 left carotid artery occlusion This is any condition in which the main influencing factor is surgical manipulation and left common carotid artery ligation to achieve partial or total blockage of blood flow from the left common carotid artery, or a branch (internal or external) of the left common carotid artery. The left common carotid artery may be clamped or tied with a suture(s) to achieve blockage of blood flow. ISBN-13:978-0323049375 PMID:31482584 A surgical manipulation causing blockage of both of the common carotid arteries, or left and right branches (internal or external) of the common carotid arteries. slaulede 2020-09-25T14:09:32Z BCCAo bilateral common carotid artery occlusion experimental_condition_ontology XCO:0000754 bilateral carotid artery occlusion A surgical manipulation causing blockage of both of the common carotid arteries, or left and right branches (internal or external) of the common carotid arteries. ISBN-13:978-0323049375 PMID:32937001 This is any condition in which the main influencing factor is dimethyl sulfoxide, a 2-carbon sulfoxide and highly polar organic liquid, that is used widely as a chemical solvent. Because of its ability to penetrate biological membranes, it is used as a vehicle for topical application of pharmaceuticals. Dimethyl sulfoxide shows a range of pharmacological activity including analgesia and anti-inflammation. slaulede 2020-09-25T14:25:59Z CHEBI:28262 MESH:D004121 DMSO experimental_condition_ontology XCO:0000755 dimethyl sulfoxide This is any condition in which the main influencing factor is dimethyl sulfoxide, a 2-carbon sulfoxide and highly polar organic liquid, that is used widely as a chemical solvent. Because of its ability to penetrate biological membranes, it is used as a vehicle for topical application of pharmaceuticals. Dimethyl sulfoxide shows a range of pharmacological activity including analgesia and anti-inflammation. CHEBI:28262 MESH:D004121 This is any condition in which the main influencing factor is Kolliphor HS 15, a non-ionic surfactant and emulsifier that is a potential therapeutic agent because of its effectiveness for reversing multidrug resistance in vitro and its low toxicity in vivo. slaulede 2020-09-25T14:43:25Z CHEBI:9194 Macrogol (15)-hydroxystearate Polyethylene glycol (15)-hydroxystearate Polyoxyethylated 12-hydroxystearic acid Solutol Solutol HS 15 experimental_condition_ontology XCO:0000756 Kolliphor HS 15 This is any condition in which the main influencing factor is Kolliphor HS 15, a non-ionic surfactant and emulsifier that is a potential therapeutic agent because of its effectiveness for reversing multidrug resistance in vitro and its low toxicity in vivo. PMID:1988130 https://www.sigmaaldrich.com/catalog/papers/1988130 A substance which lowers the surface tension of the medium in which it is dissolved, and/or the interfacial tension with other phases, and, accordingly, is positively adsorbed at the liquid/vapor and/or at other interfaces. slaulede 2020-09-25T15:01:23Z experimental_condition_ontology XCO:0000757 surfactant A substance which lowers the surface tension of the medium in which it is dissolved, and/or the interfacial tension with other phases, and, accordingly, is positively adsorbed at the liquid/vapor and/or at other interfaces. CHEBI:35195 https://www.merriam-webster.com/dictionary/surfactant Condition in which the main influencing factor is retinoic acid, a retinoid consisting of 3,7-dimethylnona-2,4,6,8-tetraenoic acid substituted at position 9 by a 2,6,6-trimethylcyclohex-1-en-1-yl group (geometry of the four exocyclic double bonds is not specified). Retinoic acid is derived from retinol (vitamin A) and plays important roles in cell growth, differentiation, and organogenesis. slaulede 2020-10-05T16:57:15Z CHEBI:26536 PMID:22439772 experimental_condition_ontology XCO:0000758 retinoic acid Condition in which the main influencing factor is retinoic acid, a retinoid consisting of 3,7-dimethylnona-2,4,6,8-tetraenoic acid substituted at position 9 by a 2,6,6-trimethylcyclohex-1-en-1-yl group (geometry of the four exocyclic double bonds is not specified). Retinoic acid is derived from retinol (vitamin A) and plays important roles in cell growth, differentiation, and organogenesis. CHEBI:26536 PMID:22439772 A condition in which the major influencing factor is a soluble Schistosoma mansoni protein expressed by the schistosomulum and target of cytotoxic IgE antibodies. slaulede 2020-10-13T18:01:28Z experimental_condition_ontology XCO:0000760 26 kDa Schistosoma mansoni antigen A condition in which the major influencing factor is a soluble Schistosoma mansoni protein expressed by the schistosomulum and target of cytotoxic IgE antibodies. PMID:1719096 PMID:6698106 This is any condition in which the main influencing factor is a biologic (product of, or component of, a living organism) or probiotic introduced externally or internally to a subject to effect a change in phenotype of the subject, usually in treatment of a medical condition. Probiotics are live microorganisms that are intended to have health benefits when consumed or applied to the body. slaulede 2020-10-15T17:39:53Z biological medical product biopharmaceutical experimental_condition_ontology XCO:0000761 biologics and probiotics This is any condition in which the main influencing factor is a biologic (product of, or component of, a living organism) or probiotic introduced externally or internally to a subject to effect a change in phenotype of the subject, usually in treatment of a medical condition. Probiotics are live microorganisms that are intended to have health benefits when consumed or applied to the body. https://www.fda.gov/about-fda/center-biologics-evaluation-and-research-cber/what-are-biologics-questions-and-answers https://www.merriam-webster.com/ https://www.nccih.nih.gov/health/probiotics-what-you-need-to-know Any condition in which the main influencing factor is an injection of T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against anti-26 kDa (antigen secreted from schistosomula of Schistosoma mansoni) IgE antibodies. slaulede 2020-10-15T17:53:02Z PMID:1719096 PMID:2494262 experimental_condition_ontology XCO:0000762 rat anti-Ab2 T cells Any condition in which the main influencing factor is an injection of T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against anti-26 kDa (antigen secreted from schistosomula of Schistosoma mansoni) IgE antibodies. PMID:1719096 PMID:2494262 This is any condition in which the main influencing factor is an injection of T cells (T lymphocytes). T cells are integral to the functioning of the immune system and are at the core of adaptive immunity, the system that tailors the body's immune response to specific pathogens slaulede 2020-10-15T18:06:48Z experimental_condition_ontology XCO:0000763 T cells This is any condition in which the main influencing factor is an injection of T cells (T lymphocytes). T cells are integral to the functioning of the immune system and are at the core of adaptive immunity, the system that tailors the body's immune response to specific pathogens CL:0000084 https://www.medicinenet.com/script/main/art.asp?articlekey=11300 Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against anti-26 kDa (antigen secreted from schistosomula of Schistosoma mansoni) IgE antibodies. slaulede 2020-10-16T15:00:38Z PMID:1719096 PMID:2494262 experimental_condition_ontology XCO:0000764 rat anti-Ab2 T cell line Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against anti-26 kDa (antigen secreted from schistosomula of Schistosoma mansoni) IgE antibodies. PMID:1719096 PMID:2494262 https://www.merriam-webster.com/ Any condition in which the main influencing factor is an injection of T cells prepared from the lymph nodes of rats immunized with the 26 kDa antigen secreted from schistosomula of Schistosoma mansoni . slaulede 2020-10-16T16:53:18Z experimental_condition_ontology XCO:0000765 rat anti-26 kDa T cells Any condition in which the main influencing factor is an injection of T cells prepared from the lymph nodes of rats immunized with the 26 kDa antigen secreted from schistosomula of Schistosoma mansoni . PMID:1719096 https://www.merriam-webster.com/ Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with the 26 kDa antigen secreted from schistosomula of Schistosoma mansoni. slaulede 2020-10-16T16:59:07Z experimental_condition_ontology XCO:0000766 rat anti-26 kDa T cell line Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with the 26 kDa antigen secreted from schistosomula of Schistosoma mansoni. PMID:1719096 https://www.merriam-webster.com/ A condition in which the main influencing factor is Schistosoma mansoni, a trematode parasite that lives in certain types of freshwater snails. The infectious form of the parasite, known as cercariae, emerge from the snail into the water. Humans can become infected when skin comes in contact with contaminated freshwater. slaulede 2020-10-16T17:29:53Z experimental_condition_ontology XCO:0000767 Schistosoma mansoni A condition in which the main influencing factor is Schistosoma mansoni, a trematode parasite that lives in certain types of freshwater snails. The infectious form of the parasite, known as cercariae, emerge from the snail into the water. Humans can become infected when skin comes in contact with contaminated freshwater. PMID:1719096 https://www.cdc.gov/parasites/schistosomiasis/index.html A condition in which the main influencing factor is the infective cercariae (larvae) of the trematode parasite Schistosoma mansoni. slaulede 2020-10-16T17:50:16Z experimental_condition_ontology XCO:0000768 Schistosoma mansoni cercariae A condition in which the main influencing factor is the infective cercariae (larvae) of the trematode parasite Schistosoma mansoni. PMID:1719096 https://www.britannica.com/science/cercaria Blood serum that contains antibodies against an infective agent (such as a bacteria or virus) or toxic substance (such as snake venom) and may be used to prevent or treat infection or poisoning. slaulede 2020-10-19T13:58:56Z experimental_condition_ontology XCO:0000769 antiserum Blood serum that contains antibodies against an infective agent (such as a bacteria or virus) or toxic substance (such as snake venom) and may be used to prevent or treat infection or poisoning. https://www.biologyonline.com/dictionary/antiserum https://www.merriam-webster.com/ Any condition in which the main influencing factor is serum prepared from rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against anti-26 kDa (antigen secreted from schistosomula of Schistosoma mansoni) IgE antibodies. slaulede 2020-10-19T14:05:35Z PMID:1719096 experimental_condition_ontology XCO:0000770 rat anti-Ab2 antiserum Any condition in which the main influencing factor is serum prepared from rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against anti-26 kDa (antigen secreted from schistosomula of Schistosoma mansoni) IgE antibodies. PMID:1719096 https://www.merriam-webster.com/ Any condition in which the main influencing factor is serum prepared from rats immunized with the 26 kDa antigen secreted from schistosomula of Schistosoma mansoni. slaulede 2020-10-19T14:09:02Z PMID:1719096 experimental_condition_ontology XCO:0000771 rat anti-26 kDa antiserum Any condition in which the main influencing factor is serum prepared from rats immunized with the 26 kDa antigen secreted from schistosomula of Schistosoma mansoni. PMID:1719096 https://www.merriam-webster.com/ A solid diet in which the amount of cocoa butter is maintained at a specified level. Cocoa butter is a pale vegetable fat with a low melting point obtained from cacao beans. slaulede 2020-10-19T15:39:19Z experimental_condition_ontology XCO:0000772 controlled cocoa butter content diet A solid diet in which the amount of cocoa butter is maintained at a specified level. Cocoa butter is a pale vegetable fat with a low melting point obtained from cacao beans. https://www.healthline.com/health/beauty-skin-care/cocoa-butter-benefits https://www.merriam-webster.com/ A solid diet in which the amount of soybean oil is maintained at a specified level. Soybean oil is a pale yellow drying or semidrying oil that is obtained from soybeans and is used chiefly as a food, in paints, varnishes, linoleum, printing ink, and soap, and as a source of phospholipids, fatty acids, and sterols. slaulede 2020-10-19T17:46:26Z experimental_condition_ontology XCO:0000773 controlled soybean oil content diet A solid diet in which the amount of soybean oil is maintained at a specified level. Soybean oil is a pale yellow drying or semidrying oil that is obtained from soybeans and is used chiefly as a food, in paints, varnishes, linoleum, printing ink, and soap, and as a source of phospholipids, fatty acids, and sterols. https://www.merriam-webster.com/ https://www.webmd.com/vitamins/ai/ingredientmono-196/soybean-oil Any condition in which the main influencing factor is any of numerous unctuous combustible substances that are liquid or can be liquefied easily on warming, are soluble in ether but not in water, and leave a greasy stain on paper or cloth. slaulede 2020-10-19T18:03:59Z experimental_condition_ontology XCO:0000774 oil Any condition in which the main influencing factor is any of numerous unctuous combustible substances that are liquid or can be liquefied easily on warming, are soluble in ether but not in water, and leave a greasy stain on paper or cloth. ISBN:978-1-4684-6878-6 https://www.britannica.com/science/oil-chemical-compound https://www.merriam-webster.com/ Any condition in which the main influencing factor is soybean oil. Soybean oil is a pale yellow drying or semidrying oil that is obtained from soybeans and is used chiefly as a food, in paints, varnishes, linoleum, printing ink, and soap, and as a source of phospholipids, fatty acids, and sterols. slaulede 2020-10-19T18:21:13Z experimental_condition_ontology XCO:0000775 soybean oil Any condition in which the main influencing factor is soybean oil. Soybean oil is a pale yellow drying or semidrying oil that is obtained from soybeans and is used chiefly as a food, in paints, varnishes, linoleum, printing ink, and soap, and as a source of phospholipids, fatty acids, and sterols. https://www.merriam-webster.com/ https://www.webmd.com/vitamins/ai/ingredientmono-196/soybean-oil This is any condition in which the main influencing factor is an aliphatic monocarboxylic acid derived from or contained in esterified form in an animal or vegetable fat, oil or wax. slaulede 2020-10-19T18:27:54Z CHEBI:35366 experimental_condition_ontology XCO:0000776 fatty acid This is any condition in which the main influencing factor is an aliphatic monocarboxylic acid derived from or contained in esterified form in an animal or vegetable fat, oil or wax. CHEBI:35366 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is alpha-lipoic acid, a heterocyclic thia fatty acid comprising pentanoic acid with a 1,2-dithiolan-3-yl group at the 5-position. slaulede 2020-10-19T18:33:37Z CHEBI:16494 MESH:D008063 PMID:30208622 &#945;-lipoic acid LA Thioctic Acid alpha-lipoic acid experimental_condition_ontology XCO:0000777 lipoic acid This is any condition in which the main influencing factor is alpha-lipoic acid, a heterocyclic thia fatty acid comprising pentanoic acid with a 1,2-dithiolan-3-yl group at the 5-position. CHEBI:16494 MESH:D008063 A condition in which the main influencing factor is spiroplatin, a metal drug and analog of the second generation for cisplatin, developed for the treatment of cancer. Spiroplatin induces DNA cross-linking, thereby inhibiting DNA replication and the synthesis of RNA and protein. Initial clinical trials of spiroplatin showed that it could cause less nausea and vomiting than cisplatin, but development was discontinued due to weak anti-tumor effects and toxicity at high dosages. slaulede 2020-10-20T14:53:27Z MESH:C040757 NSC-311056 TNO-6 aqua(1,1-bis(aminomethyl)cyclohexane)sulfatoplatinum (II) experimental_condition_ontology XCO:0000778 spiroplatin A condition in which the main influencing factor is spiroplatin, a metal drug and analog of the second generation for cisplatin, developed for the treatment of cancer. Spiroplatin induces DNA cross-linking, thereby inhibiting DNA replication and the synthesis of RNA and protein. Initial clinical trials of spiroplatin showed that it could cause less nausea and vomiting than cisplatin, but development was discontinued due to weak anti-tumor effects and toxicity at high dosages. MESH:C040757 https://drugs.ncats.io/drug/H2V318W7LE A condition in which the main influencing factor is rat IgM-secreting immunocytoma cells. The transplantable tumor cells are used in various studies including antibody secretion studies and antitumoral drug studies. slaulede 2020-10-22T13:12:29Z PMID:6683993 rat IgM lymphoplasmacytic lymphoma cells experimental_condition_ontology XCO:0000779 rat IgM immunocytoma cells A condition in which the main influencing factor is rat IgM-secreting immunocytoma cells. The transplantable tumor cells are used in various studies including antibody secretion studies and antitumoral drug studies. DOID:0050747 PMID:6683993 This is any condition in which the main influencing factor is liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and used to deliver biologically relevant substances. slaulede 2020-10-27T16:40:20Z PMID:6744286 experimental_condition_ontology XCO:0000780 liposomes This is any condition in which the main influencing factor is liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and used to deliver biologically relevant substances. https://www.merriam-webster.com/ https://www.sciencedirect.com/topics/pharmacology-toxicology-and-pharmaceutical-science/liposome An experimental condition in which the main influencing factor is positively charged liposomes, artificial positively charged vesicles composed of one or more concentric phospholipid bilayers and used to deliver biologically relevant substances. slaulede 2020-10-27T16:48:40Z PMID:6744286 lip+ experimental_condition_ontology XCO:0000781 positively charged liposomes An experimental condition in which the main influencing factor is positively charged liposomes, artificial positively charged vesicles composed of one or more concentric phospholipid bilayers and used to deliver biologically relevant substances. PMID:6744286 https://www.merriam-webster.com/ https://www.sciencedirect.com/topics/pharmacology-toxicology-and-pharmaceutical-science/liposome An experimental condition in which the main influencing factor is negatively charged liposomes, artificial negatively charged vesicles composed of one or more concentric phospholipid bilayers and used to deliver biologically relevant substances. slaulede 2020-10-27T16:52:12Z PMID:6744286 lip- experimental_condition_ontology XCO:0000782 negatively charged liposomes An experimental condition in which the main influencing factor is negatively charged liposomes, artificial negatively charged vesicles composed of one or more concentric phospholipid bilayers and used to deliver biologically relevant substances. PMID:6744286 https://www.merriam-webster.com/ https:www.sciencedirect.com/topics/pharmacology-toxicology-and-pharmaceutical-science/liposome This is any condition in which the main influencing factor is a cytokine, a small secreted protein that has a specific effect on the interactions and communications between cells. Cytokine is a general name for other signaling molecules, including lymphokines, monokines, and chemokines. slaulede 2020-10-30T13:38:35Z chemokine lymphokine monokine experimental_condition_ontology XCO:0000783 cytokine This is any condition in which the main influencing factor is a cytokine, a small secreted protein that has a specific effect on the interactions and communications between cells. Cytokine is a general name for other signaling molecules, including lymphokines, monokines, and chemokines. ISBN-13:978-1608316922 PMID:17426506 This is any condition in which the main influencing factor is interleukin-2, a cytokine made by a type of T lymphocyte. It increases the growth and activity of other T lymphocytes and B lymphocytes, and affects the development of the immune system. slaulede 2020-10-30T13:52:50Z MESH:D007376 IL-2 IL2 interleukin 2 experimental_condition_ontology XCO:0000784 interleukin-2 This is any condition in which the main influencing factor is interleukin-2, a cytokine made by a type of T lymphocyte. It increases the growth and activity of other T lymphocytes and B lymphocytes, and affects the development of the immune system. ISBN-13:978-1608316922 https://www.cancer.gov/publications/dictionaries/cancer-terms/def/interleukin-2 A condition in which the main influencing factor is a rat cell line derived from a colonic adenocarcinoma induced by 1,2- dimethylhydrazine in BDIX rats. slaulede 2020-10-30T14:41:50Z PMID:6358055 PMID:9833767 experimental_condition_ontology XCO:0000785 PROb cells A condition in which the main influencing factor is a rat cell line derived from a colonic adenocarcinoma induced by 1,2- dimethylhydrazine in BDIX rats. PMID:6358055 PMID:9833767 A rat cell line (PROb 5-FU-resistant subline) derived from colonic adenocarcinoma PROb cells. The R1 cell line was established from PROb cells by in vivo and in vitro adaptation to 5-fluorouracil (5-FU), an anticancer drug. slaulede 2020-10-30T14:51:26Z PMID:9399677 PMID:9833767 experimental_condition_ontology XCO:0000786 PRObR1 cells A rat cell line (PROb 5-FU-resistant subline) derived from colonic adenocarcinoma PROb cells. The R1 cell line was established from PROb cells by in vivo and in vitro adaptation to 5-fluorouracil (5-FU), an anticancer drug. PMID:9399677 PMID:9833767 Any condition in which the main influencing factor is sodium butyrate, an organic sodium salt resulting from the replacement of the proton from the carboxy group of butyric acid (a short-chain fatty acid) by a sodium ion. slaulede 2020-10-30T14:59:55Z CHEBI:64103 MESH:D002087 sodium butanoate experimental_condition_ontology XCO:0000787 sodium butyrate Any condition in which the main influencing factor is sodium butyrate, an organic sodium salt resulting from the replacement of the proton from the carboxy group of butyric acid (a short-chain fatty acid) by a sodium ion. CHEBI:64103 MESH:D002087 A condition in which the main influencing factor is a rat rhabdomyosarcoma cell line used to study metastasis. slaulede 2020-11-12T16:13:47Z PMID:18028954 experimental_condition_ontology XCO:0000788 S4MH cells A condition in which the main influencing factor is a rat rhabdomyosarcoma cell line used to study metastasis. ISBN-13:978-0781733908 PMID:18028954 This is any condition in which the main influencing factor is methylcellulose, a methylester of cellulose used as an emulsifying and suspending agent in cosmetics, pharmaceuticals and the chemical industry. It is used therapeutically as a bulk laxative. slaulede 2020-11-16T14:59:35Z Citrucel MC methyl cellulose experimental_condition_ontology XCO:0000789 methylcellulose This is any condition in which the main influencing factor is methylcellulose, a methylester of cellulose used as an emulsifying and suspending agent in cosmetics, pharmaceuticals and the chemical industry. It is used therapeutically as a bulk laxative. CHEBI:53448 MESH:D008747 A drink made up of water and a specified amount of sodium chloride dissolved in a sufficient quantity of water. slaulede 2020-11-19T14:53:13Z controlled NaCl content drinking water experimental_condition_ontology XCO:0000790 controlled sodium chloride content drinking water A drink made up of water and a specified amount of sodium chloride dissolved in a sufficient quantity of water. https://www.merriam-webster.com/ A condition defined by a mostly uniform set of parameters accepted as normal or average and used by general consent as a basis of comparison. slaulede 2020-11-30T14:00:43Z experimental_condition_ontology XCO:0000791 standard condition true A condition defined by a mostly uniform set of parameters accepted as normal or average and used by general consent as a basis of comparison. https://www.dictionary.com https://www.merriam-webster.com/ A trihydroxyanthraquinone that is 9,10-anthraquinone which is substituted by hydroxy groups at positions 1, 3, and 8 and by a methyl group at position 6. It is present in the roots and barks of numerous plants (particularly rhubarb and buckthorn), moulds, and lichens. It is an active ingredient of various Chinese herbs. slaulede 2020-11-30T18:03:20Z CHEBI:42223 MESH:D004642 PMID:31983185 experimental_condition_ontology XCO:0000792 emodin A trihydroxyanthraquinone that is 9,10-anthraquinone which is substituted by hydroxy groups at positions 1, 3, and 8 and by a methyl group at position 6. It is present in the roots and barks of numerous plants (particularly rhubarb and buckthorn), moulds, and lichens. It is an active ingredient of various Chinese herbs. CHEBI:42223 This is an in-silico screening analog of emodin (XCO:0000792). slaulede 2020-11-30T18:19:37Z PMID:31983185 BTB 14431 experimental_condition_ontology XCO:0000793 BTB14431 This is an in-silico screening analog of emodin (XCO:0000792). PMID:31983185 A condition in which the lin-28 homolog B gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulede 2020-12-01T17:05:51Z PMID:27384999 adenoviral transfer of the Lin28B gene gene transfer of the Lin28B gene using an adenovirus vector transfer of recombinant adenovirus containing the Lin28B gene experimental_condition_ontology Ad/Lin28B XCO:0000794 gene transfer of the lin-28 homolog B gene using an adenovirus vector A condition in which the lin-28 homolog B gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. ISBN-13:978-0781733908 PMID:24279313 A regimen of solid food in which the amount of sodium chloride consumed is controlled. slaulede 2020-12-18T17:49:31Z controlled NaCl content diet experimental_condition_ontology XCO:0000795 controlled sodium chloride content diet A regimen of solid food in which the amount of sodium chloride consumed is controlled. https://www.merriam-webster.com/ A prostaglandin endoperoxide analogue (11,9 epoxymethano-prostaglandin H2) that is a selective agonist of prostaglandin H2 (PGH2)/thromboxane A2 (TxA2) (TP) receptor. It is a stable thromboxane A2 mimetic and a vasoconstrictor. slaulede 2021-01-04T16:46:45Z CAS:56985-40-1 PMID:22508433 9,11-Dideoxy-9&#945;,11&#945;-methanoepoxyprostaglandin F 2&#945; U 46619 experimental_condition_ontology XCO:0000796 U46619 A prostaglandin endoperoxide analogue (11,9 epoxymethano-prostaglandin H2) that is a selective agonist of prostaglandin H2 (PGH2)/thromboxane A2 (TxA2) (TP) receptor. It is a stable thromboxane A2 mimetic and a vasoconstrictor. http://www.apexbt.com https://www.sigmaaldrich.com A monocarboxylic acid amide that is trans-[(1R)-1-aminoethyl]cyclohexanecarboxamide in which one of the nitrogens of the aminocarbony group is substituted by a pyridine nucleus. It is a cell-permeable, reversible inhibitor of Rho-associated protein kinase (ROCK) enzyme. slaulede 2021-01-04T16:52:50Z CAS:146986-50-7 MESH:C108830 PMID:22508433 ROCK Inhibitor Rho-associated protein kinase Inhibitor Y 27632 Y27632 experimental_condition_ontology XCO:0000797 Y-27632 A monocarboxylic acid amide that is trans-[(1R)-1-aminoethyl]cyclohexanecarboxamide in which one of the nitrogens of the aminocarbony group is substituted by a pyridine nucleus. It is a cell-permeable, reversible inhibitor of Rho-associated protein kinase (ROCK) enzyme. CHEBI:75393 https://www.sigmaaldrich.com Generated from the gene PNOC, which produces a preproprotein, which in subsequently processed to form multiple protein products. Nociceptin a 17-amino acid neuropeptide that binds to the nociceptin receptor to induce increased pain sensitivity. slaulede 2021-02-08T16:43:57Z PMID:17875345 NOP OFQ orphanin FQ experimental_condition_ontology XCO:0000798 nociceptin Generated from the gene PNOC, which produces a preproprotein, which in subsequently processed to form multiple protein products. Nociceptin a 17-amino acid neuropeptide that binds to the nociceptin receptor to induce increased pain sensitivity. https://www.ncbi.nlm.nih.gov/gene/5368 This is any condition in which the main influencing factor is ether, a mobile, very volatile, highly flammable liquid used as an inhalation anesthetic and as a solvent for waxes, fats, oils, perfumes, alkaloids, and gums. slaulede 2021-02-08T16:54:25Z CHEBI:25698he CID:3283 MESH:D004986 (C2H5)2O C4H10O CH3CH2OCH2CH3 Diethyl ether Ethyl ether experimental_condition_ontology XCO:0000799 ether This is any condition in which the main influencing factor is ether, a mobile, very volatile, highly flammable liquid used as an inhalation anesthetic and as a solvent for waxes, fats, oils, perfumes, alkaloids, and gums. MESH:D004986 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a particle with a size between 1 and 100 nanometers composed of iron oxide (Fe3O4). It contains both Fe2+ and Fe3+ ions and is sometimes formulated as FeO ? Fe2O3. It exhibits permanent magnetism and is ferrimagnetic. slaulede 2021-02-09T12:06:12Z PMID:22661893 Fe3O4 nanoparticle Iron(II,III)oxide nanoparticle MNP iron oxide nanoparticles magnetic nanoparticle experimental_condition_ontology XCO:0000800 iron oxide nanoparticle This is any condition in which the main influencing factor is a particle with a size between 1 and 100 nanometers composed of iron oxide (Fe3O4). It contains both Fe2+ and Fe3+ ions and is sometimes formulated as FeO ? Fe2O3. It exhibits permanent magnetism and is ferrimagnetic. https://en.wikipedia.org/wiki/Iron(II,III)_oxide https://pubchem.ncbi.nlm.nih.gov/compound/Iron_II_III_oxide A regimen of solid food in which the amount of gliadin consumed is controlled. Gliadins are a group of proteins called alpha, beta, gamma and omega according to their relative electrophoretic mobility in gels. They are the major component of wheat gluten and made up of single-chain polypeptides with an average molecular weight of 25–100 kDa linked by intramolecular disulfide bonds. slaulede 2021-02-09T12:53:16Z PMID:19327106 experimental_condition_ontology XCO:0000801 controlled gliadin content diet A regimen of solid food in which the amount of gliadin consumed is controlled. Gliadins are a group of proteins called alpha, beta, gamma and omega according to their relative electrophoretic mobility in gels. They are the major component of wheat gluten and made up of single-chain polypeptides with an average molecular weight of 25–100 kDa linked by intramolecular disulfide bonds. https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/gliadin It is a tertiary carboxamide and cell-permeable, potent and selective agonist of the TRPV4 (transient receptor potential vanilloid 4) channel. slaulede 2021-02-09T15:22:33Z CAS:942206-85-1 PMID:29875065 pubchem.compound:23630211 C28H32Cl2N4O6S2 experimental_condition_ontology XCO:0000802 GSK1016790A It is a tertiary carboxamide and cell-permeable, potent and selective agonist of the TRPV4 (transient receptor potential vanilloid 4) channel. CHEBI:140524 Subthreshold therapy is photocoagulation that does not produce clinical or histologic evidence of retinal damage. Therapeutic benefit is thought to be derived by inducing thermal stress on RPE cells. The goal of the subthreshold therapy is to maintain the temperature rise below the threshold of irreversible thermal damage. The main types are micropulse, selective retinal therapy (SRT), and continuous wave laser with EndPoint Management (algorithm/protocol). slaulede 2021-02-11T13:52:41Z PMID:31402999 experimental_condition_ontology XCO:0000803 subthreshold laser therapy Subthreshold therapy is photocoagulation that does not produce clinical or histologic evidence of retinal damage. Therapeutic benefit is thought to be derived by inducing thermal stress on RPE cells. The goal of the subthreshold therapy is to maintain the temperature rise below the threshold of irreversible thermal damage. The main types are micropulse, selective retinal therapy (SRT), and continuous wave laser with EndPoint Management (algorithm/protocol). PMID:27841848 https://eyewiki.aao.org/Sub-threshold_Laser#:~:text=Selective%20Retinal%20Therapy%20%28SRT%29%20Selective%20Retinal%20Therapy%20is,using%20laser%20pulse%20durations%20of%20microseconds%20or%20nanoseconds. Any biomedical use of lasers for purposes designed to improve the state of the subject. Light from a laser is tuned to specific wavelengths and is a beam of coherent electromagnetic radiation usually in the ultraviolet, visible, or infrared regions of the spectrum. slaulede 2021-02-11T14:10:41Z MESH:D053685 PMID:31402999 experimental_condition_ontology XCO:0000804 laser therapy Any biomedical use of lasers for purposes designed to improve the state of the subject. Light from a laser is tuned to specific wavelengths and is a beam of coherent electromagnetic radiation usually in the ultraviolet, visible, or infrared regions of the spectrum. https://www.healthline.com/health/laser-therapy https://www.merriam-webster.com/ Nondamaging retinal laser therapy (NRT) is a retinal treatment with a lack of tissue damage. Lack of tissue damage allows high-density treatment patterns to increase therapeutic response and periodic retreatments for chronic macular diseases. It is similar to SRT (selective RPE therapy), but using lower energy to avoid killing retinal pigmented epithelial cells. slaulede 2021-02-11T15:38:45Z PMID:31402999 NRT experimental_condition_ontology XCO:0000805 nondamaging retinal laser therapy Nondamaging retinal laser therapy (NRT) is a retinal treatment with a lack of tissue damage. Lack of tissue damage allows high-density treatment patterns to increase therapeutic response and periodic retreatments for chronic macular diseases. It is similar to SRT (selective RPE therapy), but using lower energy to avoid killing retinal pigmented epithelial cells. PMID:27159441 Selective retinal therapy (SRT) is a subthreshold laser therapy used to treat retinal disorders while preventing severe damage to the retina. In SRT RPE (retinal pigment epithelium) cells are selectively damaged without affecting the photoreceptors or choroid by using laser pulse durations of microseconds or nanoseconds slaulede 2021-02-11T17:14:59Z PMID:31402999 SRT selective RPE therapy experimental_condition_ontology XCO:0000806 selective retinal therapy Selective retinal therapy (SRT) is a subthreshold laser therapy used to treat retinal disorders while preventing severe damage to the retina. In SRT RPE (retinal pigment epithelium) cells are selectively damaged without affecting the photoreceptors or choroid by using laser pulse durations of microseconds or nanoseconds PMID:27841848 https://eyewiki.aao.org/Sub-threshold_Laser#:~:text=Selective%20Retinal%20Therapy%20%28SRT%29%20Selective%20Retinal%20Therapy%20is,using%20laser%20pulse%20durations%20of%20microseconds%20or%20nanoseconds. A beta-diketone that is methane in which two of the hydrogens are substituted by feruloyl groups. It is is a major herbal antioxidant and anti-inflammatory agent slaulede 2021-02-16T16:28:33Z CHEBI:67263 PMID:22212488 Sabiwhite tetrahydrodiferuloylmethane experimental_condition_ontology XCO:0000807 tetrahydrocurcumin A beta-diketone that is methane in which two of the hydrogens are substituted by feruloyl groups. It is is a major herbal antioxidant and anti-inflammatory agent CHEBI:67263 PMID:22212488 Any condition in which the main influencing factor is DL-&#945;-aminoadipate. This excitatory amino acid analogue is an intermediate in the principal biosynthetic pathway of lysine. It is a also an inhibitor of glutamine synthetase. slaulede 2021-02-16T17:08:36Z CHEBI:37024 MESH:D015074 PMID:28615682 AAA DL-&#945;-AAA dl-&#945;AA experimental_condition_ontology XCO:0000808 DL-&#945;-aminoadipate Any condition in which the main influencing factor is DL-&#945;-aminoadipate. This excitatory amino acid analogue is an intermediate in the principal biosynthetic pathway of lysine. It is a also an inhibitor of glutamine synthetase. MESH:D015074 This is any condition in which the main influencing factor is 2-methyl-6-(phenylethynyl)pyridine, a methylpyridine that consists of 2-methylpyridine bearing an additional phenylethynyl group at position 6. It is a potent and highly selective non-competitive antagonist at the mGlu5 receptor subtype (IC50 = 36 nM) and a positive allosteric modulator at mGlu4 receptors. It functions as an excitatory amino acid antagonist and an anxiolytic agent. slaulede 2021-02-16T17:41:28Z PMID:28615682 MPEP experimental_condition_ontology XCO:0000809 2-methyl-6-(phenylethynyl)pyridine This is any condition in which the main influencing factor is 2-methyl-6-(phenylethynyl)pyridine, a methylpyridine that consists of 2-methylpyridine bearing an additional phenylethynyl group at position 6. It is a potent and highly selective non-competitive antagonist at the mGlu5 receptor subtype (IC50 = 36 nM) and a positive allosteric modulator at mGlu4 receptors. It functions as an excitatory amino acid antagonist and an anxiolytic agent. CHEBI:64159 MESH:C121465 Any condition in which the main influencing factor is 2-Chloro-5-hydroxyphenylglycine, a metabotropic glutamate receptor 5 agonist. slaulede 2021-02-16T18:30:58Z MESH:C107349 PMID:28615682 (R,S)-2-chloro- 5-hydroxyphenylglycine CHPG experimental_condition_ontology XCO:0000810 2-Chloro-5-hydroxyphenylglycine Any condition in which the main influencing factor is 2-Chloro-5-hydroxyphenylglycine, a metabotropic glutamate receptor 5 agonist. PMID:28615682 This is any condition in which the main influencing factor is A23187, an ionophorous, polyether antibiotic from Streptomyces chartreusensis. It binds and transports calcium and other divalent cations across membranes. slaulede 2021-02-22T13:09:46Z CHEBI:3305 MESH:D000001 PMID:22508433 A-23187 calcimycin experimental_condition_ontology XCO:0000811 A23187 This is any condition in which the main influencing factor is A23187, an ionophorous, polyether antibiotic from Streptomyces chartreusensis. It binds and transports calcium and other divalent cations across membranes. MESH:D000001 This is any condition in which the main influencing factor is controlled hemorrhage, the drawing of blood (by venipuncture or artery puncture) for transfusion, apheresis, diagnostic testing, or experimental procedures. slaulede 2021-02-23T15:25:59Z PMID:17998886 phlebotomy experimental_condition_ontology XCO:0000812 controlled hemorrhage This is any condition in which the main influencing factor is controlled hemorrhage, the drawing of blood (by venipuncture or artery puncture) for transfusion, apheresis, diagnostic testing, or experimental procedures. ISBN-13:978-0702033896 https://www.merriam-webster.com/ Total body irradiation (TBI) is a form of radiotherapy (typically X-rays or gamma rays) used primarily as part of the preparative regimen for hematopoietic stem cell (or bone marrow) transplantation. slaulede 2021-03-02T14:21:45Z ISBN-13:978-0323240987 PMID:30575429 TBI experimental_condition_ontology XCO:0000813 total body irradiation Total body irradiation (TBI) is a form of radiotherapy (typically X-rays or gamma rays) used primarily as part of the preparative regimen for hematopoietic stem cell (or bone marrow) transplantation. https://en.wikipedia.org/wiki/Total_body_irradiation https://www.merriam-webster.com/ Partial body irradiation (PBI) is a form of radiotherapy used to target certain organs or to study the effects of sublethal doses of radiation. slaulede 2021-03-02T14:31:47Z PMID:22929471 PMID:27147332 PBI experimental_condition_ontology XCO:0000814 partial body irradiation Partial body irradiation (PBI) is a form of radiotherapy used to target certain organs or to study the effects of sublethal doses of radiation. PMID:22929471 PMID:27147332 This is a condition/model system that features partial body irradiation (PBI) delivering a high dose of radiation to most of the body, and a small fraction of that dose to one leg of the subject. It allows the study of multi-organ radiation injury while sparing the bone marrow from a lethal dose. slaulede 2021-03-02T15:00:18Z PMID:27682899 PMID:30575429 leg-out PBI experimental_condition_ontology XCO:0000815 leg-out partial body irradiation This is a condition/model system that features partial body irradiation (PBI) delivering a high dose of radiation to most of the body, and a small fraction of that dose to one leg of the subject. It allows the study of multi-organ radiation injury while sparing the bone marrow from a lethal dose. PMID:27682899 PMID:30575429 Partial-body irradiation with 5% bone marrow sparing (tibiae, ankles, feet) is used to define acute radiation-induced GI-ARS, H-ARS, and acute kidney injury (AKI) as well as the delayed effects of acute radiation exposure (DEARE) characterized by prolonged GI, lung, and heart injury and chronic kidney injury (CKI). This condition/model system allows analysis of concomitant multi-organ sequelae. slaulede 2021-03-02T15:35:19Z PMID:22929471 PMID:30575429 PBI/BM5 experimental_condition_ontology XCO:0000816 partial-body irradiation with 5% bone marrow sparing Partial-body irradiation with 5% bone marrow sparing (tibiae, ankles, feet) is used to define acute radiation-induced GI-ARS, H-ARS, and acute kidney injury (AKI) as well as the delayed effects of acute radiation exposure (DEARE) characterized by prolonged GI, lung, and heart injury and chronic kidney injury (CKI). This condition/model system allows analysis of concomitant multi-organ sequelae. PMID:22929471 PMID:30575429 Whole thorax lung irradiation is a type of partial body irradiation used to target the lungs. In experimental animals it is used to study the lung morbidities caused by radiation exposure. slaulede 2021-03-02T15:55:53Z PMID:30575429 PMID:33009295 WTLI experimental_condition_ontology XCO:0000817 whole thorax lung irradiation Whole thorax lung irradiation is a type of partial body irradiation used to target the lungs. In experimental animals it is used to study the lung morbidities caused by radiation exposure. PMID:30575429 A condition in which gene transfer has been performed using a plasmid as the carrier of the genetic material. A plasmid is a small, circular, double-stranded DNA molecule that is distinct from a cell's chromosomal DNA. Plasmids naturally exist in bacterial cells, and they also occur in some eukaryotes. Plasmids that are used experimentally as molecular tools are called vectors. slaulede 2021-03-04T18:11:03Z PMID:21993171 plasmid gene transfer transformation of plasmid DNA experimental_condition_ontology XCO:0000818 gene transfer using a plasmid vector A condition in which gene transfer has been performed using a plasmid as the carrier of the genetic material. A plasmid is a small, circular, double-stranded DNA molecule that is distinct from a cell's chromosomal DNA. Plasmids naturally exist in bacterial cells, and they also occur in some eukaryotes. Plasmids that are used experimentally as molecular tools are called vectors. https://www.merriam-webster.com/ https://www.nature.com/scitable/definition/plasmid-plasmids-28/ This is any condition in which the main influencing factor is gene transfer using plasmid pVAX2 as the carrier of the genetic material. The pVAX2 plasmid is based on the pVAX1 plasmid, which was designed for use in the development of DNA vaccines. slaulede 2021-03-04T18:29:17Z PMID:19440225 experimental_condition_ontology XCO:0000819 gene transfer using plasmid vector pVAX2 This is any condition in which the main influencing factor is gene transfer using plasmid pVAX2 as the carrier of the genetic material. The pVAX2 plasmid is based on the pVAX1 plasmid, which was designed for use in the development of DNA vaccines. PMID:19440225 https://www.thermofisher.com/order/catalog/product/V26020#/V26020 This is any condition in which the main influencing factor is gene transfer of an empty plasmid vector pVAX2. The pVAX2 plasmid is based on the pVAX1 plasmid, which was designed for use in the development of DNA vaccines. slaulede 2021-03-08T13:54:50Z PMID:19440225 PMID:21993171 gene transfer using empty plasmid vector pVAX2 gene transfer using only the backbone of plasmid vector pVAX2 experimental_condition_ontology XCO:0000820 sham gene transfer using an empty plasmid vector pVAX2 This is any condition in which the main influencing factor is gene transfer of an empty plasmid vector pVAX2. The pVAX2 plasmid is based on the pVAX1 plasmid, which was designed for use in the development of DNA vaccines. PMID:21993171 https://www.thermofisher.com/order/catalog/product/V26020#/V26020 A condition in which the rat GDNF gene has been (transiently or stably) transferred into a cell or organism using the plasmid vector pVAX2 in order to induce synthesis of that gene's product in the recipient cell or organism. slaulede 2021-03-08T14:07:05Z PMID:19440225 PMID:21993171 experimental_condition_ontology XCO:0000821 gene transfer of the rat GDNF gene using the plasmid vector pVAX2 A condition in which the rat GDNF gene has been (transiently or stably) transferred into a cell or organism using the plasmid vector pVAX2 in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:21993171 https://www.thermofisher.com/order/catalog/product/V26020#/V26020 JTE-607 is a pro-drug that is cleaved by carboxylesterase 1 (CES1) to its active metabolite, which then binds to cleavage and polyadenylation specificity factor 3 (CPSF3). JTE-607 reduces the production of proinflammatory cytokines in models of acute injury, septic shock and endotoxemia. slaulede 2021-03-09T12:06:36Z PMID:10493164 JTE 607 JTE 607 dihydrochloride experimental_condition_ontology XCO:0000822 JTE-607 JTE-607 is a pro-drug that is cleaved by carboxylesterase 1 (CES1) to its active metabolite, which then binds to cleavage and polyadenylation specificity factor 3 (CPSF3). JTE-607 reduces the production of proinflammatory cytokines in models of acute injury, septic shock and endotoxemia. https://www.sigmaaldrich.com/catalog/product/sigma/sml2833?lang=en&region=US https://www.tocris.com/products/jte-607-dihydrochloride_5185?gclid=Cj0KCQiA1pyCBhCtARIsAHaY_5d7izfKf8E3Lgu7fCItYrJRNFR8iSoRV7HWnsqZOjNwTGeTa9Pcu-4aAthgEALw_wcB Any condition in which the main influencing factor is peanut oil, a colorless to yellow fatty nondrying oil that is obtained from peanuts and is used chiefly as a salad oil, in margarine, in soap, and as a vehicle in pharmaceutical preparations and cosmetics. slaulede 2021-03-25T15:05:12Z PMID:24388923 arachis oil groundnut oil experimental_condition_ontology XCO:0000823 peanut oil Any condition in which the main influencing factor is peanut oil, a colorless to yellow fatty nondrying oil that is obtained from peanuts and is used chiefly as a salad oil, in margarine, in soap, and as a vehicle in pharmaceutical preparations and cosmetics. https://www.merriam-webster.com Pertussis toxin (PT) is a protein-based AB5-type exotoxin produced by the bacterium Bordetella pertussis, which causes whooping cough. PT is one of the most complex bacterial toxins known, composed of six subunits with an A protomer responsible for biologic activities and a B pentamer directing binding and entry of the A subunit into the cytoplasm. slaulede 2021-04-01T16:00:00Z PMID:1702803 B. pertussis toxin Bordetella pertussis toxin PT experimental_condition_ontology XCO:0000824 pertussis toxin Pertussis toxin (PT) is a protein-based AB5-type exotoxin produced by the bacterium Bordetella pertussis, which causes whooping cough. PT is one of the most complex bacterial toxins known, composed of six subunits with an A protomer responsible for biologic activities and a B pentamer directing binding and entry of the A subunit into the cytoplasm. https://en.wikipedia.org/wiki/Pertussis_toxin https://www.sciencedirect.com/topics/medicine-and-dentistry/pertussis-toxin An experimental condition in which the main influencing factor is cyclophosphamide (CP), an antineoplastic and immunosuppressive agent that must be activated in the liver to form the active aldophosphamide. As chemotherapy it is used to treat lymphoma, multiple myeloma, leukemia, ovarian cancer, breast cancer, small cell lung cancer, neuroblastoma, and sarcoma. slaulede 2021-04-01T16:35:28Z CHEBI:4027 MESH:D003520 CP cytophosphane experimental_condition_ontology XCO:0000825 cyclophosphamide An experimental condition in which the main influencing factor is cyclophosphamide (CP), an antineoplastic and immunosuppressive agent that must be activated in the liver to form the active aldophosphamide. As chemotherapy it is used to treat lymphoma, multiple myeloma, leukemia, ovarian cancer, breast cancer, small cell lung cancer, neuroblastoma, and sarcoma. MESH:D003520 https://en.wikipedia.org/wiki/Cyclophosphamide Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with human myelin basic protein. slaulede 2021-04-01T17:07:53Z PMID:1702803 rat anti-Hu-BP T cell line experimental_condition_ontology XCO:0000826 rat anti-Hu-MBP T cell line Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with human myelin basic protein. PMID:1702803 Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with synthetic human myelin basic protein peptide 102-129. slaulede 2021-04-01T17:27:28Z PMID:1702803 experimental_condition_ontology XCO:0000827 rat anti-Hu-S102-129 T cell line Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with synthetic human myelin basic protein peptide 102-129. PMID:1702803 Any condition in which the main influencing factor is human myelin basic protein, a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon. Human myelin basic protein is purified from human tissue or extracted from cultured cells containing cloned copies of the human myelin basic protein gene. slaulede 2021-04-01T17:46:52Z PMID:1702803 Hu-BP human MBP experimental_condition_ontology XCO:0000828 human myelin basic protein Any condition in which the main influencing factor is human myelin basic protein, a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon. Human myelin basic protein is purified from human tissue or extracted from cultured cells containing cloned copies of the human myelin basic protein gene. PMID:1702803 Corn oil is a refined fixed, that is, nonvolatile, oil obtained from from the germ of corn kernels. It has high polyunsaturated lipid content and is used as a delivery vehicle for lipophilic substances. slaulede 2021-04-08T17:10:21Z PMID:26514922 maize oil experimental_condition_ontology XCO:0000829 corn oil Corn oil is a refined fixed, that is, nonvolatile, oil obtained from from the germ of corn kernels. It has high polyunsaturated lipid content and is used as a delivery vehicle for lipophilic substances. ISBN-13:978-1608316922 https://www.merriam-webster.com Any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF), a buffer solution prepared with a composition representative of cerebrospinal fluid. It is used experimentally for rat brain microdialysis experiments, the culture of hippocampal tissue slices, or irrigation treatment of brain trauma lesions to supply oxygen, maintain osmolarity, and to buffer pH at biological levels. slaulede 2021-04-23T17:15:50Z PMID:22356885 aCSF cerebrospinal fluid simulation fluid experimental_condition_ontology XCO:0000830 artificial cerebrospinal fluid Any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF), a buffer solution prepared with a composition representative of cerebrospinal fluid. It is used experimentally for rat brain microdialysis experiments, the culture of hippocampal tissue slices, or irrigation treatment of brain trauma lesions to supply oxygen, maintain osmolarity, and to buffer pH at biological levels. https://biochemazone.com/product/artificial-cerebrospinal-solution-bz178/ https://en.wikipedia.org/wiki/Artificial_cerebrospinal_fluid Any condition in which the main influencing factor is a 2% solution (v/v) of dimethyl sulfoxide in artificial cerebrospinal fluid, a buffer solution prepared with a composition representative of cerebrospinal fluid. Dimethyl sulfoxide is a 2-carbon sulfoxide and highly polar organic liquid, that is used widely as a chemical solvent. slaulede 2021-04-23T17:27:15Z PMID:22356885 2% DMSO in aCSF experimental_condition_ontology XCO:0000831 2% dimethyl sulfoxide in artificial cerebrospinal fluid Any condition in which the main influencing factor is a 2% solution (v/v) of dimethyl sulfoxide in artificial cerebrospinal fluid, a buffer solution prepared with a composition representative of cerebrospinal fluid. Dimethyl sulfoxide is a 2-carbon sulfoxide and highly polar organic liquid, that is used widely as a chemical solvent. CHEBI:28262 MESH:D004121 https://en.wikipedia.org/wiki/Artificial_cerebrospinal_fluid Any process involving manual and instrumental techniques for incision of a lens in the eye of an organism to investigate and/or treat a pathological condition. slaulede 2021-04-30T17:36:25Z intentional incision of an ocular lens experimental_condition_ontology XCO:0000832 lensotomy Any process involving manual and instrumental techniques for incision of a lens in the eye of an organism to investigate and/or treat a pathological condition. PMID:16631043 https://en.wikipedia.org/wiki/List_of_surgical_procedures Any condition in which the main influencing factor is lacidipine, a lipophilic dihydropyridine calcium channel blocker with a slow onset of action used to treat hypertension. slaulede 2021-05-10T13:22:23Z CHEBI:135737 MESH:C060285 PMID:10023637 Lacipil Motens experimental_condition_ontology XCO:0000833 lacidipine Any condition in which the main influencing factor is lacidipine, a lipophilic dihydropyridine calcium channel blocker with a slow onset of action used to treat hypertension. https://go.drugbank.com/drugs/DB09236 https://www.sigmaaldrich.com/catalog/product/sigma/sml0946?lang=en&region=US&utm_medium=cpc&utm_source=bing&utm_term=lacidipine&utm_campaign=Backlog%20Product-Focused%20Ads%20Phase%202%20(Bing%20ebizpfs)%20(new_c)&utm_content=sigma/sml0946 Any condition in which the main influencing factor is formaldehyde, an aldehyde resulting from the formal oxidation of methanol. In solution, it has a wide range of uses: in the manufacture of resins and textiles, as a disinfectant, and as a laboratory fixative or preservative. slaulede 2021-05-17T14:00:31Z CHEBI:16842 PMID:21184763 Methanal Methylene oxide Oxomethane formalin experimental_condition_ontology XCO:0000834 formaldehyde Any condition in which the main influencing factor is formaldehyde, an aldehyde resulting from the formal oxidation of methanol. In solution, it has a wide range of uses: in the manufacture of resins and textiles, as a disinfectant, and as a laboratory fixative or preservative. CHEBI:16842 MESH:D005557 A condition in which the main influencing factor is a rat malignant glioma cell line. slaulede 2021-05-18T13:29:46Z Cellosaurus:CVCL_5712 PMID:23079672 BT4c experimental_condition_ontology XCO:0000835 BT4C cells A condition in which the main influencing factor is a rat malignant glioma cell line. PMID:23079672 https://web.expasy.org/cellosaurus/CVCL_5712 A condition in which the herpes simplex virus thymidine kinase (HSV-tk) gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulede 2021-05-18T13:40:36Z PMID:23079672 gene transfer of the Herpes Simplex Virus type 1 thymidine kinase gene using an adenovirus vector gene transfer of the herpes simplex virus thymidine kinase gene using an adenovirus vector gene transfer using AdHSV-tk experimental_condition_ontology XCO:0000836 gene transfer of the HSV-tk gene using an adenovirus vector A condition in which the herpes simplex virus thymidine kinase (HSV-tk) gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:23079672 A condition in which the 15-Lipoxygenase-1 (15-LO-1) gene has been transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulede 2021-05-18T13:57:02Z PMID:23079672 gene transfer of the 15-Lipoxygenase-1 gene using an adenovirus vector gene transfer using Ad15-LO-1 experimental_condition_ontology XCO:0000837 gene transfer of the 15-LO-1 gene using an adenovirus vector A condition in which the 15-Lipoxygenase-1 (15-LO-1) gene has been transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:23079672 Any condition in which the main influencing factor is an agent that blocks the mineralocorticoid (primarily aldosterone) receptor (NR3C2), which regulates water and electrolyte metabolism. slaulede 2021-05-21T11:58:21Z PMID:32088716 MR antagonist aldosterone receptor antagonist experimental_condition_ontology XCO:0000838 mineralocorticoid receptor antagonist Any condition in which the main influencing factor is an agent that blocks the mineralocorticoid (primarily aldosterone) receptor (NR3C2), which regulates water and electrolyte metabolism. https://en.wikipedia.org/wiki/Aldosterone https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/mineralocorticoids Any condition in which the main influencing factor is finerenone, a nonsteroidal mineralocorticoid receptor antagonist. slaulede 2021-05-21T12:40:05Z PMID:32088716 BAY 94-8862 DB16165 FIN experimental_condition_ontology XCO:0000839 finerenone Any condition in which the main influencing factor is finerenone, a nonsteroidal mineralocorticoid receptor antagonist. https://en.wikipedia.org/wiki/Finerenone https://www.medchemexpress.com/finerenone.html Any condition in which the main influencing factor is Eplerenone, a steroidal antimineralocorticoid of the spirolactone group and a selective aldosterone receptor antagonist (SARA). slaulede 2021-05-21T12:50:59Z PMID:32088716 DB00700 Inspra epoxymexrenone experimental_condition_ontology XCO:0000840 Eplerenone Any condition in which the main influencing factor is Eplerenone, a steroidal antimineralocorticoid of the spirolactone group and a selective aldosterone receptor antagonist (SARA). https://en.wikipedia.org/wiki/Eplerenone https://go.drugbank.com/drugs/DB00700 An experimental condition in which the main influencing factor is GSK-812, a potent neuroprotectant that can induce GDNF in normal and diseased retina, and antagonizes multiple receptors, including D2 and D3 receptors, and 5-HT2A, 2C, and 5-HT6 receptors.. slaulede 2021-06-04T12:00:41Z PMID:28441076 1H-3-Benzazepine, 7-[[4-[(4-chlorophenyl)Methoxy]phenyl]sulfonyl]-2,3,4,5-tetrahydro-8-Methoxy-3-Methyl- 7-[4-[(4-chlorophenyl)methoxy]phenyl]sulfonyl-8-methoxy-3-methyl-1,2,4,5-tetrahydro-3-benzazepine 7-[[4-[(4-Chlorophenyl)methoxy]phenyl]sulfonyl]-2,3,4,5-tetrahydro-8-methoxy-3-methyl-1H-3-benzazepine GSK812 experimental_condition_ontology XCO:0000841 GSK-812 An experimental condition in which the main influencing factor is GSK-812, a potent neuroprotectant that can induce GDNF in normal and diseased retina, and antagonizes multiple receptors, including D2 and D3 receptors, and 5-HT2A, 2C, and 5-HT6 receptors.. PMID:28441076 http://www.probechem.com/products_GSK-812.aspx Any condition in which the main influencing factor is a nicotinic antagonist, a type of anticholinergic drug that inhibits the action of acetylcholine (ACh) at nicotinic acetylcholine receptors. slaulede 2021-06-10T10:31:44Z CHEBI:48878 PMID:24400148 nicotinic acetylcholine receptor antagonist nicotinic cholinergic antagonist experimental_condition_ontology XCO:0000842 nicotinic antagonist Any condition in which the main influencing factor is a nicotinic antagonist, a type of anticholinergic drug that inhibits the action of acetylcholine (ACh) at nicotinic acetylcholine receptors. CHEBI:48878 https://en.wikipedia.org/wiki/Nicotinic_antagonist Any condition in which the main influencing factor is mecamylamine, a ganglionic blocking agent that inhibits transmission between preganglionic and postganglionic neurons in the autonomic nervous system. slaulede 2021-06-10T11:03:37Z PMID:24400148 C11H21N Inversine Vecamyl experimental_condition_ontology XCO:0000843 mecamylamine Any condition in which the main influencing factor is mecamylamine, a ganglionic blocking agent that inhibits transmission between preganglionic and postganglionic neurons in the autonomic nervous system. CHEBI:48878 MESH:D008464 https://en.wikipedia.org/wiki/Mecamylamine This is any condition in which the main influencing factor is the sodium salt of phenobarbital (barbituric acid substituted at C-5 by ethyl and phenyl groups). Sodium phenobarbital is an acvtivator of the constitutive androstane receptor (CAR; Nr1i3). slaulede 2021-06-24T15:00:49Z PMID:29548889 C12H11N2NaO3 Luminal sodium NaPB Sodium phenobarbitone phenobarbital sodium phenobarbital sodium salt experimental_condition_ontology XCO:0000844 sodium phenobarbital This is any condition in which the main influencing factor is the sodium salt of phenobarbital (barbituric acid substituted at C-5 by ethyl and phenyl groups). Sodium phenobarbital is an acvtivator of the constitutive androstane receptor (CAR; Nr1i3). CHEBI:8070 PMID:29548889 Any condition in which the main influencing factor is pregnenolone 16alpha-carbonitrile, a catatoxic steroid that acts as an agonist of the rodent pregnane X receptor (PXR; Nr1i2). slaulede 2021-06-24T15:21:50Z MESH:D011285 PMID:29548889 3beta-hydroxy-20-oxopregn-5-ene-16alpha-carbonitrile C22H31NO2 PCN experimental_condition_ontology XCO:0000845 pregnenolone 16alpha-carbonitrile Any condition in which the main influencing factor is pregnenolone 16alpha-carbonitrile, a catatoxic steroid that acts as an agonist of the rodent pregnane X receptor (PXR; Nr1i2). CHEBI:35591 PMID:5793358 Any condition in which the main influencing factor is a 28 amino acid polypeptide representing residues 102 to 129 in the human myelin basic protein molecule. Myelin basic protein is a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon. slaulede 2021-06-28T15:35:55Z PMID:1702803 PSQGKGRGLSLSRFSWGAEGQRPGFGYG experimental_condition_ontology XCO:0000846 Hu-S102-129 Any condition in which the main influencing factor is a 28 amino acid polypeptide representing residues 102 to 129 in the human myelin basic protein molecule. Myelin basic protein is a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon. PMID:1702803 Any condition in which the main influencing factor is a 20 amino acid polypeptide representing residues 110 to 129 in the human myelin basic protein molecule. Myelin basic protein is a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon. slaulede 2021-06-28T15:42:51Z PMID:1702803 LSLSRFSWGAEGQRPGFGYG experimental_condition_ontology XCO:0000847 Hu-S110-129 Any condition in which the main influencing factor is a 20 amino acid polypeptide representing residues 110 to 129 in the human myelin basic protein molecule. Myelin basic protein is a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon. PMID:1702803 An experimental condition in which the main influencing factor is negatively charged liposomes containing doxorubicin, a cytotoxic anthracycline antibiotic isolated from cultures of Streptomyces peucetius var. caesius and used as a chemotherapy medication. slaulede 2021-06-28T17:06:42Z PMID:6744286 lip- DXR experimental_condition_ontology XCO:0000848 negatively charged liposome-entrapped doxorubicin An experimental condition in which the main influencing factor is negatively charged liposomes containing doxorubicin, a cytotoxic anthracycline antibiotic isolated from cultures of Streptomyces peucetius var. caesius and used as a chemotherapy medication. PMID:6744286 An experimental condition in which the main influencing factor is positively charged liposomes containing doxorubicin, a cytotoxic anthracycline antibiotic isolated from cultures of Streptomyces peucetius var. caesius and used as a chemotherapy medication. slaulede 2021-06-28T17:14:08Z PMID:6744286 lip+ DXR experimental_condition_ontology XCO:0000849 positively charged liposome-entrapped doxorubicin An experimental condition in which the main influencing factor is positively charged liposomes containing doxorubicin, a cytotoxic anthracycline antibiotic isolated from cultures of Streptomyces peucetius var. caesius and used as a chemotherapy medication. PMID:6744286 This is any condition in which the main influencing factor is a chemical, biologic, organism, or action that exerts some force or effect resulting in a favorable outcome or improvement in the symptoms of a disorder or disease. slaulede 2021-06-28T18:20:14Z PMID:29273085 medicinal agent remedial agent experimental_condition_ontology Not4Curation XCO:0000850 therapeutic agent This is any condition in which the main influencing factor is a chemical, biologic, organism, or action that exerts some force or effect resulting in a favorable outcome or improvement in the symptoms of a disorder or disease. ISBN-13:978-0683400076 https://www.merriam-webster.com/ This is a condition in which the main influencing factor is a stem cell, an unspecialized cell capable of perpetuating itself through cell division and having the potential to give rise to a variety of differentiated cells with specialized functions. slaulede 2021-06-28T18:41:49Z PMID:29273085 experimental_condition_ontology Not4Curation XCO:0000851 stem cells This is a condition in which the main influencing factor is a stem cell, an unspecialized cell capable of perpetuating itself through cell division and having the potential to give rise to a variety of differentiated cells with specialized functions. CL:0000034 https://en.wikipedia.org/wiki/Stem_cell https://www.merriam-webster.com/ A condition in which the main influencing factor is human periodontal ligament-derived stem cells, which reside in the perivascular space of the periodontium, possess characteristics of mesenchymal stem cells and are a promising tool for periodontal and other tissue type regeneration. The advantages of the use of dental stem cells include their easy isolation by noninvasive routine clinical procedures, their broad differentiation potential, minimal ethical concerns, and that they may enable autologous transplantation. slaulede 2021-06-29T11:11:08Z PMID:29273085 hPDLSCs experimental_condition_ontology XCO:0000852 human periodontal ligament-derived stem cells A condition in which the main influencing factor is human periodontal ligament-derived stem cells, which reside in the perivascular space of the periodontium, possess characteristics of mesenchymal stem cells and are a promising tool for periodontal and other tissue type regeneration. The advantages of the use of dental stem cells include their easy isolation by noninvasive routine clinical procedures, their broad differentiation potential, minimal ethical concerns, and that they may enable autologous transplantation. PMID:25861283 PMID:29273085 Any condition in which the main influencing factor is serum prepared from rats bearing a subcutaneously injected B48-14 IgE-producing hybridoma. The serum is essentially antiserum containing B48-14 IgE, which are directed against a S. mansoni adult worm antigen. slaulede 2021-06-29T17:41:28Z PMID:3108390 experimental_condition_ontology XCO:0000853 rat serum from subject bearing a B48-14 IgE-producing hybridoma Any condition in which the main influencing factor is serum prepared from rats bearing a subcutaneously injected B48-14 IgE-producing hybridoma. The serum is essentially antiserum containing B48-14 IgE, which are directed against a S. mansoni adult worm antigen. PMID:3108390 https://www.merriam-webster.com/ Any condition in which the main influencing factor is serum prepared from rats bearing subcutaneously injected IR983F myeloma cells. The serum is essentially control for antiserum from rats bearing IgE-producing hybridomas. slaulede 2021-06-29T18:07:47Z PMID:3108390 rat serum from subject bearing IR 983 F myeloma experimental_condition_ontology XCO:0000854 rat serum from subject bearing IR983F myeloma Any condition in which the main influencing factor is serum prepared from rats bearing subcutaneously injected IR983F myeloma cells. The serum is essentially control for antiserum from rats bearing IgE-producing hybridomas. PMID:3108390 https://www.merriam-webster.com/ Any condition in which the main influencing factor is serum prepared from rats bearing a subcutaneously injected non-specified IgE-producing hybridoma. The serum is essentially antiserum containing control IgE, which are directed against an unspecified antigen. slaulede 2021-06-29T18:12:26Z PMID:3108390 experimental_condition_ontology XCO:0000855 rat serum from subject bearing a non-specified IgE-producing hybridoma Any condition in which the main influencing factor is serum prepared from rats bearing a subcutaneously injected non-specified IgE-producing hybridoma. The serum is essentially antiserum containing control IgE, which are directed against an unspecified antigen. PMID:3108390 https://www.merriam-webster.com/ A stilbenol that is stilbene in which the phenyl groups are substituted at positions 3, 5, and 4' by hydroxy groups. It is produced by various plants and has anti-oxidant, anti-inflammatory, cardioprotective, anti-mutagenic, and anti-carcinogenic properties. slaulede 2021-06-29T18:22:55Z PMID:30621358 3,4',5-Stilbenetriol 3,4',5-Trihydroxystilbene 5-[2-(4-hydroxyphenyl)ethenyl]benzene-1,3-diol RSV SRT501 experimental_condition_ontology XCO:0000856 resveratrol A stilbenol that is stilbene in which the phenyl groups are substituted at positions 3, 5, and 4' by hydroxy groups. It is produced by various plants and has anti-oxidant, anti-inflammatory, cardioprotective, anti-mutagenic, and anti-carcinogenic properties. MESH:D000077185 Any condition in which the main influencing factor is vildagliptin, a pyrrolidine-carbonitrile derivative and potent inhibitor of dipeptidyl peptidase 4 (DPP-4) that is used in the treatment of type 2 diabetes mellitus. slaulede 2021-07-02T13:08:02Z PMID:23774700 VG experimental_condition_ontology XCO:0000857 vildagliptin Any condition in which the main influencing factor is vildagliptin, a pyrrolidine-carbonitrile derivative and potent inhibitor of dipeptidyl peptidase 4 (DPP-4) that is used in the treatment of type 2 diabetes mellitus. MESH:D000077597 PMID:23774700 Any condition in which the main influencing factor is an injection of T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against non-specific IgE antibodies. slaulede 2021-07-02T17:20:09Z PMID:1719096 PMID:2494262 experimental_condition_ontology XCO:0000858 rat anti-control-Ab2 T cells Any condition in which the main influencing factor is an injection of T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against non-specific IgE antibodies. PMID:1719096 Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against non-specific IgE antibodies. slaulede 2021-07-02T17:23:47Z PMID:1719096 PMID:2494262 experimental_condition_ontology XCO:0000859 rat anti-control-Ab2 T cell line Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against non-specific IgE antibodies. PMID:1719096 A condition in which the main influencing factor is a monoclonal antibody having specific amino acid sequences with the ability to adhere to and interact specifically with recombinant human vascular endothelial growth factor 165. slaulede 2021-07-06T14:53:33Z PMID:15702434 anti-recombinant human vascular endothelial growth factor 165 monoclonal antibody experimental_condition_ontology XCO:0000860 anti-rh-VEGF165 monoclonal antibody A condition in which the main influencing factor is a monoclonal antibody having specific amino acid sequences with the ability to adhere to and interact specifically with recombinant human vascular endothelial growth factor 165. PMID:11316858 https://www.merriam-webster.com/ A condition in which the main influencing factor is an isotype-matched (IgG) monoclonal antibody to provide a control for some target-specific monoclonal antibody. slaulede 2021-07-06T15:18:46Z PMID:15702434 isotype-matched control Ab experimental_condition_ontology XCO:0000861 control IgG monoclonal antibody A condition in which the main influencing factor is an isotype-matched (IgG) monoclonal antibody to provide a control for some target-specific monoclonal antibody. PMID:11316858 https://www.merriam-webster.com/ A condition in which the main influencing factor is bendroflumethiazide, a sulfonamide consisting of 7-sulfamoyl-3,4-dihydro-2H-1,2,4-benzothiadiazine 1,1-dioxide in which the hydrogen at position 6 is substituted by a trifluoromethyl group and that at position 3 is substituted by a benzyl group. It has been used in the treatment of familial hyperkalemia, hypertension, edema, and urinary tract disorders. slaulede 2021-07-06T17:28:01Z PMID:18480177 Aprinox BTZ bendrofluazide experimental_condition_ontology XCO:0000862 bendroflumethiazide A condition in which the main influencing factor is bendroflumethiazide, a sulfonamide consisting of 7-sulfamoyl-3,4-dihydro-2H-1,2,4-benzothiadiazine 1,1-dioxide in which the hydrogen at position 6 is substituted by a trifluoromethyl group and that at position 3 is substituted by a benzyl group. It has been used in the treatment of familial hyperkalemia, hypertension, edema, and urinary tract disorders. CHEBI:3013 MESH:D001539 This is any condition in which the main influencing factor is a drug used in the treatment of acute or chronic vascular hypertension regardless of pharmacological mechanism. slaulede 2021-07-06T17:35:52Z PMID:18480177 antihypertensive drug experimental_condition_ontology XCO:0000863 antihypertensive agent This is any condition in which the main influencing factor is a drug used in the treatment of acute or chronic vascular hypertension regardless of pharmacological mechanism. CHEBI:35674 ISBN-13:9780781733908 A condition involving surgical manipulation causing blockage of one or more branches of the hepatic portal vein, a vein that transports nutrients from the digestive tract to the liver. slaulede 2021-07-08T13:48:54Z PMID:32156510 HPV occlusion liver portal vein occlusion experimental_condition_ontology hepatic portal vein ligation XCO:0000864 hepatic portal vein occlusion A condition involving surgical manipulation causing blockage of one or more branches of the hepatic portal vein, a vein that transports nutrients from the digestive tract to the liver. ISBN-13:9780781733908 PMID:32156510 A condition in which the main influencing factor is an androstanoid that is androst-5-ene substituted by a beta-hydroxy group at position 3 and an oxo group at position 17. It is a major C19 steroid produced by the adrenal cortex. It is also produced in small quantities in the testis and the ovary. slaulede 2021-07-09T13:35:10Z PMID:9415976 DHEA androstenolone experimental_condition_ontology XCO:0000865 dehydroepiandrosterone A condition in which the main influencing factor is an androstanoid that is androst-5-ene substituted by a beta-hydroxy group at position 3 and an oxo group at position 17. It is a major C19 steroid produced by the adrenal cortex. It is also produced in small quantities in the testis and the ovary. CHEBI:28689 MESH:D003687 Any process involving manual and instrumental techniques for incision of the internal anal sphincter muscle. The inner is controlled by the nervous system, while the external anal sphincter muscle is under voluntary control. slaulede 2021-07-09T16:04:48Z PMID:29391927 lateral internal sphincterotomy sphincterotomy experimental_condition_ontology XCO:0000866 anal sphincter myotomy Any process involving manual and instrumental techniques for incision of the internal anal sphincter muscle. The inner is controlled by the nervous system, while the external anal sphincter muscle is under voluntary control. https://www.merriam-webster.com/medical/myotomy https://www.verywellhealth.com/sphincterotomy-overview-4584862 A process in which manual and instrumental techniques are used to close a wound or surgical incision with sutures, staples, glue, or some other closure material. slaulede 2021-07-09T16:46:51Z PMID:29391927 incision closure incision stapling incision suturing experimental_condition_ontology XCO:0000867 incision repair A process in which manual and instrumental techniques are used to close a wound or surgical incision with sutures, staples, glue, or some other closure material. ISBN-13:9780781733908 https://www.merriam-webster.com/ A process in which manual and instrumental techniques are used to close a wound or surgical incision with sutures. Surgical sutures are specially made thread that comes in different sizes and different material. slaulede 2021-07-09T17:22:07Z PMID:29391927 incision suturing experimental_condition_ontology XCO:0000868 incision repair with conventional suture A process in which manual and instrumental techniques are used to close a wound or surgical incision with sutures. Surgical sutures are specially made thread that comes in different sizes and different material. ISBN-13:9780781733908 https://www.merriam-webster.com/ A process in which manual and instrumental techniques are used to close a wound or surgical incision with biosutures. Biosutures are surgical sutures upon which stem cells have been grown in vitro. slaulede 2021-07-12T10:20:45Z PMID:18690635 PMID:29391927 incision suturing with biosuture experimental_condition_ontology XCO:0000869 incision repair with biosuture A process in which manual and instrumental techniques are used to close a wound or surgical incision with biosutures. Biosutures are surgical sutures upon which stem cells have been grown in vitro. PMID:29391927 https://www.merriam-webster.com/ A condition in which the main influencing factor is a rat stem cell, isolated from subcutaneous fat tissue and cultured in vitro. A stem cell is an unspecialized cell capable of perpetuating itself through cell division and having the potential to give rise to a variety of differentiated cells with specialized functions. slaulede 2021-07-12T12:42:34Z adipose-derived stem cells PMID:29391927 experimental_condition_ontology XCO:0000870 rat adipose-derived stem cells A condition in which the main influencing factor is a rat stem cell, isolated from subcutaneous fat tissue and cultured in vitro. A stem cell is an unspecialized cell capable of perpetuating itself through cell division and having the potential to give rise to a variety of differentiated cells with specialized functions. PMID:29391927 https://www.merriam-webster.com/ A nucleobase analogue that is uracil in which the hydrogen at position 5 is replaced by fluorine. Following conversion to the active deoxynucleotide, It inhibits DNA synthesis by blocking the thymidylate synthetase conversion of deoxyuridylic acid to thymidylic acid. slaulede 2021-07-16T15:49:31Z PMID:10431686 5-FU 5-Fluoracil 5-fluoropyrimidine-2,4(1H,3H)-dione fluorouracil experimental_condition_ontology XCO:0000871 5-fluorouracil A nucleobase analogue that is uracil in which the hydrogen at position 5 is replaced by fluorine. Following conversion to the active deoxynucleotide, It inhibits DNA synthesis by blocking the thymidylate synthetase conversion of deoxyuridylic acid to thymidylic acid. CHEBI:46345 MESH:D005472 This is any condition in which the main influencing factor is thymosin alpha-1, a member of a family of heat-stable, polypeptide hormones secreted by the thymus gland. Thymosins are immune response-modulating molecules. slaulede 2021-07-16T16:55:07Z PMID:10431686 thymalfasin experimental_condition_ontology PTMA TMSA prothymosin alpha prothymosin, alpha XCO:0000872 thymosin alpha-1 This is any condition in which the main influencing factor is thymosin alpha-1, a member of a family of heat-stable, polypeptide hormones secreted by the thymus gland. Thymosins are immune response-modulating molecules. MESH:D013947 PMID:33362999 A condition in which the main influencing factor is the pulmonary metastatic subclone Sp-5 of a rat colonic carcinoma cell line (DHD/K12/TRb) used to study biochemical correlates of metastasis. slaulede 2021-07-19T17:18:00Z PMID:7818325 DHD K12/TRb - Sp-5 cells DHD-K12 TRb - Sp-5 cells DHD/K12 - Sp-5 cells TRb - Sp-5 cells experimental_condition_ontology XCO:0000873 DHD/K12/TRb - Sp-5 cells A condition in which the main influencing factor is the pulmonary metastatic subclone Sp-5 of a rat colonic carcinoma cell line (DHD/K12/TRb) used to study biochemical correlates of metastasis. PMID:19850492 PMID:7818325 This is any condition in which the main influencing factor is a controlled in situ lung condition in which the internal or external environment of one or both lungs is experimentally manipulated, for example through perfusion, increased or decreased blood flow, etc. without removal from the body. slaulede 2021-07-19T17:25:18Z PMID:7818325 Not4Curation controlled in situ pulmonary condition experimental_condition_ontology XCO:0000874 controlled in situ lung condition This is any condition in which the main influencing factor is a controlled in situ lung condition in which the internal or external environment of one or both lungs is experimentally manipulated, for example through perfusion, increased or decreased blood flow, etc. without removal from the body. ISBN-13:9780781733908 https://www.merriam-webster.com/ An experimental condition consisting of right or left thoracotomy with cannulation of pulmonary artery and vein, perfusion via artery, and collection of effluent from pulmonary vein to prevent systemic circulation of treatment or vehicle. slaulede 2021-07-19T17:33:20Z PMID:7818325 isolated single lung perfusion experimental_condition_ontology XCO:0000875 isolated lung perfusion An experimental condition consisting of right or left thoracotomy with cannulation of pulmonary artery and vein, perfusion via artery, and collection of effluent from pulmonary vein to prevent systemic circulation of treatment or vehicle. PMID:7818325 PMID:8347000 This is an antineoplastic antimetabolite that is metabolized to fluorouracil when administered by rapid injection. When administered by slow, continuous, intra-arterial infusion, it is converted to floxuridine monophosphate. It has been used to treat hepatic metastases of gastrointestinal adenocarcinomas and for palliation in malignant neoplasms of the liver and gastrointestinal tract. slaulede 2021-07-19T18:12:49Z 2'-deoxy-5-fluorouridine 5-FUdR 5-Fluorodeoxyuridine 5FDU FUDR PMID:7818325 deoxyfluorouridine fluorodeoxyuridine experimental_condition_ontology XCO:0000876 floxuridine This is an antineoplastic antimetabolite that is metabolized to fluorouracil when administered by rapid injection. When administered by slow, continuous, intra-arterial infusion, it is converted to floxuridine monophosphate. It has been used to treat hepatic metastases of gastrointestinal adenocarcinomas and for palliation in malignant neoplasms of the liver and gastrointestinal tract. CHEBI:60761 MESH:D005467 This is any condition in which the main influencing factor is Hespan buffer, 6% hetastarch in buffered solution. A buffer is a homogeneous mixture of molecules, atoms and/or ions, one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed in a sufficient quantity of solvent. slaulede 2021-07-19T18:38:39Z PMID:7818325 HB experimental_condition_ontology XCO:0000877 Hespan buffer This is any condition in which the main influencing factor is Hespan buffer, 6% hetastarch in buffered solution. A buffer is a homogeneous mixture of molecules, atoms and/or ions, one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed in a sufficient quantity of solvent. PMID:10155362 https://www.fda.gov Any condition in which the main influencing factor is Hespan buffer (6% hetastarch in buffered solution) injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel. slaulede 2021-07-20T13:59:06Z PMID:7818325 HB perfusate experimental_condition_ontology XCO:0000878 Hespan buffer perfusate Any condition in which the main influencing factor is Hespan buffer (6% hetastarch in buffered solution) injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel. PMID:10155362 https://www.fda.gov A synthetic glucocorticoid that is the 16,17-acetonide of triamcinolone. It is an anti-inflammatory agent used topically in the treatment of various skin disorders. slaulede 2021-07-20T14:16:29Z PMID:27856527 Azmacort Cinonide Kenalog 40 Tricort-40 experimental_condition_ontology XCO:0000879 triamcinolone acetonide A synthetic glucocorticoid that is the 16,17-acetonide of triamcinolone. It is an anti-inflammatory agent used topically in the treatment of various skin disorders. CHEBI:71418 MESH:D014222 Any condition in which the main influencing factor is mifepristone, a progestational and glucocorticoid hormone antagonist. Its inhibition of progesterone induces bleeding during the luteal phase and in early pregnancy by releasing endogenous prostaglandins from the endometrium or decidua. As a glucocorticoid receptor antagonist, the drug has been used to treat hypercortisolism in patients with nonpituitary Cushing Syndrome. slaulede 2021-07-20T14:26:43Z PMID:27856527 Mifegyne Mifeprex RU 38486 RU-486 RU38486 RU486 ZK98296 experimental_condition_ontology XCO:0000880 mifepristone Any condition in which the main influencing factor is mifepristone, a progestational and glucocorticoid hormone antagonist. Its inhibition of progesterone induces bleeding during the luteal phase and in early pregnancy by releasing endogenous prostaglandins from the endometrium or decidua. As a glucocorticoid receptor antagonist, the drug has been used to treat hypercortisolism in patients with nonpituitary Cushing Syndrome. MESH:D015735 This is 4-Iodoantipyrine, labeled with C-14 on the N-methyl group. Iodoantipyrine readily crosses the blood-brain barrier, and has been used to measure total and regional cerebral blood flow in vivo. slaulede 2021-07-29T17:59:13Z PMID:29498562 pubchem.compound:101126542 4-Iodoantipyrene-N-methyl-14C 4-iodo-5-methyl-1-(114C)methyl-2-phenylpyrazol-3-one C11H11IN2O experimental_condition_ontology XCO:0000881 4[N-methyl-14C] iodoantipyrine This is 4-Iodoantipyrine, labeled with C-14 on the N-methyl group. Iodoantipyrine readily crosses the blood-brain barrier, and has been used to measure total and regional cerebral blood flow in vivo. https://www.perkinelmer.com/product/iodoantipyrine-4-n-methyl-14c-nec712050uc# This procedure involves removal of about 80% of the stomach, leaving a tube-shaped stomach about the size and shape of a banana. The procedure is typically performed as a surgical intervention for weight control. slaulede 2021-08-02T15:06:01Z PMID:29168078 vertical sleeve gastrectomy experimental_condition_ontology XCO:0000882 sleeve gastrectomy This procedure involves removal of about 80% of the stomach, leaving a tube-shaped stomach about the size and shape of a banana. The procedure is typically performed as a surgical intervention for weight control. ISBN-13:9780781733908 https://www.mayoclinic.org/tests-procedures/sleeve-gastrectomy/about/pac-20385183 This is a substituted benzimidazole and proton pump inhibitor that is used in the treatment of gastroesophageal reflux and peptic ulcer. slaulede 2021-08-02T15:19:16Z PMID:29168078 5-(difluoromethoxy)-2-{[(3,4-dimethoxypyridin-2-yl)methyl]sulfinyl}-1H-benzimidazole BY-1023 Protonix SKF-96022 experimental_condition_ontology XCO:0000883 pantoprazole This is a substituted benzimidazole and proton pump inhibitor that is used in the treatment of gastroesophageal reflux and peptic ulcer. CHEBI:7915 MESH:D000077402 Any condition in which the main influencing factor is trypan blue, an azo dye used as a vital stain to selectively colour dead tissues or cells blue. slaulede 2021-08-02T16:18:02Z PMID:3347907 tetrasodium 3,3'-[(3,3'-dimethylbiphenyl-4,4'-diyl)didiazene-2,1-diyl]bis(5-amino-4-hydroxynaphthalene-2,7-disulfonate) experimental_condition_ontology XCO:0000884 trypan blue Any condition in which the main influencing factor is trypan blue, an azo dye used as a vital stain to selectively colour dead tissues or cells blue. https://en.wikipedia.org/wiki/Trypan_blue https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/trypan-blue A condition in which the main influencing factor is substance that is toxic to the pancreatic insulin-producing beta cells of the islets of Langerhans in rodents and other animals and can therefore be used for modeling diabetes mellitus through destruction of the beta cells. slaulede 2021-08-09T17:47:11Z PMID:12401717 experimental_condition_ontology XCO:0000885 diabetes-inducing chemical A condition in which the main influencing factor is substance that is toxic to the pancreatic insulin-producing beta cells of the islets of Langerhans in rodents and other animals and can therefore be used for modeling diabetes mellitus through destruction of the beta cells. CHEBI:9288 ISBN-13:9780781733908 A condition in which the main influencing factor is substance that causes seizures in experimental animals, initiated by the injection of a drug. slaulede 2021-08-09T18:13:25Z PMID:31039378 seizure-inducing chemical experimental_condition_ontology XCO:0000886 epilepsy-inducing chemical A condition in which the main influencing factor is substance that causes seizures in experimental animals, initiated by the injection of a drug. DOID:9007090 PMID:31039378 This a pharmaceutical agent that displays activity as a central nervous system and respiratory stimulant. It is considered a non-competitive gamma-aminobutyric acid antagonist. Pentetrazol has been used experimentally to study seizure phenomenon and to identify pharmaceuticals that may control seizure susceptibility. slaulede 2021-08-10T12:49:31Z CHEBI:34910 PMID:31039378 1,5-pentamethylenetetrazole PTZ pentamethylenetetrazole pentylenetetrazole experimental_condition_ontology XCO:0000887 pentetrazol This a pharmaceutical agent that displays activity as a central nervous system and respiratory stimulant. It is considered a non-competitive gamma-aminobutyric acid antagonist. Pentetrazol has been used experimentally to study seizure phenomenon and to identify pharmaceuticals that may control seizure susceptibility. MESH:D010433 Pilocarpine is a miotic alkaloid obtained from jaborandi that is used chiefly in the form of its hydrochloride or nitrate especially in the treatment of glaucoma. It is a cholinergic (muscarinic) agonist and used to cause seizures in animal models of epilepsy. slaulede 2021-08-10T13:18:44Z CHEBI:39462 PMID:31039378 experimental_condition_ontology XCO:0000888 pilocarpine Pilocarpine is a miotic alkaloid obtained from jaborandi that is used chiefly in the form of its hydrochloride or nitrate especially in the treatment of glaucoma. It is a cholinergic (muscarinic) agonist and used to cause seizures in animal models of epilepsy. MESH:D010862 https://medlineplus.gov/druginfo/meds/a608039.html https://www.merriam-webster.com/ Ionomycin is a very long-chain fatty acid that is a calcium ionophore produced by Streptomyces conglobatus. It is used in research to raise the intracellular level of Ca(2+) and as a research tool to understand Ca(2+) transport across biological membranes. slaulede 2021-08-10T13:36:53Z CHEBI:63954 MESH:D015759 PMID:32300198 C41H72O9 experimental_condition_ontology XCO:0000889 ionomycin Ionomycin is a very long-chain fatty acid that is a calcium ionophore produced by Streptomyces conglobatus. It is used in research to raise the intracellular level of Ca(2+) and as a research tool to understand Ca(2+) transport across biological membranes. CHEBI:63954 MESH:D015759 A compound that facilitates transmission of an ion across a lipid barrier (as in a cell membrane) by combining with the ion or by increasing the permeability of the barrier to it. slaulede 2021-08-10T13:40:47Z PMID:32300198 ion carrier experimental_condition_ontology XCO:0000890 ionophore A compound that facilitates transmission of an ion across a lipid barrier (as in a cell membrane) by combining with the ion or by increasing the permeability of the barrier to it. CHEBI:24869 https://www.merriam-webster.com/ Phorbol 13-acetate 12-myristate is a phorbol ester found in croton oil with very effective tumor promoting activity. It is a protein kinase C agonist and stimulates the synthesis of both DNA and RNA. slaulede 2021-08-10T13:54:49Z CHEBI:37537 12-O-Tetradecanoyl Phorbol 13-Acetate PMA TPA phorbol myristate acetate tetradecanoylphorbol acetate experimental_condition_ontology XCO:0000891 phorbol 13-acetate 12-myristate Phorbol 13-acetate 12-myristate is a phorbol ester found in croton oil with very effective tumor promoting activity. It is a protein kinase C agonist and stimulates the synthesis of both DNA and RNA. MESH:D013755 Tumor promoters are substances that enhance tumorigenicity when administered after a carcinogen. In general, tumor promoters do not possess tumorigenic activity themselves. slaulede 2021-08-10T15:45:15Z PMID:32300198 experimental_condition_ontology XCO:0000892 tumor promoter Tumor promoters are substances that enhance tumorigenicity when administered after a carcinogen. In general, tumor promoters do not possess tumorigenic activity themselves. PMID:10417370 https://www.cancer.gov/publications/dictionaries/cancer-terms/def/tumor-promotion A drink made up of water and a specified amount of ramipril in which the amount of ramipril consumed is maintained at a specified level. slaulede 2021-08-26T11:53:55Z CHEBI:8774 PMID:20864942 controlled Altace content drinking water experimental_condition_ontology XCO:0000893 controlled ramipril content drinking water A drink made up of water and a specified amount of ramipril in which the amount of ramipril consumed is maintained at a specified level. PMID:20864942 https://www.merriam-webster.com/ A regimen of solid food in which the amount of hesperidin, a disaccharide derivative that consists of hesperetin substituted by a 6-O-(alpha-L-rhamnopyranosyl)-beta-D-glucopyranosyl moiety at position 7 via a glycosidic linkage, is controlled. slaulede 2021-08-27T15:37:24Z CHEBI:28775 MESH:D006569 PMID:19966469 controlled Hesperetin 7-O-Rutinoside content diet controlled Hesperidin 2S content diet experimental_condition_ontology XCO:0000894 controlled hesperidin content diet A regimen of solid food in which the amount of hesperidin, a disaccharide derivative that consists of hesperetin substituted by a 6-O-(alpha-L-rhamnopyranosyl)-beta-D-glucopyranosyl moiety at position 7 via a glycosidic linkage, is controlled. CHEBI:28775 A regimen of solid food in which the amount of cyclodextrin (CD)-clathrated hesperetin is controlled. CD-clathrated hesperetin is the aglycone of hesperidin. Clathration by CD enhances hesperetin solubility. slaulede 2021-08-27T15:46:09Z CHEBI:28230 MESH:C013015 PMID:19966469 experimental_condition_ontology XCO:0000895 controlled cyclodextrin (CD)-clathrated hesperetin content diet A regimen of solid food in which the amount of cyclodextrin (CD)-clathrated hesperetin is controlled. CD-clathrated hesperetin is the aglycone of hesperidin. Clathration by CD enhances hesperetin solubility. PMID:19966469 A regimen of solid food in which the amount of hesperetin is controlled. Hesperetin belongs to the flavanone class of flavonoids. Hesperetin, in the form of its glycoside Hesperidin, is the predominant flavonoid in lemons and oranges. slaulede 2021-08-27T15:51:49Z CHEBI:28230 MESH:C013015 experimental_condition_ontology XCO:0000896 controlled hesperetin content diet A regimen of solid food in which the amount of hesperetin is controlled. Hesperetin belongs to the flavanone class of flavonoids. Hesperetin, in the form of its glycoside Hesperidin, is the predominant flavonoid in lemons and oranges. drugbank:DB01094 This is an alkylamide found in some peppers that acts as an agonist at TRPV1 cation channels. slaulede 2021-09-16T12:42:30Z CHEBI:3374 PMID:27335281 (6E)-N-(4-hydroxy-3-methoxybenzyl)-8-methylnon-6-enamide 8-Methyl-N-Vanillyl-6-Nonenamide Axsain Capsaicine experimental_condition_ontology XCO:0000897 capsaicin This is an alkylamide found in some peppers that acts as an agonist at TRPV1 cation channels. MESH:D002211 This a pyrimidine N-oxide that is a potent direct-acting peripheral vasodilator that reduces peripheral resistance and produces a fall in blood pressure. slaulede 2021-09-16T13:23:00Z PMID:27335281 2,4-Pyrimidinediamine, 6-(1-piperidinyl)-, 3-oxide 6-(piperidin-1-yl)pyrimidine-2,4-diamine 3-oxide Rogaine U 10858 experimental_condition_ontology XCO:0000898 minoxidil This a pyrimidine N-oxide that is a potent direct-acting peripheral vasodilator that reduces peripheral resistance and produces a fall in blood pressure. CHEBI:6942 MESH:D008914 This is a thiazide diuretic often considered the prototypical member of this class. It reduces the reabsorption of electrolytes from the renal tubules. This results in increased excretion of water and electrolytes, including sodium, potassium, chloride, and magnesium. It is used in the treatment of several disorders including edema, hypertension, diabetes insipidus, and hypoparathyroidism. slaulede 2021-10-07T13:42:44Z CHEBI:5778 PMID:3611778 Dichlothiazide Dihydrochlorothiazide experimental_condition_ontology XCO:0000899 hydrochlorothiazide This is a thiazide diuretic often considered the prototypical member of this class. It reduces the reabsorption of electrolytes from the renal tubules. This results in increased excretion of water and electrolytes, including sodium, potassium, chloride, and magnesium. It is used in the treatment of several disorders including edema, hypertension, diabetes insipidus, and hypoparathyroidism. MESH:D006852 This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of hydrochlorothiazide in which the amount of hydrochlorothiazide consumed is maintained at a specified level. slaulede 2021-10-07T14:29:25Z CHEBI:5778 PMID:3611778 controlled Microzide content drinking water controlled dichlothiazide content drinking water controlled dihydrochlorothiazide content drinking water experimental_condition_ontology XCO:0000900 controlled hydrochlorothiazide content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of hydrochlorothiazide in which the amount of hydrochlorothiazide consumed is maintained at a specified level. https://www.merriam-webster.com/ This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of delapril in which the amount of delapril consumed is maintained at a specified level. slaulede 2021-10-07T15:05:11Z CHEBI:135735 PMID:8505110 experimental_condition_ontology XCO:0000901 controlled delapril content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of delapril in which the amount of delapril consumed is maintained at a specified level. https://www.merriam-webster.com/ This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of candesartan in which the amount of candesartan consumed is maintained at a specified level. slaulede 2021-10-07T15:17:01Z CHEBI:3348 MESH:C081643 PMID:8505110 experimental_condition_ontology XCO:0000902 controlled candesartan content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of candesartan in which the amount of candesartan consumed is maintained at a specified level. https://www.merriam-webster.com/ Technetium (99mTc) mebrofenin is a diagnostic radiopharmaceutical used for imaging of the liver and the gallbladder. slaulede 2021-10-07T18:18:21Z CHEBI:135608 PMID:30208622 99mTc-N-(3-bromo-2,4,6-trimethylphenylcarbamoilmethyl 1-iminodiacetic acid Choletec Technetium mebrofenin experimental_condition_ontology XCO:0000903 99mTc-mebrofenin Technetium (99mTc) mebrofenin is a diagnostic radiopharmaceutical used for imaging of the liver and the gallbladder. https://en.wikipedia.org/wiki/Technetium_(99mTc)_mebrofenin This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of resveratrol in which the amount of resveratrol consumed is maintained at a specified level. slaulede 2021-10-08T18:16:04Z MESH:D000077185 controlled 3,4',5-Stilbenetriol content drinking water controlled RSV content drinking water controlled SRT501 content drinking water experimental_condition_ontology XCO:0000904 controlled resveratrol content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of resveratrol in which the amount of resveratrol consumed is maintained at a specified level. PMID:30621358 https://www.merriam-webster.com/ Any condition in which the main influencing factor is castor oil, a mixture of triglycerides obtained by pressing the seeds of the castor oil plant, Ricinus communis It is used as a cathartic and as a plasticizer. slaulede 2021-10-12T18:50:59Z PMID:10023637 Ricinus communis oil Ricinus oil oil of Palma Christi tangantangan oil experimental_condition_ontology XCO:0000905 castor oil Any condition in which the main influencing factor is castor oil, a mixture of triglycerides obtained by pressing the seeds of the castor oil plant, Ricinus communis It is used as a cathartic and as a plasticizer. CHEBI:140618 MESH:D002368 This is any condition in which the main influencing factor is ovalbumin, the main protein found in egg white. Ovalbumin displays sequence and three-dimensional homology to the serpin superfamily, but unlike most serpins it is not a serine protease inhibitor. slaulede 2021-10-14T16:18:19Z https://en.wikipedia.org/wiki/Ovalbumin OVA experimental_condition_ontology XCO:0000906 ovalbumin This is any condition in which the main influencing factor is ovalbumin, the main protein found in egg white. Ovalbumin displays sequence and three-dimensional homology to the serpin superfamily, but unlike most serpins it is not a serine protease inhibitor. ISBN-13:9780781733908 https://en.wikipedia.org/wiki/Ovalbumin Any condition in which the main influencing factor is liraglutide, a lipopeptide that is an analogue of human GLP-1 and an agonist of the GLP-1 receptor. Liraglutide is used as a hypoglycemic agent and supplemental therapy in the treatment of diabetes mellitus. slaulede 2021-10-15T10:42:36Z PMID:29976929 NN-2211 Saxenda Victoza experimental_condition_ontology XCO:0000907 liraglutide Any condition in which the main influencing factor is liraglutide, a lipopeptide that is an analogue of human GLP-1 and an agonist of the GLP-1 receptor. Liraglutide is used as a hypoglycemic agent and supplemental therapy in the treatment of diabetes mellitus. CHEBI:71193 MESH:D000069450 A condition in which the main influencing factor is a metal sulfate composed of potassium, aluminium and sulfate ions in the ratio 1:1:2. slaulede 2021-10-21T15:54:45Z CHEBI:26218 MESH:C041524 AlK(SO4)2 alum aluminium potassium sulfate aluminum sulfate potassium alum experimental_condition_ontology XCO:0000908 potassium aluminium sulfate A condition in which the main influencing factor is a metal sulfate composed of potassium, aluminium and sulfate ions in the ratio 1:1:2. CHEBI:86463 A condition in which the main influencing factor is any alkali metal salt having potassium(1+) as the cation. slaulede 2021-10-21T16:00:13Z CHEBI:26218 Kaliumsalz potassium salts experimental_condition_ontology XCO:0000909 potassium salt A condition in which the main influencing factor is any alkali metal salt having potassium(1+) as the cation. CHEBI:26218 A regimen of solid food in which the amount of dehydroepiandrosterone consumed is controlled. slaulede 2021-10-25T15:20:22Z CHEBI:28689 MESH:D003687 PMID:9415976 controlled DHEA content diet controlled androstenolone content diet experimental_condition_ontology XCO:0000910 controlled dehydroepiandrosterone content diet A regimen of solid food in which the amount of dehydroepiandrosterone consumed is controlled. PMID:9415976 This is any condition in which the main influencing factor is sodium bicarbonate, a white, crystalline powder that is commonly used as a pH buffering agent, an electrolyte replenisher, systemic alkalizer and in topical cleansing solutions. slaulede 2021-10-25T17:24:20Z CHEBI:32139 CID:516892 PMID:29168078 baking soda bicarbonate of soda sodium hydrogen carbonate sodium hydrogencarbonate experimental_condition_ontology XCO:0000911 sodium bicarbonate This is any condition in which the main influencing factor is sodium bicarbonate, a white, crystalline powder that is commonly used as a pH buffering agent, an electrolyte replenisher, systemic alkalizer and in topical cleansing solutions. MESH:D017693 Condition in which the environmental level and/or time of exposure to red light (wavelength range of 630–740 nm) is controlled. slaulede 2021-10-26T18:33:13Z PMID:28341233 experimental_condition_ontology XCO:0000912 controlled exposure to red light Condition in which the environmental level and/or time of exposure to red light (wavelength range of 630–740 nm) is controlled. https://en.wikipedia.org/wiki/Red Any condition in which the main influencing factor is ethosuximide, a dicarboximide that is pyrrolidine-2,5-dione in which the hydrogens at position 3 are substituted by one methyl and one ethyl group. Ethosuximide is an antiepileptic used in the treatment of absence seizures and potentially myoclonic seizures, but is ineffective against tonic-clonic seizures. slaulede 2021-10-29T11:04:35Z MESH:D005013 PMID:30408474 3-ethyl-3-methylpyrrolidine-2,5-dione Zarontin experimental_condition_ontology XCO:0000913 ethosuximide Any condition in which the main influencing factor is ethosuximide, a dicarboximide that is pyrrolidine-2,5-dione in which the hydrogens at position 3 are substituted by one methyl and one ethyl group. Ethosuximide is an antiepileptic used in the treatment of absence seizures and potentially myoclonic seizures, but is ineffective against tonic-clonic seizures. CHEBI:4887 A dietary regimen in which access to food is unlimited and consists of energy-dense, highly palatable food. The diet is technically undefined as to ratio of components, but recapitulates the orosensory properties (such as smell and texture) and palatability of foodstuffs that promote overconsumption (voluntary hyperphagia). It has been proven to not only increase body weight and induce obesity, but to also cause metabolic syndrome, severe diabetic symptoms, liver inflammation, and other metabolic dysregulations. slaulede 2021-10-29T14:53:10Z Western diet junk food diet supermarket diet experimental_condition_ontology XCO:0000914 cafeteria diet A dietary regimen in which access to food is unlimited and consists of energy-dense, highly palatable food. The diet is technically undefined as to ratio of components, but recapitulates the orosensory properties (such as smell and texture) and palatability of foodstuffs that promote overconsumption (voluntary hyperphagia). It has been proven to not only increase body weight and induce obesity, but to also cause metabolic syndrome, severe diabetic symptoms, liver inflammation, and other metabolic dysregulations. PMID:33309818 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of ethanol, serving as a control condition for some chemical delivered in ethanol and drinking water. slaulede 2021-11-01T12:46:32Z PMID:30621358 experimental_condition_ontology XCO:0000915 controlled ethanol content drinking water used as vehicle This is any condition in which the main influencing factor is a drink made up of water and a specified amount of ethanol, serving as a control condition for some chemical delivered in ethanol and drinking water. https://www.merriam-webster.com/ This is a regimen of semisolid food in which the amount of solid elements and water in the diet are controlled. The diet resembles jelly in consistency and is about 62.5% H2O, 37.5% synthetic food (Ziegler Bros., formula 53140000),0.3% NaCl, and 0.3% agar wt/wt. slaulede 2021-11-30T17:49:55Z gel diet experimental_condition_ontology gel-agar diet semisolid diet XCO:0000916 gelled diet This is a regimen of semisolid food in which the amount of solid elements and water in the diet are controlled. The diet resembles jelly in consistency and is about 62.5% H2O, 37.5% synthetic food (Ziegler Bros., formula 53140000),0.3% NaCl, and 0.3% agar wt/wt. PMID:12684228 This is any condition in which the main influencing factor is distilled water, which is purified by successive evaporation and condensation. It is experimentally provided for hydration or as a vehicle control for some dissolved substance. slaulede 2021-11-30T18:14:19Z PMID:12684228 dH2O distilled H2O experimental_condition_ontology clarified water purified water XCO:0000917 distilled water This is any condition in which the main influencing factor is distilled water, which is purified by successive evaporation and condensation. It is experimentally provided for hydration or as a vehicle control for some dissolved substance. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the major influencing factor is atmospheric air in its natural state. The composition of ambient air varies depending on the elevation above sea level, but is typically 78% nitrogen and 21% oxygen. slaulede 2021-12-07T15:31:29Z atmospheric air room air experimental_condition_ontology XCO:0000918 ambient air This is any condition in which the major influencing factor is atmospheric air in its natural state. The composition of ambient air varies depending on the elevation above sea level, but is typically 78% nitrogen and 21% oxygen. https://www.thermofisher.com A nitrosamine that has methyl and 3-carboxypropyl substituents. It is a tobacco-derived nitrosamino acid that is a known animal and potential human carcinogen. It induces bladder transitional cell carcinomas in rats and has recently been identified as a contaminant in certain blood pressure medications. slaulede 2022-02-03T13:23:56Z PMID:32123074 pubchem.compound:13643 4-[methyl(nitroso)amino]butanoic acid N-nitrosomethylaminobutyric acid N-nitrosomethylbenzylamine NMBA experimental_condition_ontology XCO:0000919 N-nitroso-N-methyl-4-aminobutyric acid A nitrosamine that has methyl and 3-carboxypropyl substituents. It is a tobacco-derived nitrosamino acid that is a known animal and potential human carcinogen. It induces bladder transitional cell carcinomas in rats and has recently been identified as a contaminant in certain blood pressure medications. CHEBI:176579 A regimen of solid food in which the amount of an inorganic element or compound containing a metal, nonmetal, radical, or phosphate that is needed for proper body function and maintenance of health, is controlled. slaulede 2022-02-03T13:41:46Z PMID:32123074 experimental_condition_ontology XCO:0000920 controlled mineral content diet A regimen of solid food in which the amount of an inorganic element or compound containing a metal, nonmetal, radical, or phosphate that is needed for proper body function and maintenance of health, is controlled. ISBN-13:9780781733908 https://www.merriam-webster.com A regimen of solid food in which the amount of zinc is controlled. slaulede 2022-02-03T13:49:41Z controlled Zn content diet experimental_condition_ontology XCO:0000921 controlled zinc content diet A regimen of solid food in which the amount of zinc is controlled. ISBN-13:9780781733908 https://www.merriam-webster.com An oxindole that is 3-methyleneoxindole in which one of the hydrogens of the methylene group is replaced by a 3,5-dimethylpyrrol-2-yl group. It has been used to produce pulmonary arterial hypertension in animal models. slaulede 2022-02-03T14:10:08Z PMID:24113457 (3Z)-3-[(3,5-dimethyl-1H-pyrrol-2-yl)methylidene]-1,3-dihydro-2H-indol-2-one SU SU 5416 SU5416 experimental_condition_ontology XCO:0000922 semaxanib An oxindole that is 3-methyleneoxindole in which one of the hydrogens of the methylene group is replaced by a 3,5-dimethylpyrrol-2-yl group. It has been used to produce pulmonary arterial hypertension in animal models. CHEBI:91083 This is an experimental condition consisting of right or left thoracotomy with cannulation of pulmonary artery and vein, perfusion via artery with Hespan buffer, and collection of effluent from pulmonary vein to prevent systemic circulation of treatment or vehicle. slaulede 2022-02-08T16:35:19Z PMID:7818325 isolated lung perfusion with HB experimental_condition_ontology XCO:0000923 isolated lung perfusion with Hespan buffer This is an experimental condition consisting of right or left thoracotomy with cannulation of pulmonary artery and vein, perfusion via artery with Hespan buffer, and collection of effluent from pulmonary vein to prevent systemic circulation of treatment or vehicle. PMID:10155362 PMID:7818325 This is an experimental condition consisting of right or left thoracotomy with cannulation of pulmonary artery and vein, perfusion via artery with a solution containing floxuridine, and collection of effluent from pulmonary vein to prevent systemic circulation of treatment or vehicle. slaulede 2022-02-08T16:41:10Z PMID:7818325 isolated lung perfusion with FUDR experimental_condition_ontology XCO:0000924 isolated lung perfusion with floxuridine This is an experimental condition consisting of right or left thoracotomy with cannulation of pulmonary artery and vein, perfusion via artery with a solution containing floxuridine, and collection of effluent from pulmonary vein to prevent systemic circulation of treatment or vehicle. ISBN-13:9780781733908 PMID:7818325 Bumetanide is a member of the class of benzoic acids, and a diuretic used for treatment of edema associated with congestive heart failure, hepatic and renal disease. slaulede 2022-03-01T17:38:17Z MESH:D002034 PMID:30385718 3-(Butylamino)-4-phenoxy-5-sulfamoylbenzoic aci Bumex Burinex experimental_condition_ontology XCO:0000925 bumetanide Bumetanide is a member of the class of benzoic acids, and a diuretic used for treatment of edema associated with congestive heart failure, hepatic and renal disease. CHEBI:3213 This is any condition in which the main influencing factor is a polyether compound, composed of repeating ethyleneoxy units, and derived from petroleum. Polyethylene glycol has many applications, including medical uses like in the composition of some laxatives. slaulede 2022-03-07T11:51:41Z PMID:32084371 PEG PEO POE poly(ethylene oxide) poly(oxyethylene) polyethylene oxide polyoxyethylene experimental_condition_ontology XCO:0000926 polyethylene glycol This is any condition in which the main influencing factor is a polyether compound, composed of repeating ethyleneoxy units, and derived from petroleum. Polyethylene glycol has many applications, including medical uses like in the composition of some laxatives. CHEBI:46793 https://en.wikipedia.org/wiki/Polyethylene_glycol A hydroxyether compound containing more than one ether group. slaulede 2022-03-07T11:58:38Z PMID:32084371 experimental_condition_ontology XCO:0000927 hydroxypolyether A hydroxyether compound containing more than one ether group. CHEBI:46789 This is a colonoscopy prep composed of 5.9% Macrogol 3350 (polyethylene glycol) and electrolytes. slaulede 2022-03-07T12:43:59Z Macrogol 3350 experimental_condition_ontology XCO:0000928 ColonLYTELY This is a colonoscopy prep composed of 5.9% Macrogol 3350 (polyethylene glycol) and electrolytes. https://www.colonprep.com.au Thia is a drink made up of water and a specified amount of ColonLYTELY (5.9% Macrogol 3350 solution) in which the amount of ColonLYTELY consumed is maintained at a specified level. slaulede 2022-03-07T12:52:46Z controlled Macrogol 3350 content drinking water experimental_condition_ontology XCO:0000929 controlled ColonLYTELY content drinking water Thia is a drink made up of water and a specified amount of ColonLYTELY (5.9% Macrogol 3350 solution) in which the amount of ColonLYTELY consumed is maintained at a specified level. PMID:32084371 https://www.colonprep.com.au This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and the kidneys. It is followed by painting of the renal blood vessels with a solution of 10% phenol. slaulede 2022-04-26T15:38:47Z PMID:15894899 RDN denervation of kidneys surgical denervation of kidneys experimental_condition_ontology XCO:0000930 renal denervation This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and the kidneys. It is followed by painting of the renal blood vessels with a solution of 10% phenol. ISBN-13:978-0781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is surgical narrowing of the lumen of the celiac artery and superior mesenteric artery. slaulede 2022-04-26T16:02:24Z PMID:15894899 experimental_condition_ontology XCO:0000931 celiac artery and superior mesenteric artery constriction This is any condition in which the main influencing factor is surgical narrowing of the lumen of the celiac artery and superior mesenteric artery. ISBN-13:978-0781733908 https://www.merriam-webster.com/ This is a family of cyclic nonapeptide hormones found in most mammals. Synthesized in the hypothalamus and stored in the post-pituitary, vasopressins play a key role in homeostasis, particularly in regulating the body's water content. Vasopressin acts as a vasoconstrictor to increase blood pressure, blood volume, and water reabsorption by the renal collecting ducts. slaulede 2022-04-26T16:45:16Z ADH AVP antidiuretic hormone experimental_condition_ontology XCO:0000932 vasopressin This is a family of cyclic nonapeptide hormones found in most mammals. Synthesized in the hypothalamus and stored in the post-pituitary, vasopressins play a key role in homeostasis, particularly in regulating the body's water content. Vasopressin acts as a vasoconstrictor to increase blood pressure, blood volume, and water reabsorption by the renal collecting ducts. CHEBI:9937 MESH:D014667 This molecule is the predominant form of mammalian vasopressin (antidiuretic hormone). It is a nonapeptide containing an arginine at residue 8 and two disulfide-linked cysteines at residues of 1 and 6. slaulede 2022-04-26T16:50:12Z Arg8-vasopressin arg-vasopressin arginine vasopressin experimental_condition_ontology XCO:0000933 argipressin This molecule is the predominant form of mammalian vasopressin (antidiuretic hormone). It is a nonapeptide containing an arginine at residue 8 and two disulfide-linked cysteines at residues of 1 and 6. CHEBI:34543 MESH:D001127 This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and both kidneys. It is followed by painting of the renal blood vessels with a solution of 10% phenol. slaulede 2022-04-28T16:36:07Z PMID:15894899 denervation of both kidneys experimental_condition_ontology XCO:0000934 bilateral renal denervation This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and both kidneys. It is followed by painting of the renal blood vessels with a solution of 10% phenol. ISBN-13:978-0781733908 https://www.merriam-webster.com/ This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and only one kidney, left or right. It is followed by painting of the renal blood vessels with a solution of 10% phenol. slaulede 2022-04-28T16:39:29Z PMID:15894899 denervation of a single kidney experimental_condition_ontology XCO:0000935 unilateral renal denervation This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and only one kidney, left or right. It is followed by painting of the renal blood vessels with a solution of 10% phenol. ISBN-13:978-0781733908 https://www.merriam-webster.com/ This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and the kidney on the left side of the body. It is followed by painting of the left side renal blood vessels with a solution of 10% phenol. slaulede 2022-04-28T16:47:06Z PMID:15894899 left side renal denervation experimental_condition_ontology XCO:0000936 left kidney denervation This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and the kidney on the left side of the body. It is followed by painting of the left side renal blood vessels with a solution of 10% phenol. ISBN-13:978-0781733908 https://www.merriam-webster.com/ This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and the kidney on the right side of the body. It is followed by painting of the right side renal blood vessels with a solution of 10% phenol. slaulede 2022-04-28T16:51:47Z PMID:15894899 right side renal denervation experimental_condition_ontology XCO:0000937 right kidney denervation This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and the kidney on the right side of the body. It is followed by painting of the right side renal blood vessels with a solution of 10% phenol. ISBN-13:978-0781733908 https://www.merriam-webster.com/ This is a serum albumin protein derived from cow blood. It is used as an enzyme-stabilizing agent, a blocking reagent, etc. for laboratory experiments. slaulede 2022-04-28T17:42:46Z PMID:15894899 BSA Fraction V https://en.wikipedia.org/wiki/Bovine_serum_albumin experimental_condition_ontology XCO:0000938 bovine serum albumin This is a serum albumin protein derived from cow blood. It is used as an enzyme-stabilizing agent, a blocking reagent, etc. for laboratory experiments. ISBN-13:978-0781733908 https://en.wikipedia.org/wiki/Bovine_serum_albumin This is a hypoglycemic drug which enhances glucose-stimulated insulin secretion. slaulede 2022-05-02T16:49:07Z 4-(4-Methylcyclohexyl)-4-oxobutanoic acid 4-(4beta-Methylcyclohexane-1-yl)-4-oxobutanoic acid Cyclohexanebutanoic acid, 4-methyl-gamma-oxo-, trans- trans&#8201;-&#8201;4&#8201;-&#8201;(4&#8201;-&#8201;methylcyclohexyl)&#8201;-&#8201;4&#8201;-&#8201;oxobutyric acid experimental_condition_ontology XCO:0000939 JTT-608 This is a hypoglycemic drug which enhances glucose-stimulated insulin secretion. PMID:10323602 This is an experimental condition in which the internal or external environment of a pancreas, the combined endocrine/exocrine gland situated transversely behind the stomach, between the spleen and the duodenum, is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body. slaulede 2022-05-05T16:23:16Z PMID:10323602 experimental_condition_ontology XCO:0000940 controlled ex vivo pancreas condition This is an experimental condition in which the internal or external environment of a pancreas, the combined endocrine/exocrine gland situated transversely behind the stomach, between the spleen and the duodenum, is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body. ISBN-13:978-0781733908 https://www.merriam-webster.com/ This is an experimental condition consisting of perfusion of the isolated pancreas with some physiological buffer (consisting of controlled solute composition and specific flow rate) in through the celiac artery and out through a portal vein. slaulede 2022-05-05T16:44:35Z PMID:10323602 PMID:1097860 experimental_condition_ontology XCO:0000941 controlled ex vivo pancreas perfusion This is an experimental condition consisting of perfusion of the isolated pancreas with some physiological buffer (consisting of controlled solute composition and specific flow rate) in through the celiac artery and out through a portal vein. ISBN-13:978-0781733908 https://www.merriam-webster.com/ A solid diet in which the amount of saxagliptin, an oral antidiabetic drug in the dipeptidyl peptidase-4 (DPP-4) inhibitor class, is maintained at a specified level. slaulede 2022-05-27T17:31:25Z CHEBI:71272 MESH:C502994 controlled 3-hydroxyadamantylglycine-4,5-methanoprolinenitrile hydrate content diet controlled Onglyza content diet experimental_condition_ontology XCO:0000942 controlled saxagliptin content diet A solid diet in which the amount of saxagliptin, an oral antidiabetic drug in the dipeptidyl peptidase-4 (DPP-4) inhibitor class, is maintained at a specified level. https://en.wikipedia.org/wiki/Saxagliptin https://www.merriam-webster.com/ This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of glucosamine in which the amount of glucosamine consumed is maintained at a specified level. slaulede 2022-06-03T16:16:44Z CHEBI:5417 PMID:22446865 controlled 2-amino-2-deoxyglucose content drinking water experimental_condition_ontology XCO:0000943 controlled glucosamine content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of glucosamine in which the amount of glucosamine consumed is maintained at a specified level. https://www.merriam-webster.com/ This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of alendronate in which the amount of alendronate consumed is maintained at a specified level. slaulede 2022-06-03T16:38:25Z PMID:22446865 controlled Fosamax content drinking water controlled sodium alendronate content drinking water experimental_condition_ontology controlled alendronic acid content drinking water XCO:0000944 controlled alendronate content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of alendronate in which the amount of alendronate consumed is maintained at a specified level. http://en.wikipedia.org/wiki/Alendronic_acid https://www.merriam-webster.com/ This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of taxifolin in which the amount of taxifolin consumed is maintained at a specified level. slaulede 2022-06-03T16:45:16Z CHEBI:38747 PMID:22446865 controlled DHQ content drinking water controlled catechin hydrate content drinking water controlled dihydroquercetin content drinking water experimental_condition_ontology XCO:0000945 controlled taxifolin content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of taxifolin in which the amount of taxifolin consumed is maintained at a specified level. https://en.wikipedia.org/wiki/Taxifolin https://www.merriam-webster.com/ This is a member of the class of piperazines that is piperazine substituted by a carboxy group at position 2R and a (1E)-1-phosphonoprop-1-en-3-yl group at position 4. It is an antagonist of N-methyl-D-aspartate receptors (NMDARs) and originally designed as a potential therapy for excitotoxicity, epilepsy or neuropathic pain. slaulede 2022-06-09T14:54:14Z PMID:32507787 pubchem.compound:6435801 (2R4-[(2E)-3-phosphonoprop-2-en-1-yl]piperazine-2-carboxylic acid CPPene D-Cpp-ene SDZ EAA 494 experimental_condition_ontology XCO:0000946 midafotel This is a member of the class of piperazines that is piperazine substituted by a carboxy group at position 2R and a (1E)-1-phosphonoprop-1-en-3-yl group at position 4. It is an antagonist of N-methyl-D-aspartate receptors (NMDARs) and originally designed as a potential therapy for excitotoxicity, epilepsy or neuropathic pain. CHEBI:180900 https://en.wikipedia.org/wiki/Midafotel This is a condition in which the main influencing factor is a drug or agent that inhibits the action of N-methyl-D-aspartate (NMDA) receptors. They tend to induce a state known as dissociative anesthesia, marked by catalepsy, amnesia, and analgesia, while side effects can include hallucinations, nightmares, and confusion. Due to their psychotomimetic effects, many NMDA receptor antagonists are used as recreational drugs. slaulede 2022-06-09T15:08:40Z PMID:32507787 N-methyl-D-aspartate receptor antagonist NMDAR antagonist experimental_condition_ontology XCO:0000947 NMDA receptor antagonist This is a condition in which the main influencing factor is a drug or agent that inhibits the action of N-methyl-D-aspartate (NMDA) receptors. They tend to induce a state known as dissociative anesthesia, marked by catalepsy, amnesia, and analgesia, while side effects can include hallucinations, nightmares, and confusion. Due to their psychotomimetic effects, many NMDA receptor antagonists are used as recreational drugs. CHEBI:60643 This is a condition in which the main influencing factor is a member of the class of piperidines that is 4-benzylpiperidine substituted by a 3-hydroxy-3-(4-hydroxyphenyl)-2-methylpropyl group at position 1 (the 1R,2S-stereoisomer). It is a potent antagonist of the GluN2B subunit of the N-methyl-D-aspartate (NMDA) receptor. slaulede 2022-06-09T15:23:24Z MESH:C109643 PMID:32507787 4-[(1R,2S)-3-(4-benzylpiperidin-1-yl)-1-hydroxy-2-methylpropyl]phenol experimental_condition_ontology XCO:0000948 Ro 25-6981 This is any condition in which the main influencing factor is PPDA, a subtype-selective NMDA receptor antagonist that preferentially binds to GluN2C/GluN2D (NR2C/NR2D) containing receptors. slaulede 2022-06-09T15:28:58Z CAS:684283-16-7 PMID:32507787 (2S*,3R*)-1-(Phenanthren-2-carbonyl)piperazine-2,3-dicarboxylic acid Cis-PPDA cis-piperidine dicarboxylic acid experimental_condition_ontology XCO:0000949 PPDA This is any condition in which the main influencing factor is PPDA, a subtype-selective NMDA receptor antagonist that preferentially binds to GluN2C/GluN2D (NR2C/NR2D) containing receptors. CHEBI:189866 This is any condition in which the main influencing factor is a drug or agent used to prevent seizures or reduce their severity. Anticonvulsants suppress the excessive rapid firing of neurons during seizures and prevent the spread of the seizure within the brain. slaulede 2022-06-09T15:44:11Z MESH:D000927 PMID:32507787 antiepileptic antiepileptic drug antiseizure drug experimental_condition_ontology Not4Curation XCO:0000950 anticonvulsant This is any condition in which the main influencing factor is a drug or agent used to prevent seizures or reduce their severity. Anticonvulsants suppress the excessive rapid firing of neurons during seizures and prevent the spread of the seizure within the brain. CHEBI:35623 https://en.wikipedia.org/wiki/Anticonvulsant This is a condition in which the main influencing factor is an AMPA and KA receptor antagonist and a neuroprotectant for cerebral ischemia. slaulede 2022-06-09T15:57:30Z CAS:118876-58-7 CHEBI:31073 6-nitro-7-sulfamoylbenzo(f)quinoxaline-2,3-dione NBQX experimental_condition_ontology XCO:0000951 2,3-Dioxo-6-nitro-7-sulfamoylbenzo(f)quinoxaline This is a condition in which the main influencing factor is an AMPA and KA receptor antagonist and a neuroprotectant for cerebral ischemia. MESH:C062865 PMID:32507787 This is a condition in which the main influencing factor is a drink made up of water and a specified amount of perindopril consumed by an organism as part of an experiment. Perindopril is a nonsulfhydryl prodrug that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications. It is rapidly metabolized in the liver to perindoprilat, a potent, competitive inhibitor of ACE. slaulede 2022-06-10T15:10:29Z CHEBI:8024 MESH:D020913 PMID:12376396 controlled Aceon content drinking water controlled Coversum content drinking water controlled Coversyl content drinking water experimental_condition_ontology XCO:0000952 controlled perindopril content drinking water This is a condition in which the main influencing factor is a drink made up of water and a specified amount of perindopril consumed by an organism as part of an experiment. Perindopril is a nonsulfhydryl prodrug that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications. It is rapidly metabolized in the liver to perindoprilat, a potent, competitive inhibitor of ACE. https://www.drugbank.ca/drugs/DB00790 https://www.merriam-webster.com/ This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of reserpine consumed by an organism as part of an experiment. Reserpine is an indole alkaloid which irreversibly blocks the vesicular monoamine transporters (VMATs), SLC18A1 and SLC18A2, and has been used as both an antihypertensive drug and an antipsychotic drug. slaulede 2022-06-10T16:51:15Z CHEBI:28487 PMID:21107278 controlled Serpasil content drinking water experimental_condition_ontology XCO:0000953 controlled reserpine content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of reserpine consumed by an organism as part of an experiment. Reserpine is an indole alkaloid which irreversibly blocks the vesicular monoamine transporters (VMATs), SLC18A1 and SLC18A2, and has been used as both an antihypertensive drug and an antipsychotic drug. https://en.wikipedia.org/wiki/Reserpine https://www.drugbank.ca/drugs/DB00206 This is a condition in which the main influencing factor is an aqueous mix of glucosamine and alendronic acid (the acid form of alendronate), two chemicals used to promote bone health. slaulede 2022-06-16T17:17:55Z CHEBI:50647 CHEBI:5417 GA glucosamine alendronate experimental_condition_ontology XCO:0000954 glucosamine - alendronate This is a condition in which the main influencing factor is an aqueous mix of glucosamine and alendronic acid (the acid form of alendronate), two chemicals used to promote bone health. PMID:22446865 This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of glucosamine - alendronate in which the amount of glucosamine - alendronate consumed is maintained at a specified level. slaulede 2022-06-16T17:23:21Z CHEBI:50647 CHEBI:5417 controlled GA content drinking water controlled glucosamine alendronate content drinking water experimental_condition_ontology XCO:0000955 controlled glucosamine - alendronate content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of glucosamine - alendronate in which the amount of glucosamine - alendronate consumed is maintained at a specified level. PMID:22446865 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF) with a concentration of 0.14 M sodium ions. Artificial cerebrospinal fluid (aCSF) is a buffer solution prepared with a composition representative of cerebrospinal fluid. slaulede 2022-06-30T16:30:19Z PMID:15458950 aCSF with 0.14 M Na+ aCSF with 0.14 M sodium artificial cerebrospinal fluid with 0.14 M Na+ experimental_condition_ontology XCO:0000956 artificial cerebrospinal fluid with 0.14 M sodium This is any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF) with a concentration of 0.14 M sodium ions. Artificial cerebrospinal fluid (aCSF) is a buffer solution prepared with a composition representative of cerebrospinal fluid. PMID:15458950 https://en.wikipedia.org/wiki/Artificial_cerebrospinal_fluid This is any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF) with a concentration of 0.15 M sodium ions. Artificial cerebrospinal fluid (aCSF) is a buffer solution prepared with a composition representative of cerebrospinal fluid. slaulede 2022-06-30T17:02:45Z PMID:15458950 aCSF with 0.15 M Na+ aCSF with 0.15 M sodium artificial cerebrospinal fluid with 0.15 M Na+ experimental_condition_ontology XCO:0000957 artificial cerebrospinal fluid with 0.15 M sodium This is any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF) with a concentration of 0.15 M sodium ions. Artificial cerebrospinal fluid (aCSF) is a buffer solution prepared with a composition representative of cerebrospinal fluid. PMID:15458950 https://en.wikipedia.org/wiki/Artificial_cerebrospinal_fluid This is any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF) with a concentration of 0.16 M sodium ions. Artificial cerebrospinal fluid (aCSF) is a buffer solution prepared with a composition representative of cerebrospinal fluid. slaulede 2022-06-30T17:07:23Z PMID:15458950 aCSF with 0.16 M Na+ aCSF with 0.16 M sodium artificial cerebrospinal fluid with 0.16 M Na+ experimental_condition_ontology XCO:0000958 artificial cerebrospinal fluid with 0.16 M sodium This is any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF) with a concentration of 0.16 M sodium ions. Artificial cerebrospinal fluid (aCSF) is a buffer solution prepared with a composition representative of cerebrospinal fluid. PMID:15458950 https://en.wikipedia.org/wiki/Artificial_cerebrospinal_fluid This is any condition in which the main influencing factor is a dichlorobenzene derivative that is a cell-permeable α2-adrenoceptor agonist used as an antihypertensive agent. slaulede 2022-07-11T17:40:30Z PMID:15458950 2,6-Dichlorobenzylideneaminoguanidine experimental_condition_ontology XCO:0000959 Guanabenz This is any condition in which the main influencing factor is a dichlorobenzene derivative that is a cell-permeable α2-adrenoceptor agonist used as an antihypertensive agent. CHEBI:5553 MESH:D006143 This is a condition in which the level of carbon dioxide (10%), oxygen (20%), and nitrogen (70%) in the air surrounding the organism or breathed by the organism is controlled as part of the experiment. slaulede 2022-07-18T18:12:29Z PMID:21421817 experimental_condition_ontology XCO:0000960 10% CO2, 20% O2, 70% N2 This is a condition in which the level of carbon dioxide (10%), oxygen (20%), and nitrogen (70%) in the air surrounding the organism or breathed by the organism is controlled as part of the experiment. PMID:21421817 https://www.merriam-webster.com/ This is an experimental condition in which the internal or external environment of a heart is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body. slaulede 2022-10-10T11:29:50Z controlled isolated heart condition experimental_condition_ontology XCO:0000961 controlled ex vivo heart condition This is an experimental condition in which the internal or external environment of a heart is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body. ISBN-13:978-0781733908 https://www.merriam-webster.com This is an experimental condition consisting of perfusion (retrograde or forward) of the isolated heart with some physiological buffer (consisting of controlled solute composition and specific flow rate) through the aorta. In retrograde perfusion the backwards pressure causes the aortic valve to shut, forcing the solution into the coronary vessels, which normally supply the heart tissue with blood. slaulede 2022-10-10T12:35:44Z Langendorff heart perfusion biventricular working heart perfusion working (ejecting) heart perfusion experimental_condition_ontology XCO:0000962 controlled ex vivo heart perfusion This is an experimental condition consisting of perfusion (retrograde or forward) of the isolated heart with some physiological buffer (consisting of controlled solute composition and specific flow rate) through the aorta. In retrograde perfusion the backwards pressure causes the aortic valve to shut, forcing the solution into the coronary vessels, which normally supply the heart tissue with blood. https://www.harvardapparatus.com/physiology/isolated-organ-perfusion-studies/isolated-heart-perfusion-systems.html https://www.merriam-webster.com This is a drink made up of acidified water (pH 2.4-2.8) and a specified amount of the basic amino acid commonly known as L-NAME and used as a non-selective inhibitor of nitric oxide synthase, consumed by an organism as part of an experiment. slaulede 2022-10-18T11:24:31Z controlled L-NAME content in acidified drinking water experimental_condition_ontology XCO:0000963 controlled NG-nitroarginine methyl ester content in acidified drinking water This is a drink made up of acidified water (pH 2.4-2.8) and a specified amount of the basic amino acid commonly known as L-NAME and used as a non-selective inhibitor of nitric oxide synthase, consumed by an organism as part of an experiment. ISBN-13:978-0781733908 MESH:D019331 This is any condition in which the main influencing factor is perfluorooctanoic acid, a fluoroalkanoic acid. slaulede 2023-02-14T11:34:01Z MESH:C023036 https://www.cancer.org PFOA pentadecafluorooctanoic acid perfluorinated octanoic acid experimental_condition_ontology XCO:0000964 perfluorooctanoic acid This is any condition in which the main influencing factor is perfluorooctanoic acid, a fluoroalkanoic acid. CHEBI:35549 This is any experimental condition in which cells derived from a multicellular organism are cultured and experimentally manipulated or regulated, for example through drug treatment or nutrient availability, in an artificial environment outside the living body. slaulede 2023-02-14T12:04:36Z controlled petri dish condition controlled test tube condition experimental_condition_ontology XCO:0000965 controlled in vitro cell condition This is any experimental condition in which cells derived from a multicellular organism are cultured and experimentally manipulated or regulated, for example through drug treatment or nutrient availability, in an artificial environment outside the living body. ISBN-13:978-0781733908 https://www.merriam-webster.com This is any experimental condition in which cultured cells are grown in a defined medium without added animal serum. slaulede 2023-02-14T12:17:04Z condition of growth medium without serum serum starvation experimental_condition_ontology XCO:0000966 controlled serum-free condition This is any experimental condition in which cultured cells are grown in a defined medium without added animal serum. ISBN-13:978-0781733908 https://www.merriam-webster.com This is any condition in which the main influencing factor is a gastric bypass, a type of weight-loss surgery that involves creating a small pouch from the stomach and connecting the newly created pouch directly to the small intestine. After gastric bypass, swallowed food will go into this small pouch of stomach and then directly into the small intestine, thereby bypassing most of the stomach and the first section of the small intestine. slaulede 2023-02-27T18:10:08Z Roux-en-Y gastric bypass Roux-en-Y gastric bypass surgery gastric bypass surgery experimental_condition_ontology XCO:0000967 gastric bypass This is any condition in which the main influencing factor is a gastric bypass, a type of weight-loss surgery that involves creating a small pouch from the stomach and connecting the newly created pouch directly to the small intestine. After gastric bypass, swallowed food will go into this small pouch of stomach and then directly into the small intestine, thereby bypassing most of the stomach and the first section of the small intestine. https://www.mayoclinic.org/tests-procedures/gastric-bypass-surgery/about/pac-20385189 https://www.merriam-webster.com This is a condition induced by an experimental surgical procedure involving fluid percussion, cortical impact, or weight drop/impact acceleration to produce controlled injury to the surface of the brain. slaulede 2023-02-27T18:45:54Z experimental TBI experimental_condition_ontology XCO:0000968 experimental traumatic brain injury This is a condition induced by an experimental surgical procedure involving fluid percussion, cortical impact, or weight drop/impact acceleration to produce controlled injury to the surface of the brain. PMID:21876530 This is an experimental injury condition produced by a pendulum-and-piston-based device applying a brief fluid pressure pulse onto the intact dura after performing a craniectomy on the head of the subject. slaulede 2023-03-02T13:40:02Z LFPI lateral fluid-percussion injury parasagittal fluid percussion injury experimental_condition_ontology XCO:0000969 lateral fluid percussion injury This is an experimental injury condition produced by a pendulum-and-piston-based device applying a brief fluid pressure pulse onto the intact dura after performing a craniectomy on the head of the subject. PMID:19022291 PMID:21876530 This is any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of a protein kinase inhibitor. A protein kinase is an enzyme that regulates the biological activity of proteins by phosphorylation of specific amino acids with ATP as the source of phosphate, thereby inducing a conformational change from an inactive to an active form of the protein. slaulede 2023-03-02T14:39:02Z experimental_condition_ontology XCO:0000970 protein kinase inhibitor This is any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of a protein kinase inhibitor. A protein kinase is an enzyme that regulates the biological activity of proteins by phosphorylation of specific amino acids with ATP as the source of phosphate, thereby inducing a conformational change from an inactive to an active form of the protein. https://en.wikipedia.org/wiki/Protein_kinase https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/protein-kinases This is any condition in which the main influencing factor is the chemical SB525334, which decreases or interferes with the activity of the serine/threonine protein kinase Alk5 (activin receptor-like kinase-5). slaulede 2023-03-02T14:58:14Z CID:9967941 6-(2-(tert-Butyl)-5-(6-methylpyridin-2-yl)-1H-imidazol-4-yl)quinoxaline SB 525334 SB-525334 TGF- beta RI Kinase Inhibitor VIII experimental_condition_ontology XCO:0000971 SB525334 This is any condition in which the main influencing factor is the chemical SB525334, which decreases or interferes with the activity of the serine/threonine protein kinase Alk5 (activin receptor-like kinase-5). RGD:733386 This is any condition in which the main influencing factor is the chemical nintedanib, a member of the class of oxindoles that is a multi-kinase inhibitor used for the treatment of idiopathic pulmonary fibrosis and cancer. slaulede 2023-03-02T15:05:33Z MESH:C530716 (Z)-Methyl 3-(((4-(N-methyl-2-(4-methylpiperazin-1-yl)acetamido)phenyl)amino)(phenyl)methylene)-2-oxoindoline-6-carboxylate Intedanib Ofev Vargatef methyl (3Z)-3-[(4-{methyl[(4-methylpiperazin-1-yl)acetyl]amino}anilino)(phenyl)methylidene]-2-oxo-2,3-dihydro-1H-indole-6-carboxylate experimental_condition_ontology XCO:0000972 nintedanib This is any condition in which the main influencing factor is the chemical nintedanib, a member of the class of oxindoles that is a multi-kinase inhibitor used for the treatment of idiopathic pulmonary fibrosis and cancer. CHEBI:85164 This is any condition in which the main influencing factor is the chemical sorafenib, a member of the class of phenylureas that are multi-kinase inhibitors and anti-neoplastic agents. slaulede 2023-03-02T15:15:18Z 4-(4-(3-(4-CHLORO-3-(TRIFLUOROMETHYL)PHENYL)UREIDO)PHENOXY)-N-METHYLPICOLINAMIDE 4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide BAY 43-9006 Nexavar experimental_condition_ontology XCO:0000973 sorafenib This is any condition in which the main influencing factor is the chemical sorafenib, a member of the class of phenylureas that are multi-kinase inhibitors and anti-neoplastic agents. CHEBI:50924 This is a condition in which the main influencing factor is a surgical procedure causing blockage of the bile duct by suture ligation, which leads to acute obstructive jaundice and eventually to liver fibrosis. slaulede 2023-03-02T15:29:13Z CBDL common bile duct ligation experimental_condition_ontology XCO:0000974 bile duct ligation This is a condition in which the main influencing factor is a surgical procedure causing blockage of the bile duct by suture ligation, which leads to acute obstructive jaundice and eventually to liver fibrosis. https://www.sciencedirect.com/topics/medicine-and-dentistry/bile-duct-ligation This is any condition in which the main influencing factor is carbon tetrachloride, a chlorocarbon that is methane in which all the hydrogens have been replaced by chloro groups. It is a solvent for oils, fats, lacquers, varnishes, rubber waxes, and resins, and a starting material in the manufacturing of organic compounds. slaulede 2023-03-06T12:33:48Z CHEBI:27385 MESH:D002251 CCl4 tetrachloromethane experimental_condition_ontology XCO:0000975 carbon tetrachloride This is any condition in which the main influencing factor is carbon tetrachloride, a chlorocarbon that is methane in which all the hydrogens have been replaced by chloro groups. It is a solvent for oils, fats, lacquers, varnishes, rubber waxes, and resins, and a starting material in the manufacturing of organic compounds. CHEBI:27385 MESH:D002251 This is a chloroethene that is ethene substituted by chlorides at positions 1, 1 and 2. It is a highly volatile inhalation anesthetic used mainly in short surgical procedures where light anesthesia with good analgesia is required. It is also used as an industrial solvent. slaulede 2023-03-06T13:54:06Z 1,1,2-trichloroethene trichloroethene experimental_condition_ontology XCO:0000976 trichlorethylene This is a chloroethene that is ethene substituted by chlorides at positions 1, 1 and 2. It is a highly volatile inhalation anesthetic used mainly in short surgical procedures where light anesthesia with good analgesia is required. It is also used as an industrial solvent. CHEBI:16602 MESH:D014241 This is any experimental condition in which cells derived from a multicellular organism are cultured in medium enriched in amino acids, glucose, and other unique ingredients and supplemented with dexamethasone, penicillin/streptomycin, ITS+, GlutaMAX and HEPES; Gibco #CM4000. William's E Medium was originally developed by Williams and Gunn as reduced serum-supplemented medium for long-term cell cultures of adult rat liver epithelial cells. slaulede 2023-03-06T14:19:01Z PMID:31501904 supplemented William’s E Medium experimental_condition_ontology XCO:0000977 supplemented Williams' E Medium This is any experimental condition in which cells derived from a multicellular organism are cultured in medium enriched in amino acids, glucose, and other unique ingredients and supplemented with dexamethasone, penicillin/streptomycin, ITS+, GlutaMAX and HEPES; Gibco #CM4000. William's E Medium was originally developed by Williams and Gunn as reduced serum-supplemented medium for long-term cell cultures of adult rat liver epithelial cells. PMID:31501904 https://www.thermofisher.com/order/catalog/product/12551032 This is any condition in which the main influencing factor is an acetylated form of L-carnitine. It is naturally produced by the human body, and it is available as a dietary supplement. Acetyl-L-carnitine is broken down in the blood by plasma esterases to carnitine which is used by the body to transport fatty acids into the mitochondria for breakdown. slaulede 2023-03-09T13:05:38Z CHEBI:57589 MESH:D000108 ALC ALCAR L-ACETYLCARNITINE L-acetyl-carnitine LAC O-Acetyl-L-carnitine acetylcarnitine experimental_condition_ontology XCO:0000978 acetyl-L-carnitine This is any condition in which the main influencing factor is an acetylated form of L-carnitine. It is naturally produced by the human body, and it is available as a dietary supplement. Acetyl-L-carnitine is broken down in the blood by plasma esterases to carnitine which is used by the body to transport fatty acids into the mitochondria for breakdown. https://en.wikipedia.org/wiki/Acetylcarnitine This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of acetyl-L-carnitine in which the amount of acetyl-L-carnitine consumed is maintained at a specified level. slaulede 2023-03-09T13:19:08Z CHEBI:57589 MESH:D000108 controlled ALC content drinking water controlled ALCAR content drinking water controlled L-ACETYLCARNITINE L-ACETYLCARNITINE content drinking water controlled L-acetyl-carnitine content drinking water controlled LAC content drinking water controlled O-Acetyl-L-carnitine content drinking water controlled acetylcarnitine content drinking water experimental_condition_ontology XCO:0000979 controlled acetyl-L-carnitine content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of acetyl-L-carnitine in which the amount of acetyl-L-carnitine consumed is maintained at a specified level. ISBN-13:978-0781733908 https://www.merriam-webster.com This is an experimental regimen of gelled food in which the amount of solid elements, water, and some other component(s) in the diet are controlled. slaulede 2023-03-09T13:43:10Z controlled content gel diet experimental_condition_ontology controlled content gel-agar diet controlled content semisolid diet XCO:0000980 controlled content gelled diet This is an experimental regimen of gelled food in which the amount of solid elements, water, and some other component(s) in the diet are controlled. PMID:12684228 https://www.merriam-webster.com This is an experimental regimen of gelled food in which the amount of solid elements, water, and lithium chloride in the diet are controlled. slaulede 2023-03-09T13:47:41Z controlled LiCl content gelled diet experimental_condition_ontology XCO:0000981 controlled lithium chloride content gelled diet This is an experimental regimen of gelled food in which the amount of solid elements, water, and lithium chloride in the diet are controlled. PMID:12684228 PMID:31146973 This is a condition in which gene transfer has been performed using a lentivirus as the carrier of the genetic material. Lentivirus is a genus of retroviruses that cause chronic and deadly diseases characterized by long incubation periods, in humans and other mammalian species. Lentiviruses are distributed worldwide, and are known to be hosted in apes, cows, goats, horses, cats, and sheep as well as several other mammals. slaulede 2023-03-13T13:28:54Z lentiviral gene transfer lentivirus transfer experimental_condition_ontology XCO:0000982 gene transfer using a lentivirus vector This is a condition in which gene transfer has been performed using a lentivirus as the carrier of the genetic material. Lentivirus is a genus of retroviruses that cause chronic and deadly diseases characterized by long incubation periods, in humans and other mammalian species. Lentiviruses are distributed worldwide, and are known to be hosted in apes, cows, goats, horses, cats, and sheep as well as several other mammals. ISBN-13:978-0781733908 https://en.wikipedia.org/wiki/Lentivirus This is a condition in which the enhanced green fluorescent protein (EGFP) gene has been (transiently or stably) transferred into a cell or organism using an lentivirus carrier in order to induce synthesis of EGFP in the recipient cell or organism. slaulede 2023-03-13T13:41:04Z gene transduction of the enhanced green fluorescent protein gene using a lentivirus vector gene transfer of the eGFP gene using a lentivirus vector gene transfer of the enhanced green fluorescent protein gene using a lentivirus vector lentiviral transfer of the EGFP gene transduction of recombinant lentivirus containing the EGFP gene transfer of recombinant lentivirus containing the EGFP gene experimental_condition_ontology XCO:0000983 gene transfer of the EGFP gene using a lentivirus vector This is a condition in which the enhanced green fluorescent protein (EGFP) gene has been (transiently or stably) transferred into a cell or organism using an lentivirus carrier in order to induce synthesis of EGFP in the recipient cell or organism. PMID:28241067 https://www.merriam-webster.com This is a condition in which the rat wild type cyclin Y gene (Ccny) has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of rat cyclin Y in the recipient cell or organism. slaulede 2023-03-13T14:07:11Z lentiviral transfer of the rat wild type Ccny gene transfer of recombinant lentivirus containing the rat wild type Ccny gene experimental_condition_ontology XCO:0000984 gene transfer of the rat wild type Ccny gene using a lentivirus vector This is a condition in which the rat wild type cyclin Y gene (Ccny) has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of rat cyclin Y in the recipient cell or organism. PMID:26220330 This is a condition in which the rat wild type cyclin Y gene short hairpin RNA (Ccny-shRNA) has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to reduce synthesis of rat wild type cyclin Y in the recipient cell or organism. slaulede 2023-03-13T14:27:37Z lentiviral transfer of the rat wild type Ccny-specific shRNA transduction of recombinant lentivirus containing the rat wild type Ccny-specific shRNA transfer of recombinant lentivirus containing the rat wild type-specific shRNA experimental_condition_ontology XCO:0000985 transfer of rat wild type Ccny-specific shRNA using a lentivirus vector This is a condition in which the rat wild type cyclin Y gene short hairpin RNA (Ccny-shRNA) has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to reduce synthesis of rat wild type cyclin Y in the recipient cell or organism. PMID:28241067 https://www.merriam-webster.com This is a condition in which the rat wild type cyclin Y gene short hairpin RNA (Ccny-shRNA) and enhanced green fluorescent protein (EGFP) gene have been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to reduce synthesis of rat wild type cyclin Y while inducing EGFP synthesis in the recipient cell or organism. slaulede 2023-03-13T14:36:52Z lentiviral transfer of the rat wild type Ccny-specific shRNA and the EGFP gene transduction of recombinant lentivirus containing the rat wild type-specific shRNA and the EGFP gene transfer of recombinant lentivirus containing the rat wild type-specific shRNA and the EGFP gene experimental_condition_ontology XCO:0000986 transfer of the rat wild type Ccny-specific shRNA and EGFP gene using a lentivirus vector This is a condition in which the rat wild type cyclin Y gene short hairpin RNA (Ccny-shRNA) and enhanced green fluorescent protein (EGFP) gene have been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to reduce synthesis of rat wild type cyclin Y while inducing EGFP synthesis in the recipient cell or organism. PMID:28241067 https://www.merriam-webster.com This is a condition in which the rat wild type cyclin Y gene (Ccny-WT) and enhanced green fluorescent protein (EGFP) gene have been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of both rat wild type cyclin Y and EGFP in the recipient cell or organism. slaulede 2023-03-13T14:42:14Z lentiviral transfer of the rat wild type Ccny gene and the EGFP gene transduction of recombinant lentivirus containing the rat wild type Ccny gene and the EGFP gene transfer of recombinant lentivirus containing the rat wild type Ccny gene and the EGFP gene experimental_condition_ontology XCO:0000987 gene transfer of the rat wild type Ccny gene and EGFP gene using a lentivirus vector This is a condition in which the rat wild type cyclin Y gene (Ccny-WT) and enhanced green fluorescent protein (EGFP) gene have been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of both rat wild type cyclin Y and EGFP in the recipient cell or organism. PMID:28241067 https://www.merriam-webster.com This is any experimental condition in which the main influencing factor is Dulbecco's Modified Eagle's Medium. Typically, cells derived from a multicellular organism are cultured in this synthetic medium originally formulated by Dulbecco and Freeman and based on Eagle's Minimal Essential Medium. slaulede 2023-03-14T11:55:08Z DMEM DMEM, low glucose, pyruvate experimental_condition_ontology XCO:0000988 Dulbecco's Modified Eagle's Medium This is any experimental condition in which the main influencing factor is Dulbecco's Modified Eagle's Medium. Typically, cells derived from a multicellular organism are cultured in this synthetic medium originally formulated by Dulbecco and Freeman and based on Eagle's Minimal Essential Medium. https://en.wikipedia.org/wiki/Eagle%27s_minimal_essential_medium https://www.thermofisher.com/us/en/home/technical-resources/media-formulation.48.html This is any experimental condition in which the main influencing factor is fetal bovine serum. Fetal bovine serum is the most widely used serum-supplement for the in vitro cell culture of eukaryotic cells. Fetal bovine serum is derived from the blood drawn from a bovine fetus via a closed system of collection at a slaughterhouse. slaulede 2023-03-14T12:20:39Z FBS fetal calf serum experimental_condition_ontology XCO:0000989 fetal bovine serum This is any experimental condition in which the main influencing factor is fetal bovine serum. Fetal bovine serum is the most widely used serum-supplement for the in vitro cell culture of eukaryotic cells. Fetal bovine serum is derived from the blood drawn from a bovine fetus via a closed system of collection at a slaughterhouse. PMID:13598821 https://en.wikipedia.org/wiki/Fetal_bovine_serum This is any experimental condition in which the main influencing factor is Neurobasal medium, a culture medium formulated to meet the special requirements of neuronal cells. This medium allows for the long-term maintenance of normal phenotype and growth of neuronal cells, and the maintenance of pure populations of neuronal cells without the need of an astrocyte feeder layer. slaulede 2023-03-14T12:39:34Z PMID:26640375 experimental_condition_ontology XCO:0000990 Neurobasal medium This is any experimental condition in which the main influencing factor is Neurobasal medium, a culture medium formulated to meet the special requirements of neuronal cells. This medium allows for the long-term maintenance of normal phenotype and growth of neuronal cells, and the maintenance of pure populations of neuronal cells without the need of an astrocyte feeder layer. https://www.thermofisher.com/us/en/home/technical-resources/media-formulation.251.html This is any experimental condition in which the main influencing factor is GlutaMAX-I, a dipeptide (L-alanyl-L-glutamine) substitute for L-glutamine that can be used as a direct substitute for L-Glutamine at equimolar concentrations in mammalian and stem cell culture with minimal or no adaptation. L-alanyl-L-glutamine eliminates problems associated with the spontaneous breakdown of L-glutamine during incubation, is highly soluble in aqueous solution, and is heat stable. slaulede 2023-03-14T14:17:15Z PMID:26640375 L-alanyl-L-glutamine experimental_condition_ontology XCO:0000991 GlutaMAX-I This is any experimental condition in which the main influencing factor is GlutaMAX-I, a dipeptide (L-alanyl-L-glutamine) substitute for L-glutamine that can be used as a direct substitute for L-Glutamine at equimolar concentrations in mammalian and stem cell culture with minimal or no adaptation. L-alanyl-L-glutamine eliminates problems associated with the spontaneous breakdown of L-glutamine during incubation, is highly soluble in aqueous solution, and is heat stable. https://www.fishersci.com This is any experimental condition in which the main influencing factor is B-27, an optimized serum-free supplement used to support the low- or high-density growth and short- or long-term viability of embryonic, post-natal, and adult hippocampal and other CNS neurons. It is meant to supplement a basal medium such as Neurobasal medium. slaulede 2023-03-14T14:27:51Z PMID:26640375 experimental_condition_ontology XCO:0000992 B-27 This is any experimental condition in which the main influencing factor is B-27, an optimized serum-free supplement used to support the low- or high-density growth and short- or long-term viability of embryonic, post-natal, and adult hippocampal and other CNS neurons. It is meant to supplement a basal medium such as Neurobasal medium. https://www.thermofisher.com/order/catalog/product/17504044 This is any experimental condition in which the main influencing factor is a controlled level of moisture in the air provided to an organism, ex vivo tissue, or cultured cells. slaulede 2023-03-14T14:39:30Z PMID:26640375 air H2O content controlled H2O content air controlled water content air experimental_condition_ontology XCO:0000993 controlled humidity This is any experimental condition in which the main influencing factor is a controlled level of moisture in the air provided to an organism, ex vivo tissue, or cultured cells. https://www.merriam-webster.com This is any experimental condition in which the main influencing factor is StemPro NSC SFM, a serum-free culture medium formulated to meet the special requirements of neuronal stem cells. This medium supports expansion of both adherent and spheroid cultures, and differentiation capability into astrocytes, oligodendrocytes and neurons. slaulede 2023-03-14T14:52:39Z PMID:2664037 neuralstem cell serum free medium experimental_condition_ontology XCO:0000994 StemPro NSC SFM This is any experimental condition in which the main influencing factor is StemPro NSC SFM, a serum-free culture medium formulated to meet the special requirements of neuronal stem cells. This medium supports expansion of both adherent and spheroid cultures, and differentiation capability into astrocytes, oligodendrocytes and neurons. https://www.thermofisher.com/order/catalog/product/A1050901 This is any experimental condition in which the main influencing factor is a dimeric isoform of platelet-derived growth factor (PDGF-AA). All PDGF isoforms are potent mitogens for connective tissue cells, including dermal fibroblasts, glial cells, arterial smooth muscle cells and some epithelial and endothelial cells. PDGF appears to be ubiquitous in neurons throughout the CNS, where it is suggested to play an important role in neuron survival and regeneration, and in mediation of glial cell proliferation and differentiation. slaulede 2023-03-14T15:14:58Z PMID:26640375 platelet-derived growth factor-AA platelet-derived growth factor-AA isoform platelet-derived growth factor-alpha/alpha isoform experimental_condition_ontology XCO:0000995 PDGF-AA This is any experimental condition in which the main influencing factor is a dimeric isoform of platelet-derived growth factor (PDGF-AA). All PDGF isoforms are potent mitogens for connective tissue cells, including dermal fibroblasts, glial cells, arterial smooth muscle cells and some epithelial and endothelial cells. PDGF appears to be ubiquitous in neurons throughout the CNS, where it is suggested to play an important role in neuron survival and regeneration, and in mediation of glial cell proliferation and differentiation. https://www.thermofisher.com/antibody/product/Human-PDGF-AA-Animal-Free-Recombinant-Protein/AF-100-13A-1MG This is any condition in which the main influencing factor is CHAER1 (cardiac hypertrophy associated epigenetic regulator 1) siRNA (small interfering RNA) transfected by Lipofectamine. Small interfering RNA (siRNA) is a class of double-stranded RNA (20-24bp) that acts in the RNA interference pathway, by interfering with the expression of genes with complementary nucleotide sequence to that of siRNA, inducing mRNA degradation. CHAER1 is an ncRNA involved in epigenetic regulation of gene expression. Lipofectamine is a proprietary formulation for transfecting small RNAs into cultured eukaryotic cells. slaulede 2023-03-23T13:58:48Z PMID:27618650 transfection of CHAER1 short interfering RNA using Lipofectamine reagent transfection of CHAER1 siRNA using Lipofectamine reagent transfection of CHAER1 silencing RNA using Lipofectamine reagent transfection of CHAER1 small interfering RNA using Lipofectamine reagent experimental_condition_ontology XCO:0000996 transfer of CHAER1 siRNA using Lipofectamine reagent This is any condition in which the main influencing factor is CHAER1 (cardiac hypertrophy associated epigenetic regulator 1) siRNA (small interfering RNA) transfected by Lipofectamine. Small interfering RNA (siRNA) is a class of double-stranded RNA (20-24bp) that acts in the RNA interference pathway, by interfering with the expression of genes with complementary nucleotide sequence to that of siRNA, inducing mRNA degradation. CHAER1 is an ncRNA involved in epigenetic regulation of gene expression. Lipofectamine is a proprietary formulation for transfecting small RNAs into cultured eukaryotic cells. https://en.wikipedia.org/wiki/Small_interfering_RNA https://www.thermofisher.com/us/en/home/life-science/cell-culture/transfection/transfection-reagents/lipofectamine-rnaimax-reagent.html This is any condition in which the main influencing factor is transfer of negative control siRNA (small interfering RNA) delivered with Lipofectamine. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences. Lipofectamine is a proprietary formulation for transfecting small RNAs into cultured eukaryotic cells. slaulede 2023-03-23T14:11:37Z PMID:27618650 transfection of negative control short interfering RNA using Lipofectamine reagent transfection of negative control siRNA using Lipofectamine reagent transfection of negative control silencing RNA using Lipofectamine reagent transfection of negative control small interfering RNA using Lipofectamine reagent experimental_condition_ontology XCO:0000997 transfer of negative control siRNA using Lipofectamine reagent This is any condition in which the main influencing factor is transfer of negative control siRNA (small interfering RNA) delivered with Lipofectamine. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences. Lipofectamine is a proprietary formulation for transfecting small RNAs into cultured eukaryotic cells. https://en.wikipedia.org/wiki/Small_interfering_RNA https://www.thermofisher.com/us/en/home/life-science/cell-culture/transfection/transfection-reagents/lipofectamine-rnaimax-reagent.html This is any condition in which the main influencing factor is control of the process of breathing, whether by the control of the volume of air breathed or by control of the contents of the breathed air. This may be for the treatment of disease or for the experimental study of physiology or pathology. slaulede 2023-03-23T14:43:17Z experimental_condition_ontology XCO:0000998 controlled breathing condition This is any condition in which the main influencing factor is control of the process of breathing, whether by the control of the volume of air breathed or by control of the contents of the breathed air. This may be for the treatment of disease or for the experimental study of physiology or pathology. https://www.merriam-webster.com This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator. The controlled parameters may be volume, pressure, and/or air component content. slaulede 2023-03-23T14:49:38Z controlled mechanical ventilation experimental_condition_ontology XCO:0000999 mechanical ventilation This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator. The controlled parameters may be volume, pressure, and/or air component content. ISBN-13:978-0781733908 https://my.clevelandclinic.org/health/treatments/15368-mechanical-ventilation This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator with assist/control (A/C), meaning the breathing rate is set and the tidal volume or pressure is set. When the subject triggers a breath, a full set tidal volume (or pressure) breath is delivered. When the vent delivers a subject-triggered breath, the next breath is timed in relation to this. slaulede 2023-03-23T15:26:05Z A/C assist/control volume controlled ventilation volume-controlled ventilation with constant tidal volumes experimental_condition_ontology XCO:0001000 mechanical ventilation with assist/control This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator with assist/control (A/C), meaning the breathing rate is set and the tidal volume or pressure is set. When the subject triggers a breath, a full set tidal volume (or pressure) breath is delivered. When the vent delivers a subject-triggered breath, the next breath is timed in relation to this. ISBN-13:978-0781733908 https://ventbasics.com/modes/modes-overview/ This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator with synchronized intermittent mandatory ventilation, meaning the breathing rate is set and the tidal volume is set with pressure support. The subject receives a set minimum number of breaths (the set rate) and any additional breaths are determined by the subject. slaulede 2023-03-23T15:36:28Z SIMV experimental_condition_ontology XCO:0001001 synchronized intermittent mandatory ventilation This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator with synchronized intermittent mandatory ventilation, meaning the breathing rate is set and the tidal volume is set with pressure support. The subject receives a set minimum number of breaths (the set rate) and any additional breaths are determined by the subject. ISBN-13:978-0781733908 https://ventbasics.com/modes/modes-overview/ This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator using variable tidal volume, or variable pressure support, and/or variable respiratory rate. slaulede 2023-03-23T17:26:15Z mechanical ventilation with variable tidal volume experimental_condition_ontology XCO:0001002 variable ventilation This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator using variable tidal volume, or variable pressure support, and/or variable respiratory rate. ISBN-13:978-0781733908 PMID:26979175 This is any condition in which the main influencing factor is a magnetic field, a vector field in the neighborhood of a magnet, electric current, or changing electric field in which magnetic forces are observable. slaulede 2023-03-24T14:19:32Z PMID:24407149 experimental_condition_ontology XCO:0001003 magnetic field This is any condition in which the main influencing factor is a magnetic field, a vector field in the neighborhood of a magnet, electric current, or changing electric field in which magnetic forces are observable. https://byjus.com/physics/ https://www.merriam-webster.com This is any condition in which the main influencing factor is a uniform magnetic field. A uniform magnetic field may be generated by an apparatus such as a Halbach cylinder. A Halbach cylinder is a magnetized cylinder composed of ferromagnetic material which can produce a uniform magnetic field across a plate of cultured cells which is surrounded by the cylinder. slaulede 2023-03-24T14:51:33Z PMID:24407149 experimental_condition_ontology XCO:0001004 uniform magnetic field This is any condition in which the main influencing factor is a uniform magnetic field. A uniform magnetic field may be generated by an apparatus such as a Halbach cylinder. A Halbach cylinder is a magnetized cylinder composed of ferromagnetic material which can produce a uniform magnetic field across a plate of cultured cells which is surrounded by the cylinder. https://en.wikipedia.org/wiki/Halbach_array https://en.wikipedia.org/wiki/Magnetism This is any condition in which the main influencing factor is PIWIL1 (piwi-like RNA-mediated gene silencing 1) siRNA. The PIWIL1 protein may play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. The pSUPER plasmid was designed for eukaryotic expression/RNAi. slaulede 2023-03-28T17:14:00Z PIWIL1 siRNA transfection PMID:26104391 transfection of PIWIL1 siRNA using pSUPER plasmid experimental_condition_ontology XCO:0001005 transfer of PIWIL1 siRNA using pSUPER plasmid This is any condition in which the main influencing factor is PIWIL1 (piwi-like RNA-mediated gene silencing 1) siRNA. The PIWIL1 protein may play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. The pSUPER plasmid was designed for eukaryotic expression/RNAi. PMID:26104391 https://www.addgene.org This is any condition in which the main influencing factor is negative control siRNA delivered with a pSUPER plasmid. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental siRNA used. slaulede 2023-03-28T17:21:28Z negative control siRNA transfection scrambled siRNA transfection transfection of negative control siRNA using pSUPER plasmid experimental_condition_ontology XCO:0001006 transfer of negative control siRNA using pSUPER plasmid This is any condition in which the main influencing factor is negative control siRNA delivered with a pSUPER plasmid. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental siRNA used. PMID:26104391 https://www.addgene.org This is any condition in which the main influencing factor is negative control shRNA delivered with a lentivirus vector. Negative control shRNA is an shRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental shRNA used. slaulede 2023-03-31T11:00:04Z transduction of negative control shRNA using a lentivirus transduction of negative control shRNA using a lentivirus vector transfer of negative control shRNA using a lentiviral vector experimental_condition_ontology XCO:0001007 transfer of negative control shRNA using a lentivirus vector This is any condition in which the main influencing factor is negative control shRNA delivered with a lentivirus vector. Negative control shRNA is an shRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental shRNA used. PMID:31606248 https://www.origene.com/products/cdna-clones/lentiviral-particles/control-particles This is any condition in which the main influencing factor is Pum2 (pumilio RNA-binding family member 2) shRNA. Pum2 is a protein that exhibits lncRNA binding, miRNA binding, and mRNA 3'-UTR binding. Pum2 is involved in negative regulation of gene expression and regulation of intracellular mRNA localization. slaulede 2023-03-31T11:37:24Z transduction of Pum2 shRNA using a lentivirus transduction of Pum2 shRNA using a lentivirus vector transfer of Pum2 shRNA using a lentiviral vector experimental_condition_ontology XCO:0001008 transfer of Pum2 shRNA using a lentivirus vector This is any condition in which the main influencing factor is Pum2 (pumilio RNA-binding family member 2) shRNA. Pum2 is a protein that exhibits lncRNA binding, miRNA binding, and mRNA 3'-UTR binding. Pum2 is involved in negative regulation of gene expression and regulation of intracellular mRNA localization. PMID:31606248 https://blog.addgene.org This is any experimental condition in which the main influencing factor is M199 medium, which is useful across a wide range of species and applications but is particularly suitable for the culturing of non-transformed cells. M199 medium ingredients may include Earle’s salts and a bicarbonate/carbonic acid buffering system for the maintenance of pH in a CO2 incubator or Hank’s salts with salt solutions designed for atmospheric equilibrium. slaulede 2023-04-06T12:56:12Z PMID:31283468 M199 M199 media M199 medium Medium 199 experimental_condition_ontology XCO:0001009 Media 199 This is any experimental condition in which the main influencing factor is M199 medium, which is useful across a wide range of species and applications but is particularly suitable for the culturing of non-transformed cells. M199 medium ingredients may include Earle’s salts and a bicarbonate/carbonic acid buffering system for the maintenance of pH in a CO2 incubator or Hank’s salts with salt solutions designed for atmospheric equilibrium. https://www.thermofisher.com This is any experimental condition in which the main influencing factor is glutamine, an alpha-amino acid that consists of butyric acid bearing an amino substituent at position 2 and a carbamoyl substituent at position 4. Glutamine is used as a supplement in cell culture media. slaulede 2023-04-06T13:12:19Z CHEBI:28300 L-glutamine experimental_condition_ontology XCO:0001010 glutamine This is any experimental condition in which the main influencing factor is glutamine, an alpha-amino acid that consists of butyric acid bearing an amino substituent at position 2 and a carbamoyl substituent at position 4. Glutamine is used as a supplement in cell culture media. CHEBI:28300 https://www.merriam-webster.com This is any experimental condition in which the main influencing factor is a mixture of penicillin G and streptomycin (penicillin-streptomycin) that is widely used in mammalian cell culture media to prevent bacterial contamination. The solution contains 5,000 units of penicillin G (sodium salt) which acts as the active base, and 5,000 micrograms of streptomycin (sulfate) (base per milliliter), formulated in 0.85% saline. slaulede 2023-04-06T13:28:20Z PMID:31283468 Pen-Strep experimental_condition_ontology XCO:0001011 penicillin-streptomycin This is any experimental condition in which the main influencing factor is a mixture of penicillin G and streptomycin (penicillin-streptomycin) that is widely used in mammalian cell culture media to prevent bacterial contamination. The solution contains 5,000 units of penicillin G (sodium salt) which acts as the active base, and 5,000 micrograms of streptomycin (sulfate) (base per milliliter), formulated in 0.85% saline. https://en.wikipedia.org/wiki/Pen-Strep This is a condition in which the rat Rbpms (RNA binding protein, mRNA processing factor) gene has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of Rbpms in the recipient cell or organism. slaulede 2023-04-06T14:09:22Z gene transfer of rat Rbpms using a lentivirus vector gene transfer of the rat Rbpms gene using a lentiviral vector transduction of rat Rbpms using a lentiviral vector transduction of rat Rbpms using a lentivirus vector experimental_condition_ontology XCO:0001012 gene transfer of the rat Rbpms gene using a lentivirus vector This is a condition in which the rat Rbpms (RNA binding protein, mRNA processing factor) gene has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of Rbpms in the recipient cell or organism. PMID:31283468 https://www.merriam-webster.com This is any condition in which the main influencing factor is rat RBPMS (RNA binding protein, mRNA processing factor)-specific siRNA. This siRNA has been transferred into a cell or organism using a lentivirus carrier in order to block synthesis of RBPMS in the recipient cell or organism. slaulede 2023-04-06T14:34:10Z PMID:31283468 transduction of RBPMS siRNA using a lentivirus vector transfer of rat RBPMS short interfering RNA using a lentivirus vector transfer of rat RBPMS siRNA using a lentiviral vector transfer of rat RBPMS small interfering RNA using a lentivirus vector experimental_condition_ontology XCO:0001013 transfer of rat RBPMS siRNA using a lentivirus vector This is any condition in which the main influencing factor is rat RBPMS (RNA binding protein, mRNA processing factor)-specific siRNA. This siRNA has been transferred into a cell or organism using a lentivirus carrier in order to block synthesis of RBPMS in the recipient cell or organism. PMID:31283468 https://en.wikipedia.org/wiki/Small_interfering_RNA This is any condition in which the main influencing factor is negative control siRNA delivered with a lentivirus vector. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental siRNA used. slaulede 2023-04-06T14:42:17Z transduction of negative control siRNA using a lentivirus transduction of negative control siRNA using a lentivirus vector transfer of negative control siRNA using a lentivirus experimental_condition_ontology XCO:0001014 transfer of negative control siRNA using a lentiviral vector This is any condition in which the main influencing factor is negative control siRNA delivered with a lentivirus vector. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental siRNA used. PMID:31283468 https://www.origene.com/products/cdna-clones/lentiviral-particles/control-particles This is any condition in which the main influencing factor is creating a volumetric muscle loss (VML) of 20% or more of the total amount of mass in the targeted muscle through surgical removal (myectomy). slaulede 2023-04-06T16:01:25Z PMID:29531830 experimental_condition_ontology XCO:0001015 myectomy This is any condition in which the main influencing factor is creating a volumetric muscle loss (VML) of 20% or more of the total amount of mass in the targeted muscle through surgical removal (myectomy). PMID:34146835 https://study.com/ This is any condition in which the main influencing factor is implantation of a minced muscle graft. It is a surgical procedure intended to induce healing of a skeletal muscle injured by volumetric muscle loss. slaulede 2023-04-06T16:32:30Z PMID:29531830 MMG autologous minced muscle graft experimental_condition_ontology XCO:0001016 minced muscle graft This is any condition in which the main influencing factor is implantation of a minced muscle graft. It is a surgical procedure intended to induce healing of a skeletal muscle injured by volumetric muscle loss. PMID:29531830 This is a bitter crystalline alkaloid C17H21NO4 obtained from coca leaves that is used especially in the form of its hydrochloride medically as a topical anesthetic and illicitly for its euphoric effects and that may result in a compulsive psychological need. slaulede 2023-04-27T12:51:11Z CHEBI:27958 MESH:D003042 (1R,2R,3S,5S)-2-(methoxycarbonyl)tropan-3-yl benzoate experimental_condition_ontology XCO:0001017 cocaine This is a bitter crystalline alkaloid C17H21NO4 obtained from coca leaves that is used especially in the form of its hydrochloride medically as a topical anesthetic and illicitly for its euphoric effects and that may result in a compulsive psychological need. https://www.merriam-webster.com This is an organic heterotricyclic compound that is 5-methyl-3-(morpholin-4-ylmethyl)-2,3-dihydro[1,4]oxazino[2,3,4-hi]indole substituted at position 6 by a 1-naphthylcarbonyl group. slaulede 2023-04-27T13:02:47Z MESH:C070417 WIN 55,212 [(3R)-5-methyl-3-(morpholin-4-ylmethyl)-2,3-dihydro[1,4]oxazino[2,3,4-hi]indol-6-yl](1-naphthyl)methanone experimental_condition_ontology XCO:0001018 WIN 55,212-2 This is an organic heterotricyclic compound that is 5-methyl-3-(morpholin-4-ylmethyl)-2,3-dihydro[1,4]oxazino[2,3,4-hi]indole substituted at position 6 by a 1-naphthylcarbonyl group. CHEBI:73295 This is any condition in which the main influencing factor is olanzapine, a benzodiazepine derivative that binds SEROTONIN RECEPTORS; MUSCARINIC RECEPTORS; HISTAMINE H1 RECEPTORS; ADRENERGIC ALPHA-1 RECEPTORS; and DOPAMINE RECEPTORS. It is an antipsychotic agent used in the treatment of SCHIZOPHRENIA; BIPOLAR DISORDER; and MAJOR DEPRESSIVE DISORDER; it may also reduce nausea and vomiting in patients undergoing chemotherapy. slaulede 2023-05-02T13:01:59Z CHEBI:7735 MESH:D000077152 2-methyl-4-(4-methylpiperazin-1-yl)-10H-thieno[2,3-b][1,5]benzodiazepine experimental_condition_ontology XCO:0001019 olanzapine This is any condition in which the main influencing factor is olanzapine, a benzodiazepine derivative that binds SEROTONIN RECEPTORS; MUSCARINIC RECEPTORS; HISTAMINE H1 RECEPTORS; ADRENERGIC ALPHA-1 RECEPTORS; and DOPAMINE RECEPTORS. It is an antipsychotic agent used in the treatment of SCHIZOPHRENIA; BIPOLAR DISORDER; and MAJOR DEPRESSIVE DISORDER; it may also reduce nausea and vomiting in patients undergoing chemotherapy. MESH:D000077152 This is any condition in which the main influencing factor is docosahexaenoic acid, a C22 polyunsaturated fatty acid containing six double bonds. slaulede 2023-05-02T13:31:17Z CHEBI:36005 DHA cervonic acid experimental_condition_ontology XCO:0001020 docosahexaenoic acid This is any condition in which the main influencing factor is docosahexaenoic acid, a C22 polyunsaturated fatty acid containing six double bonds. CHEBI:36005 This is any condition in which the main influencing factor is a solid diet in which the amount of docosahexaenoic acid, a C22 polyunsaturated fatty acid containing six double bonds, is maintained at a specified level. slaulede 2023-05-02T13:37:56Z CHEBI:36005 PMID:27322469 controlled DHA content diet experimental_condition_ontology XCO:0001021 controlled docosahexaenoic acid content diet This is any condition in which the main influencing factor is a solid diet in which the amount of docosahexaenoic acid, a C22 polyunsaturated fatty acid containing six double bonds, is maintained at a specified level. CHEBI:36005 This is any condition in which the main influencing factor is flaxseed oil, an edible oil in demand as a dietary supplement, as a source of &#945;-Linolenic acid, an omega-3 fatty acid. slaulede 2023-05-02T13:50:29Z flax oil linseed oil experimental_condition_ontology XCO:0001022 flaxseed oil This is any condition in which the main influencing factor is flaxseed oil, an edible oil in demand as a dietary supplement, as a source of &#945;-Linolenic acid, an omega-3 fatty acid. https://en.wikipedia.org/wiki/Linseed_oil This is any condition in which the main influencing factor is a solid diet in which the amount of flaxseed oil, an edible oil rich in &#945;-Linolenic acid (an omega-3 fatty acid), is maintained at a specified level. slaulede 2023-05-02T13:57:19Z PMID:27322469 controlled flaxs oil content diet controlled linseed oil content diet experimental_condition_ontology XCO:0001023 controlled flaxseed oil content diet This is any condition in which the main influencing factor is a solid diet in which the amount of flaxseed oil, an edible oil rich in &#945;-Linolenic acid (an omega-3 fatty acid), is maintained at a specified level. https://en.wikipedia.org/wiki/Linseed_oil This is any condition in which the main influencing factor is BNTA, a small molecule with ECM modulatory and anti-inflammatory properties that is a potential therapeutic agent for osteoarthritis. slaulede 2023-05-09T14:19:20Z CID:2819453 N-(2-bromo-4-(phenylsulfonyl)thiophen-3-yl)-2-chlorobenzamide N-[2-bromo-4-(phenylsulfonyl)-3-thienyl]-2-chlorobenzamide N-[4-(benzenesulfonyl)-2-bromothiophen-3-yl]-2-chlorobenzamide experimental_condition_ontology XCO:0001024 BNTA This is any condition in which the main influencing factor is BNTA, a small molecule with ECM modulatory and anti-inflammatory properties that is a potential therapeutic agent for osteoarthritis. PMID:31015473 This is any condition in which the main influencing factor is UNC0638, a histone methyltransferase Inhibitor that is a trial drug for cancer. slaulede 2023-05-09T15:04:55Z PMID:26551542 2-Cyclohexyl-N-(1-isopropylpiperidin-4-yl)-6-methoxy-7-(3-(pyrrolidin-1-yl)propoxy)quinazolin-4-amine DNA MTase Inhibitor III DNA Methyltransferase Inhibitor III EHMT1/GLP Inhibitor II EHMT2/G9a Inhibitor IV HMTase Inhibitor IV experimental_condition_ontology XCO:0001025 UNC0638 This is any condition in which the main influencing factor is UNC0638, a histone methyltransferase Inhibitor that is a trial drug for cancer. https://www.sigmaaldrich.com/US/en/product/mm/382192 This is any condition in which the main influencing factor is the ligation of one or more segmental spinal nerves at a point before the spinal nerve joins a common nerve (most commonly: ligation of L5 and/or L6 nerves which, with L4, make up the sciatic nerve in rats). This is a model of chronic neuropathic pain. slaulede 2023-05-09T16:38:20Z SNL experimental_condition_ontology Chung model SNL model XCO:0001026 spinal nerve ligation This is any condition in which the main influencing factor is the ligation of one or more segmental spinal nerves at a point before the spinal nerve joins a common nerve (most commonly: ligation of L5 and/or L6 nerves which, with L4, make up the sciatic nerve in rats). This is a model of chronic neuropathic pain. PMID:1333581 https://link.springer.com/referenceworkentry/10.1007/978-3-540-29805-2_2683 This is a condition in which the Rpl10a (ribosomal protein L10A) gene has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of Rpl10a in the recipient cell or organism. slaulede 2023-05-11T15:08:39Z gene transfer of Rpl10a using a lentivirus vector transduction of Rpl10a using a lentiviral vector transduction of ribosomal protein L10A using a lentiviral vector transduction of ribosomal protein L10A using a lentivirus vector experimental_condition_ontology XCO:0001027 gene transfer of the Rpl10a gene using a lentivirus vector This is a condition in which the Rpl10a (ribosomal protein L10A) gene has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of Rpl10a in the recipient cell or organism. PMID:31825308 https://www.merriam-webster.com This is a condition in which the enhanced yellow fluorescent protein (EYFP) gene has been (transiently or stably) transferred into a cell or organism using an lentivirus carrier in order to induce synthesis of EYFP in the recipient cell or organism. slaulede 2023-05-11T15:33:38Z gene transduction of the enhanced yellow fluorescent protein gene using a lentivirus vector gene transfer of the EYFP gene using a lentiviral vector lentiviral transfer of the EYFP gene transduction of recombinant lentivirus containing the EYFP gene transfer of recombinant lentivirus containing the EYFP gene experimental_condition_ontology XCO:0001028 gene transfer of the EYFP gene using a lentivirus vector This is a condition in which the enhanced yellow fluorescent protein (EYFP) gene has been (transiently or stably) transferred into a cell or organism using an lentivirus carrier in order to induce synthesis of EYFP in the recipient cell or organism. PMID:31825308 https://www.merriam-webster.com This is a condition in which the Rpl10a (ribosomal protein L10A) gene and enhanced yellow fluorescent protein (EYFP) gene have been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of both rat wild type cyclin Y and EGFP in the recipient cell or organism. slaulede 2023-05-11T15:56:41Z lentiviral transfer of the Rpl10a gene and the EYFP gene transduction of recombinant lentivirus containing the Rpl10a gene and the EYFP gene transfer of recombinant lentivirus containing the Rpl10a gene and the EYFP gene experimental_condition_ontology XCO:0001029 gene transfer of the Rpl10a gene and EYFP gene using a lentivirus vector This is a condition in which the Rpl10a (ribosomal protein L10A) gene and enhanced yellow fluorescent protein (EYFP) gene have been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of both rat wild type cyclin Y and EGFP in the recipient cell or organism. PMID:31825308 https://www.merriam-webster.com This is any condition in which the main influencing factor is acupuncture, a technique in which practitioners insert fine needles into the skin to treat health problems. The needles may be manipulated manually or stimulated with small electrical currents (electroacupuncture). Acupuncture has been in use in some form for at least 2,500 years. slaulede 2023-05-12T14:51:55Z MESH:D015670 acupotomy acupuncture treatment pharmacoacupuncture therapy pharmacoacupuncture treatment experimental_condition_ontology XCO:0001030 acupuncture This is any condition in which the main influencing factor is acupuncture, a technique in which practitioners insert fine needles into the skin to treat health problems. The needles may be manipulated manually or stimulated with small electrical currents (electroacupuncture). Acupuncture has been in use in some form for at least 2,500 years. https://www.nccih.nih.gov/health/acupuncture-what-you-need-to-know This is any condition in which the main influencing factor is electroacupuncture, a form of acupuncture where a small electric current is passed between pairs of acupuncture needles. According to some acupuncturists, this practice augments the use of regular acupuncture, can restore health and well-being, and is particularly good for treating pain. slaulede 2023-05-12T14:58:31Z MESH:D015671 PMID:24722278 electro-acupuncture experimental_condition_ontology XCO:0001031 electroacupuncture This is any condition in which the main influencing factor is electroacupuncture, a form of acupuncture where a small electric current is passed between pairs of acupuncture needles. According to some acupuncturists, this practice augments the use of regular acupuncture, can restore health and well-being, and is particularly good for treating pain. https://en.wikipedia.org/wiki/Electroacupuncture This is any condition in which the main influencing factor is neural progenitor cells, which are isolated from embryonic or fetal CNS tissue and can be expanded in culture for prolonged periods using genetic or epigenetic approaches. Expanded cells have the capacity to differentiate into neurons, oligodendrocytes, or astrocytes. slaulede 2023-05-18T14:23:53Z hNPCs experimental_condition_ontology XCO:0001032 human neural progenitor cells This is any condition in which the main influencing factor is neural progenitor cells, which are isolated from embryonic or fetal CNS tissue and can be expanded in culture for prolonged periods using genetic or epigenetic approaches. Expanded cells have the capacity to differentiate into neurons, oligodendrocytes, or astrocytes. PMID:18341406 This is any condition in which the main influencing factor is a balanced salt solution-based medium for the delivery of a suspension of cells. slaulede 2023-05-18T14:35:36Z BSS cell carrying medium experimental_condition_ontology XCO:0001033 balanced salt solution cell carrying medium This is any condition in which the main influencing factor is a balanced salt solution-based medium for the delivery of a suspension of cells. PMID:27217715 This is any condition in which the main influencing factor is hawk tea extract (HTE), a potential cholesterol-lowering agent and antioxidant. Hawk tea is a medicinal herbal and caffeine-free drink popular in China. slaulede 2023-05-19T13:15:55Z HTE Litsea coreana Levl. var. lanuginose extract Litsea coreana extract experimental_condition_ontology XCO:0001034 hawk tea extract This is any condition in which the main influencing factor is hawk tea extract (HTE), a potential cholesterol-lowering agent and antioxidant. Hawk tea is a medicinal herbal and caffeine-free drink popular in China. PMID:31098406 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of hawk tea extract consumed by an organism as part of an experiment. Hawk tea extract is a potential cholesterol-lowering agent and antioxidant. Hawk tea is a traditional herbal and caffeine-free drink popular in China. slaulede 2023-05-19T13:25:24Z PMID:23618259 controlled Litsea coreana extract content drinking water controlled hawk tea extract content drinking water experimental_condition_ontology XCO:0001035 controlled HTE content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of hawk tea extract consumed by an organism as part of an experiment. Hawk tea extract is a potential cholesterol-lowering agent and antioxidant. Hawk tea is a traditional herbal and caffeine-free drink popular in China. PMID:31098406 This is any condition in which the major influencing factor is the peptide (TESPFKNTEISFKLGQEFEETTADNR) representing residues 53 to 78 of peripheral myelin protein 2, a fatty acid and cholesterol binding protein which together with myelin basic protein constitutes a major fraction of the peripheral nervous system myelin proteins. slaulede 2023-05-19T13:48:55Z Pmp2 peptide 53-78 TESPFKNTEISFKLGQEFEETTADNR experimental_condition_ontology XCO:0001036 peripheral myelin protein 2 peptide 53-78 This is any condition in which the major influencing factor is the peptide (TESPFKNTEISFKLGQEFEETTADNR) representing residues 53 to 78 of peripheral myelin protein 2, a fatty acid and cholesterol binding protein which together with myelin basic protein constitutes a major fraction of the peripheral nervous system myelin proteins. PMID:31344254 This is any condition in which the main influencing factor is Mycobacterium tuberculosis H37Ra (a high G+C gram-positive bacteria) introduced externally or internally, alive or dead, to a subject to effect a change in phenotype of the subject. Mycobacterium tuberculosis H37Ra is an avirulent strain derived from its virulent parent strain H37. slaulede 2023-05-19T14:35:05Z ATCC:25177 PMID:31344254 UniProt:419947 MYCTA Mycobacterium tuberculosis ATCC 25177 Mycobacterium tuberculosis strain H37Ra experimental_condition_ontology XCO:0001037 Mycobacterium tuberculosis H37Ra This is any condition in which the main influencing factor is Mycobacterium tuberculosis H37Ra (a high G+C gram-positive bacteria) introduced externally or internally, alive or dead, to a subject to effect a change in phenotype of the subject. Mycobacterium tuberculosis H37Ra is an avirulent strain derived from its virulent parent strain H37. NCBI:txid419947 https://www.ebi.ac.uk/ena/browser/view/GCA_000016145.1 This is any condition in which the main influencing factor is PBS-filled liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and containing phosphate buffered saline. slaulede 2023-05-19T16:16:35Z PBS containing liposomes PBS-liposomes phosphate buffered saline-filled liposomes experimental_condition_ontology XCO:0001038 PBS-filled liposomes This is any condition in which the main influencing factor is PBS-filled liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and containing phosphate buffered saline. PMID:30485549 This is any condition in which the main influencing factor is clodronate-filled liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and containing clodronate. slaulede 2023-05-19T16:23:46Z http://clodronateliposomes.com/ clodronate containing liposomes clodronate liposomes experimental_condition_ontology XCO:0001039 Clodronate-filled liposomes This is any condition in which the main influencing factor is clodronate-filled liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and containing clodronate. PMID:30485549 This is any condition in which the main influencing factor is (R)-lipoic acid, the (R)-enantiomer of lipoic acid. Lipoic acid is a vitamin-like, C8 thia fatty acid with anti-oxidant properties. slaulede 2023-05-23T16:56:01Z MESH:D008063 PMID:24104204 R-&#945;-lipoic acid experimental_condition_ontology XCO:0001040 (R)-lipoic acid This is any condition in which the main influencing factor is (R)-lipoic acid, the (R)-enantiomer of lipoic acid. Lipoic acid is a vitamin-like, C8 thia fatty acid with anti-oxidant properties. CHEBI:30314 This is any condition in which the main influencing factor is an experimental surgical procedure involving laminectomy and delivery of a controlled contusion of the spinal cord by a mechanical apparatus. slaulede 2023-05-26T10:20:43Z spinal cord injury PMID:15629760 PMID:28106101 experimental_condition_ontology XCO:0001041 experimental spinal cord contusion This is any condition in which the main influencing factor is an experimental surgical procedure involving laminectomy and delivery of a controlled contusion of the spinal cord by a mechanical apparatus. PMID:15629760 This is any condition in which the main influencing factor is an experimental surgical procedure involving laminectomy of the ninth thoracic vertebra and delivery of a controlled contusion of the spinal cord by a mechanical apparatus. slaulede 2023-05-26T10:31:57Z spinal cord injury at the ninth thoracic vertebra spinal cord injury at T9 spinal cord contusion at T9 experimental_condition_ontology XCO:0001042 T9 spinal cord contusion This is any condition in which the main influencing factor is an experimental surgical procedure involving laminectomy of the ninth thoracic vertebra and delivery of a controlled contusion of the spinal cord by a mechanical apparatus. PMID:15629760 This is any condition in which the main influencing factor is surgical removal of the lamina (dorsal part of vertebra) of one or more vertebrae. This procedure can serve as sham condition for a spinal cord contusion study. slaulede 2023-05-26T10:55:47Z PMID:15629760 dorsal laminectomy surgical removal of vertebral lamina experimental_condition_ontology XCO:0001043 laminectomy This is any condition in which the main influencing factor is surgical removal of the lamina (dorsal part of vertebra) of one or more vertebrae. This procedure can serve as sham condition for a spinal cord contusion study. PMID:15629760 https://www.mayoclinic.org/tests-procedures/laminectomy/about/pac-20394533 This is any condition in which the main influencing factor is surgical removal of the lamina (dorsal part of vertebra) of the ninth thoracic vertebra. slaulede 2023-05-26T11:29:44Z PMID:15629760 surgical removal of the lamina of the ninth thoracic vertebra experimental_condition_ontology XCO:0001044 T9 laminectomy This is any condition in which the main influencing factor is surgical removal of the lamina (dorsal part of vertebra) of the ninth thoracic vertebra. PMID:15629760 https://www.mayoclinic.org/tests-procedures/laminectomy/about/pac-20394533 This is any condition in which the main influencing factor is Walker 256, a rat mammary gland carcinoma cell line. slaulede 2023-05-26T12:12:33Z Cellosaurus:CVCL_3537 PMID:32209134 LLC-WRC 256 cells W256 cells experimental_condition_ontology XCO:0001045 Walker 256 cells This is any condition in which the main influencing factor is Walker 256, a rat mammary gland carcinoma cell line. https://www.atcc.org/products/ccl-38 https://www.merriam-webster.com This is any condition in which the main influencing factor is a Dnmt3a gapmer (Dnmt3a-targeting antisense oligonucleotide). Gapmers are mRNA-targeting, short DNA antisense oligonucleotide structures with RNA-like segments on both sides of the sequence. slaulede 2023-06-01T15:19:05Z PMID:30354815 DNA methyltransferase 3 alpha GapmeR DNA methyltransferase 3 alpha gapmer antisense oligonucleotide Dnmt3a GapmeR experimental_condition_ontology XCO:0001046 Dnmt3a gapmer antisense oligonucleotide This is any condition in which the main influencing factor is a Dnmt3a gapmer (Dnmt3a-targeting antisense oligonucleotide). Gapmers are mRNA-targeting, short DNA antisense oligonucleotide structures with RNA-like segments on both sides of the sequence. https://en.wikipedia.org/wiki/Gapmer This is any condition in which the main influencing factor is a Tet3 gapmer (Tet3-targeting antisense oligonucleotide). Gapmers are mRNA-targeting, short DNA antisense oligonucleotide structures with RNA-like segments on both sides of the sequence. slaulede 2023-06-01T15:28:16Z PMID:30354815 Tet3 GapmeR tet methylcytosine dioxygenase 3 GapmeR tet methylcytosine dioxygenase 3 gapmer antisense oligonucleotide experimental_condition_ontology XCO:0001047 Tet3 gapmer antisense oligonucleotide This is any condition in which the main influencing factor is a Tet3 gapmer (Tet3-targeting antisense oligonucleotide). Gapmers are mRNA-targeting, short DNA antisense oligonucleotide structures with RNA-like segments on both sides of the sequence. https://en.wikipedia.org/wiki/Gapmer This is any condition in which the main influencing factor is a negative control gapmer. A negative control gapmer is a gapmer with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental gapmer used. slaulede 2023-06-01T15:36:36Z PMID:30354815 SCR GapmeR control GapmeR scrambled GapmeR scrambled GapmeR antisense oligonucleotide experimental_condition_ontology XCO:0001048 scrambled gapmer antisense oligonucleotide This is any condition in which the main influencing factor is a negative control gapmer. A negative control gapmer is a gapmer with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental gapmer used. PMID:30354815 https://en.wikipedia.org/wiki/Gapmer This is any condition in which the main influencing factor is nicotine, a highly toxic alkaloid. Nicotine is a racemate composed of equimolar amounts of (R)- and (S)-nicotine. It is the prototypical agonist at nicotinic cholinergic receptors where it dramatically stimulates neurons and ultimately blocks synaptic transmission. slaulede 2023-06-01T17:01:56Z PMID:23874651 (R,S)-nicotine (RS)-nicotine rac-3-(1-methylpyrrolidin-2-yl)pyridine experimental_condition_ontology XCO:0001049 nicotine This is any condition in which the main influencing factor is nicotine, a highly toxic alkaloid. Nicotine is a racemate composed of equimolar amounts of (R)- and (S)-nicotine. It is the prototypical agonist at nicotinic cholinergic receptors where it dramatically stimulates neurons and ultimately blocks synaptic transmission. CHEBI:18723 MESH:D009538 This is any condition in which the main influencing factor is surgical removal of the lamina (dorsal part of vertebra) from both the eighth and the ninth thoracic vertebrae. slaulede 2023-06-02T14:15:42Z PMID:26546062 surgical removal of the lamina of the eighth and ninth thoracic vertebrae experimental_condition_ontology XCO:0001050 T8/T9 laminectomy This is any condition in which the main influencing factor is surgical removal of the lamina (dorsal part of vertebra) from both the eighth and the ninth thoracic vertebrae. PMID:26546062 https://www.mayoclinic.org/tests-procedures/laminectomy/about/pac-20394533 This is any condition in which the main influencing factor is a solid diet in which the amount of soy protein isolate, usually containing 85%–90% protein (dry basis), is maintained at a specified level. Soy protein isolates (SPI) are prepared by separating the fibers and insoluble carbohydrates from soy protein concentrate. slaulede 2023-06-06T15:19:14Z controlled SPI content diet experimental_condition_ontology XCO:0001051 controlled soy protein isolate content diet This is any condition in which the main influencing factor is a solid diet in which the amount of soy protein isolate, usually containing 85%–90% protein (dry basis), is maintained at a specified level. Soy protein isolates (SPI) are prepared by separating the fibers and insoluble carbohydrates from soy protein concentrate. https://www.sciencedirect.com/topics/agricultural-and-biological-sciences/soy-protein-isolate This is any condition in which the main influencing factor is a 2'-deoxyribonucleoside that has formula C8H12N4O4. 5-aza-2&#8242;-deoxycytidine is a chemotherapeutic pyrimidine nucleoside analogue that integrates into cellular DNA and inhibits the action of DNA methyltransferases. slaulede 2023-06-19T13:59:50Z PMID:37288607 2'-Deoxy-5-azacytidine 4-amino-1-(2-deoxy-beta-D-erythro-pentofuranosyl)-1,3,5-triazin-2(1H)-one 5-AzaD 5AzadC Dacogen decitabine experimental_condition_ontology XCO:0001052 5-aza-2&#8242;-deoxycytidine This is any condition in which the main influencing factor is a 2'-deoxyribonucleoside that has formula C8H12N4O4. 5-aza-2&#8242;-deoxycytidine is a chemotherapeutic pyrimidine nucleoside analogue that integrates into cellular DNA and inhibits the action of DNA methyltransferases. CID:451668 https://go.drugbank.com/drugs/DB01262 This is any condition in which the main influencing factor is closure of a wound, body parts, or anatomical orifices by the use of sutures, staples, or surgical adhesive/sealant. slaulede 2023-06-20T15:13:05Z GEO:GSE72787 surgical gluing surgical stapling surgical suturing experimental_condition_ontology XCO:0001053 surgical closure This is any condition in which the main influencing factor is closure of a wound, body parts, or anatomical orifices by the use of sutures, staples, or surgical adhesive/sealant. https://www.merriam-webster.com https://www.sciencedirect.com/topics/medicine-and-dentistry/surgical-glue This is any condition in which the main influencing factor is Qingda granule, derived from Qingxuan Jiangya Decoction (QXJYD), which has been in usage for a long time as a traditional Chinese medicine formula. slaulede 2023-06-20T16:42:57Z GEO:GSE144548 QDG Qingda granules experimental_condition_ontology XCO:0001054 Qingda granule This is any condition in which the main influencing factor is Qingda granule, derived from Qingxuan Jiangya Decoction (QXJYD), which has been in usage for a long time as a traditional Chinese medicine formula. PMID:32199989 This is any condition in which the main influencing factor is luteolin, a tetrahydroxyflavone in which the four hydroxy groups are located at positions 3', 4', 5 and 7. It is thought to play an important role in the human body as an antioxidant, a free radical scavenger, an anti-inflammatory agent and an immune system modulator as well as being active against several cancers. Luteolin is a common flavonoid abundantly present in several plant products, including broccoli, pepper, thyme, and celery. slaulede 2023-06-22T14:33:16Z CHEBI:15864 MESH:D047311 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one 3',4',5,7-Tetrahydroxyflavone experimental_condition_ontology XCO:0001055 luteolin This is any condition in which the main influencing factor is luteolin, a tetrahydroxyflavone in which the four hydroxy groups are located at positions 3', 4', 5 and 7. It is thought to play an important role in the human body as an antioxidant, a free radical scavenger, an anti-inflammatory agent and an immune system modulator as well as being active against several cancers. Luteolin is a common flavonoid abundantly present in several plant products, including broccoli, pepper, thyme, and celery. CHEBI:15864 https://www.sciencedirect.com/topics/pharmacology-toxicology-and-pharmaceutical-science/luteolin This is any condition in which the main influencing factor is methylglyoxal, a 2-oxo aldehyde derived from propanal. Methylglyoxal is an organic compound used often as a reagent in organic synthesis, as a flavoring agent, in tanning and as an experimental antidepressant. It has been demonstrated as an intermediate in the metabolism of acetone and its derivatives in isolated cell preparations, in various culture media, and in vivo in certain animals. slaulede 2023-06-22T14:51:02Z GEO:GSE119482 2-Oxopropanal MGO pyruvaldehyde experimental_condition_ontology XCO:0001056 methylglyoxal This is any condition in which the main influencing factor is methylglyoxal, a 2-oxo aldehyde derived from propanal. Methylglyoxal is an organic compound used often as a reagent in organic synthesis, as a flavoring agent, in tanning and as an experimental antidepressant. It has been demonstrated as an intermediate in the metabolism of acetone and its derivatives in isolated cell preparations, in various culture media, and in vivo in certain animals. CHEBI:17158 MESH:D011765 This is any condition in which the main influencing factor is corticosterone, a 21-carbon adrenocortical steroid hormone that has modest but significant activities as both a mineralocorticoid and a glucocorticoid. slaulede 2023-06-23T14:29:08Z CHEBI:16827 11beta,21-dihydroxypregn-4-ene-3,20-dione experimental_condition_ontology XCO:0001057 corticosterone This is any condition in which the main influencing factor is corticosterone, a 21-carbon adrenocortical steroid hormone that has modest but significant activities as both a mineralocorticoid and a glucocorticoid. ISBN:978-1455756438 MESH:D003345 This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of corticosterone in which the amount of corticosterone consumed is maintained at a specified level. slaulede 2023-06-23T14:40:29Z CHEBI:16827 experimental_condition_ontology XCO:0001058 controlled corticosterone content drinking water This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of corticosterone in which the amount of corticosterone consumed is maintained at a specified level. MESH:D003345 https://www.merriam-webster.com This is any condition in which the main influencing factor is a drink made up of saline (0.9% sodium chloride solution) and a specified amount of one or more solutes. slaulede 2023-06-23T14:54:26Z PMID:30364965 controlled content 0.9% sodium chloride drink controlled content drinking saline controlled content normal saline drink experimental_condition_ontology XCO:0001059 controlled content saline drink This is any condition in which the main influencing factor is a drink made up of saline (0.9% sodium chloride solution) and a specified amount of one or more solutes. ISBN:978-1455756438 https://www.merriam-webster.com This is any condition in which the main influencing factor is a drink made up of normal saline (0.9% sodium chloride) and a specified amount of corticosterone in which the amount of corticosterone consumed is maintained at a specified level. slaulede 2023-06-23T15:03:59Z PMID:30364965 controlled corticosterone content 0.9% sodium chloride drink controlled corticosterone content normal saline drink experimental_condition_ontology XCO:0001060 controlled corticosterone content saline drink This is any condition in which the main influencing factor is a drink made up of normal saline (0.9% sodium chloride) and a specified amount of corticosterone in which the amount of corticosterone consumed is maintained at a specified level. ISBN:978-1455756438 https://www.merriam-webster.com This is any condition in which the main influencing factor is an oligosaccharide, a compound in which a small number of monosaccharide units (2-10) are joined by alpha- or beta-glycosidic linkages. slaulede 2023-06-23T15:27:30Z CHEBI:50699 MESH:D009844 oligosaccharides experimental_condition_ontology XCO:0001061 oligosaccharide This is any condition in which the main influencing factor is an oligosaccharide, a compound in which a small number of monosaccharide units (2-10) are joined by alpha- or beta-glycosidic linkages. ISBN:978-1455756438 MESH:D009844 This is any condition in which the main influencing factor is 2-hydroxypropyl-&#946;-cyclodextrin, a hydroxypropyl-substituted heptasaccharide made up of a ring of seven glucose subunits joined by &#945;-1,4 glycosidic bonds. slaulede 2023-06-23T15:43:12Z CHEBI:495055 MESH:C031215 2 Hydroxylpropyl beta cyclodextrin 2-Hydroxylpropyl-beta-cyclodextrin HP&#946;CD HP-beta-CD experimental_condition_ontology XCO:0001062 2-hydroxypropyl-&#946;-cyclodextrin This is any condition in which the main influencing factor is 2-hydroxypropyl-&#946;-cyclodextrin, a hydroxypropyl-substituted heptasaccharide made up of a ring of seven glucose subunits joined by &#945;-1,4 glycosidic bonds. https://en.wikipedia.org/wiki/Cyclodextrin This is any condition in which the main influencing factor is the surgical excision of the pineal body, a midline, cone-like structure located in the dorso-caudal roof of the 3rd ventricle, attached by peduncles to the habenular and posterior commissures. slaulede 2023-06-26T17:12:25Z experimental_condition_ontology XCO:0001063 pinealectomy This is any condition in which the main influencing factor is the surgical excision of the pineal body, a midline, cone-like structure located in the dorso-caudal roof of the 3rd ventricle, attached by peduncles to the habenular and posterior commissures. UBERON:0001905 https://www.merriam-webster.com This is any condition in which the main influencing factor is a 5/6 nephrectomy, which is an experimental procedure performed to produce an animal model of chronic kidney disease in rodents. Typically, the right kidney is removed and the poles of the left kidney are removed to produce a total renal system which is 1/6 of original capacity. The animal is typically allowed to recover for a week between the total and partial nephrectomy. slaulede 2023-06-26T18:07:22Z PMID:28760335 5/6 Nx five-sixths partial nephrectomy subtotal 5/6 nephrectomy subtotal nephrectomy two-step subtotal nephrectomy experimental_condition_ontology XCO:0001064 5/6 nephrectomy This is any condition in which the main influencing factor is a 5/6 nephrectomy, which is an experimental procedure performed to produce an animal model of chronic kidney disease in rodents. Typically, the right kidney is removed and the poles of the left kidney are removed to produce a total renal system which is 1/6 of original capacity. The animal is typically allowed to recover for a week between the total and partial nephrectomy. ISBN:978-1455756438 PMID:32001792 This is any condition in which the main influencing factor is a control locked nucleic acid (LNA)–modified oligonucleotide with a non-specific scrambled sequence. A locked nucleic acid (LNA), also known as bridged nucleic acid (BNA), and often referred to as inaccessible RNA, is a modified RNA nucleotide in which the ribose moiety is modified with an extra bridge connecting the 2' oxygen and 4' carbon. LNAs provide structural stability and nuclease resistance to the oligonucleotide. slaulede 2023-06-27T13:16:05Z PMID:28760335 scrambled control BNA oligonucleotide scrambled control LNA oligonucleotide scrambled control locked nucleic acid oligonucleotide experimental_condition_ontology XCO:0001065 scrambled control LNA-modified oligonucleotide This is any condition in which the main influencing factor is a control locked nucleic acid (LNA)–modified oligonucleotide with a non-specific scrambled sequence. A locked nucleic acid (LNA), also known as bridged nucleic acid (BNA), and often referred to as inaccessible RNA, is a modified RNA nucleotide in which the ribose moiety is modified with an extra bridge connecting the 2' oxygen and 4' carbon. LNAs provide structural stability and nuclease resistance to the oligonucleotide. https://en.wikipedia.org/wiki/Locked_nucleic_acid https://www.idtdna.com/pages/technology/custom-dna-rna/locked-nucleic-acids This is any condition in which the main influencing factor is a control locked nucleic acid (LNA)–modified oligonucleotide with an anti–rat miR-21-5p sequence. A locked nucleic acid (LNA), also known as bridged nucleic acid (BNA), and often referred to as inaccessible RNA, is a modified RNA nucleotide in which the ribose moiety is modified with an extra bridge connecting the 2' oxygen and 4' carbon. LNAs provide structural stability and nuclease resistance to the oligonucleotide. slaulede 2023-06-27T14:04:55Z PMID:28760335 BNA-modified anti-rno-miR-21-5p oligonucleotide LNA-modified anti-microRNA-21-5p oligonucleotide experimental_condition_ontology XCO:0001066 LNA-modified anti-rno-miR-21-5p oligonucleotide This is any condition in which the main influencing factor is a control locked nucleic acid (LNA)–modified oligonucleotide with an anti–rat miR-21-5p sequence. A locked nucleic acid (LNA), also known as bridged nucleic acid (BNA), and often referred to as inaccessible RNA, is a modified RNA nucleotide in which the ribose moiety is modified with an extra bridge connecting the 2' oxygen and 4' carbon. LNAs provide structural stability and nuclease resistance to the oligonucleotide. https://en.wikipedia.org/wiki/Locked_nucleic_acid https://www.idtdna.com/pages/technology/custom-dna-rna/locked-nucleic-acids This is any condition in which the main influencing factor is nitroglycerin, a volatile vasodilator which relieves angina pectoris by stimulating guanylate cyclase and lowering cytosolic calcium. It is also sometimes used for tocolysis. slaulede 2023-07-06T16:25:28Z CHEBI:28787 1,2,3-trinitrooxypropane experimental_condition_ontology XCO:0001067 nitroglycerin This is any condition in which the main influencing factor is nitroglycerin, a volatile vasodilator which relieves angina pectoris by stimulating guanylate cyclase and lowering cytosolic calcium. It is also sometimes used for tocolysis. MESH:D005996 This is any condition in which the main influencing factor is sleep, the natural, easily reversible periodic state of many living things that is marked by the absence of wakefulness and by the loss of consciousness of one's surroundings, is accompanied by a typical body posture (such as lying down with the eyes closed), the occurrence of dreaming, and changes in brain activity and physiological functioning. slaulede 2023-07-17T17:37:42Z napping slumber snoozing experimental_condition_ontology XCO:0001068 sleep This is any condition in which the main influencing factor is sleep, the natural, easily reversible periodic state of many living things that is marked by the absence of wakefulness and by the loss of consciousness of one's surroundings, is accompanied by a typical body posture (such as lying down with the eyes closed), the occurrence of dreaming, and changes in brain activity and physiological functioning. https://www.merriam-webster.com This is any condition in which the main influencing factor is sleep restriction, a state caused by inadequate quantity or quality of sleep, including voluntary or involuntary sleeplessness and circadian rhythm sleep. Sleep restriction may be caused by stress, school or job requirements, poor sleeping habits, or an experimentally arranged situation. slaulede 2023-07-17T17:58:29Z PMID:32040351 sleep deprivation experimental_condition_ontology insomnia XCO:0001069 sleep restriction This is any condition in which the main influencing factor is sleep restriction, a state caused by inadequate quantity or quality of sleep, including voluntary or involuntary sleeplessness and circadian rhythm sleep. Sleep restriction may be caused by stress, school or job requirements, poor sleeping habits, or an experimentally arranged situation. https://www.betterhealth.vic.gov.au/health/conditionsandtreatments/sleep-deprivation This is any condition in which the main influencing factor is papain, a cysteine protease present in papaya (Carica papaya) and mountain papaya (Vasconcellea cundinamarcensis). In addition to experimental uses in biology research, it has wide ranging commercial applications in the leather, cosmetic, textiles, detergents, food and pharmaceutical industries. slaulede 2023-07-18T14:25:07Z EC:3.4.22.2 MESH:D010206 papaya proteinase 1 experimental_condition_ontology XCO:0001070 papain This is any condition in which the main influencing factor is papain, a cysteine protease present in papaya (Carica papaya) and mountain papaya (Vasconcellea cundinamarcensis). In addition to experimental uses in biology research, it has wide ranging commercial applications in the leather, cosmetic, textiles, detergents, food and pharmaceutical industries. https://en.wikipedia.org/wiki/Papain This is any condition in which the main influencing factor is L-cysteine, an optically active form of cysteine having the L-configuration at the alpha-carbon. It is a thiol-containing non-essential amino acid that is oxidized to form cystine. slaulede 2023-07-18T16:58:46Z PMID:31950348 half-cystine experimental_condition_ontology XCO:0001071 L-cysteine This is any condition in which the main influencing factor is L-cysteine, an optically active form of cysteine having the L-configuration at the alpha-carbon. It is a thiol-containing non-essential amino acid that is oxidized to form cystine. CHEBI:17561 MESH:D003545 This is any condition in which the main influencing factor is the soluble transforming growth factor-beta receptor 2 gene (sTGF&#946;R2) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulede 2023-07-20T14:03:21Z gene transfer of the sTGF&#946;R2 gene using an adenoviral vector gene transfer of the soluble transforming growth factor-beta receptor 2 gene using a adenoviral vector transduction of sTGF&#946;R2 using an adenoviral vector transduction of sTGF&#946;R2 using an adenovirus vector experimental_condition_ontology XCO:0001072 gene transfer of the sTGF&#946;R2 gene using an adenovirus vector This is any condition in which the main influencing factor is the soluble transforming growth factor-beta receptor 2 gene (sTGF&#946;R2) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:31950348 This is any condition in which the main influencing factor is the klotho gene (KL) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulede 2023-07-20T14:15:01Z gene transfer of the KL gene using an adenoviral vector gene transfer of the alpha klotho gene using an adenoviral vector gene transfer of the klotho gene using an adenoviral vector transduction of KL using an adenoviral vector transduction of KL using an adenovirus vector experimental_condition_ontology XCO:0001073 gene transfer of the KL gene using an adenovirus vector This is any condition in which the main influencing factor is the klotho gene (KL) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:31950348 This is a condition in which the main influencing factor is an experimental surgical procedure causing blockage of one or both ureters. Ureters are the muscular ducts that propel urine from the kidneys to the urinary bladder. slaulede 2023-08-01T13:28:25Z experimental_condition_ontology UO ureteral obstruction XCO:0001074 ureter ligation This is a condition in which the main influencing factor is an experimental surgical procedure causing blockage of one or both ureters. Ureters are the muscular ducts that propel urine from the kidneys to the urinary bladder. ISBN:978-1455756438 UBERON:0000056 This is a condition in which the main influencing factor is an experimental surgical procedure causing blockage of one ureter. Unilateral ureter ligation is used in experimental animals to create a model of unilateral ureteral obstruction and renal fibrosis. slaulede 2023-08-01T14:00:10Z experimental_condition_ontology UUO unilateral ureteral obstruction XCO:0001075 unilateral ureter ligation This is a condition in which the main influencing factor is an experimental surgical procedure causing blockage of one ureter. Unilateral ureter ligation is used in experimental animals to create a model of unilateral ureteral obstruction and renal fibrosis. ISBN:978-1455756438 PMID:28912732 This is a condition in which the main influencing factor is an experimental surgical procedure causing blockage of both ureters. Bilateral ureter ligation (BUL) is used in experimental animals to create a model of renal failure. slaulede 2023-08-01T14:15:15Z BUL experimental_condition_ontology BUO bilateral ureteral obstruction XCO:0001076 bilateral ureter ligation This is a condition in which the main influencing factor is an experimental surgical procedure causing blockage of both ureters. Bilateral ureter ligation (BUL) is used in experimental animals to create a model of renal failure. ISBN:978-1455756438 PMID:20797570 This is any condition in which the main influencing factor is bisphenol F, an organic compound with the chemical formula (HOC6H4)2CH2. It is structurally related to bisphenol A (BPA), a popular precursor for forming plastics, as both belong to the category of molecules known as bisphenols, which feature two phenol groups connected via a linking group. slaulede 2023-08-08T16:49:17Z CHEBI:34575 MESH:C008745 4,4&#8242;-Dihydroxydiphenylmethane 4,4&#8242;-Methylenediphenol 4,4'-bisphenol F 4-(4-hydroxybenzyl)phenol BPF experimental_condition_ontology XCO:0001077 bisphenol F This is any condition in which the main influencing factor is bisphenol F, an organic compound with the chemical formula (HOC6H4)2CH2. It is structurally related to bisphenol A (BPA), a popular precursor for forming plastics, as both belong to the category of molecules known as bisphenols, which feature two phenol groups connected via a linking group. https://en.wikipedia.org/wiki/Bisphenol_F This is any condition in which the main influencing factor is bisphenol F in a drink made up of water and a specified amount of bisphenol F consumed by an organism as part of an experiment. Bisphenol F is an organic compound with the chemical formula (HOC6H4)2CH2. slaulede 2023-08-08T17:13:41Z CHEBI:34575 MESH:C008745 controlled 4,4&#8242;-Dihydroxydiphenylmethane content drinking water controlled 4,4&#8242;-Methylenediphenol content drinking water controlled BPF content drinking water experimental_condition_ontology XCO:0001078 controlled bisphenol F content drinking water This is any condition in which the main influencing factor is bisphenol F in a drink made up of water and a specified amount of bisphenol F consumed by an organism as part of an experiment. Bisphenol F is an organic compound with the chemical formula (HOC6H4)2CH2. https://en.wikipedia.org/wiki/Bisphenol_F https://www.merriam-webster.com/ This is any condition in which the main influencing factor is adenine, the parent compound of the 6-aminopurines, composed of a purine having an amino group at C-6. Adenine is one of the five constituent bases of nucleic acids.The shape of adenine is complementary to either thymine in DNA or uracil in RNA. slaulede 2023-09-14T15:58:46Z MESH:D000225 1H-Purin-6-amine 6-Aminopurine 9H-purin-6-amine experimental_condition_ontology XCO:0001079 adenine This is any condition in which the main influencing factor is adenine, the parent compound of the 6-aminopurines, composed of a purine having an amino group at C-6. Adenine is one of the five constituent bases of nucleic acids.The shape of adenine is complementary to either thymine in DNA or uracil in RNA. CHEBI:16708 https://en.wikipedia.org/wiki/Adenine This is any condition in which the main influencing factor is monoiodoacetate, a haloacetate(1-) resulting from the deprotonation of the carboxy group of iadoacetic acid. slaulede 2023-10-02T13:55:23Z MIA iodoacetate experimental_condition_ontology XCO:0001080 monoiodoacetate This is any condition in which the main influencing factor is monoiodoacetate, a haloacetate(1-) resulting from the deprotonation of the carboxy group of iadoacetic acid. CHEBI:23123 This is any condition in which the main influencing factor is SBFI-103, a selective FABP5 inhibitor. It is an experimental drug for treatment of cancer and osteoarthritis. slaulede 2023-10-02T14:40:38Z CAS:2132990-98-6 9-Fluorenylmethyl a-3-hydroxycarbonyl-2,4-di(2-methoxylphenyl)-cyclobutane-1-carboxylate FABP5-IN-1 SB-FI-103 alpha-SBFI-103 experimental_condition_ontology XCO:0001081 SBFI-103 This is any condition in which the main influencing factor is SBFI-103, a selective FABP5 inhibitor. It is an experimental drug for treatment of cancer and osteoarthritis. PMID:35650684 https://synapse.patsnap.com/drug/8addafe1559d4e20a32638b36f0515ec This is any condition in which the major influencing factor is the fibrillar collagen which comprises the main component of cartilage and is also found in the vitreous humor of the eye. Collagens are a family of extracellular, closely related proteins occurring as a major component of connective tissue, giving it strength and flexibility. slaulede 2023-10-03T13:13:21Z Bos taurus type II collagen cattle type II collagen experimental_condition_ontology XCO:0001082 bovine type II collagen This is any condition in which the major influencing factor is the fibrillar collagen which comprises the main component of cartilage and is also found in the vitreous humor of the eye. Collagens are a family of extracellular, closely related proteins occurring as a major component of connective tissue, giving it strength and flexibility. ISBN:978-1455756438 http://en.wikipedia.org/wiki/Collagen This is any condition in which the main influencing factor is imperatorin, a member of the class of psoralens that is psoralen substituted by a prenyloxy group at position 8. Isolated from Angelica dahurica and Angelica koreana, it acts as a acetylcholinesterase inhibitor. slaulede 2023-10-03T13:24:53Z CAS:482-44-0 MESH:C031534 PMID:32392637 9-[(3-methylbut-2-en-1-yl)oxy]-7H-furo[3,2-g]chromen-7-one IMP experimental_condition_ontology XCO:0001083 imperatorin This is any condition in which the main influencing factor is imperatorin, a member of the class of psoralens that is psoralen substituted by a prenyloxy group at position 8. Isolated from Angelica dahurica and Angelica koreana, it acts as a acetylcholinesterase inhibitor. CHEBI:5885 This is any condition in which the main influencing factor is beta-Sitosterol, one of several phytosterols (plant sterols) with chemical structures similar to that of cholesterol. It is a white, waxy powder with a characteristic odor, and is one of the components of the food additive E499. slaulede 2023-10-03T14:44:34Z CAS:83-46-5 PMID:32392637 beta-sitosterol experimental_condition_ontology XCO:0001084 beta-Sitosterol This is any condition in which the main influencing factor is beta-Sitosterol, one of several phytosterols (plant sterols) with chemical structures similar to that of cholesterol. It is a white, waxy powder with a characteristic odor, and is one of the components of the food additive E499. https://en.wikipedia.org/wiki/Beta-Sitosterol This is a condition induced by an experimental surgical procedure involving disruption of CSF circulation in the spinal cord. This artificial compression is intended to mimic the human disease canalicular syringomyelia. slaulederkind 2023-10-27T17:01:49Z experimental extradural spinal cord compression experimental_condition_ontology XCO:0001085 experimental epidural spinal cord compression This is a condition induced by an experimental surgical procedure involving disruption of CSF circulation in the spinal cord. This artificial compression is intended to mimic the human disease canalicular syringomyelia. PMID:37275526 This is any condition in which the main influencing factor is TRV023, an angiotensin analogue which is a beta-arrestin selective signaling AGTR1 agonist. It is a biased ligand because it does not affect G-protein signaling by AGTR1. slaulederkind 2023-10-31T13:11:19Z Sar-Arg-Val-Tyr-Lys-His-Pro-Ala-OH TRV experimental_condition_ontology XCO:0001086 TRV023 This is any condition in which the main influencing factor is TRV023, an angiotensin analogue which is a beta-arrestin selective signaling AGTR1 agonist. It is a biased ligand because it does not affect G-protein signaling by AGTR1. PMID:32259102 PMID:34201646 This is any condition in which the main influencing factor is limited bedding and nesting, a housing condition designed to create a model of early life adversity. The minimum bedding/nesting may be as little as a paper towel in a plain, unadorned cage. slaulederkind 2023-10-31T13:46:58Z LBN limited bedding and nesting model limited bedding/nesting model experimental_condition_ontology ELA early-life adversity XCO:0001087 limited bedding and nesting This is any condition in which the main influencing factor is limited bedding and nesting, a housing condition designed to create a model of early life adversity. The minimum bedding/nesting may be as little as a paper towel in a plain, unadorned cage. PMID:35102257 This is any condition in which the main influencing factor is cefuroxime, a broad-spectrum cephalosporin antibiotic resistant to beta-lactamase. Cefuroxime has been proposed for treatment of infections of gram-negative organisms, gram-positive organisms, gonorrhea, and haemophilus. slaulederkind 2023-11-02T12:28:19Z 3-[(carbamoyloxy)methyl]-7beta-[(2Z)-2-(furan-2-yl)-2-(methoxyimino)acetamido]-3,4-didehydrocepham-4-carboxylic acid CHEBI:3515 CID:5479529 experimental_condition_ontology XCO:0001088 cefuroxime This is any condition in which the main influencing factor is cefuroxime, a broad-spectrum cephalosporin antibiotic resistant to beta-lactamase. Cefuroxime has been proposed for treatment of infections of gram-negative organisms, gram-positive organisms, gonorrhea, and haemophilus. MESH:D002444 This is any condition in which the main influencing factor is a hirudin, a single-chain polypeptide of about 65 amino acids (7 kDa) found in leech saliva, that has a neutral hydrophobic N terminus, an acidic hydrophilic C terminus, and a compact, hydrophobic core region. Hirudins, both natural and synthetic, are inhibitors of thrombin. slaulederkind 2023-11-02T13:01:47Z hirudins MESH:C074619 MESH:C083544 PMID:34621173 experimental_condition_ontology XCO:0001089 hirudin This is any condition in which the main influencing factor is a hirudin, a single-chain polypeptide of about 65 amino acids (7 kDa) found in leech saliva, that has a neutral hydrophobic N terminus, an acidic hydrophilic C terminus, and a compact, hydrophobic core region. Hirudins, both natural and synthetic, are inhibitors of thrombin. MESH:D006629 This is any condition in which the main influencing factor is an anticoagulant, a substance that hinders the clotting of blood. slaulederkind 2023-11-02T13:12:35Z CHEBI:50249 MESH:D000925 PMID:34621173 experimental_condition_ontology Not4Curation XCO:0001090 anticoagulant This is any condition in which the main influencing factor is an anticoagulant, a substance that hinders the clotting of blood. ISBN:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is experimental spinal cord injury, a penetrating or non-penetrating injury to the spinal cord resulting from experimentally controlled trauma. slaulederkind 2023-11-02T13:45:26Z DOID:9000039 GEO:GSE149657 experimental_condition_ontology XCO:0001091 experimental spinal cord injury This is any condition in which the main influencing factor is experimental spinal cord injury, a penetrating or non-penetrating injury to the spinal cord resulting from experimentally controlled trauma. MESH:D013119 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is an experimentally controlled sciatic nerve crush, which is used as a model of sciatic neuropathy, Wallerian degeneration, and axonal regeneration. slaulederkind 2023-11-02T13:57:14Z GEO:GSE149657 experimental_condition_ontology XCO:0001092 sciatic nerve crush This is any condition in which the main influencing factor is an experimentally controlled sciatic nerve crush, which is used as a model of sciatic neuropathy, Wallerian degeneration, and axonal regeneration. PMID:35768768 This is any condition in which the main influencing factor is epigallocatechin-3-gallate, a gallate ester which is an antimutagen found in tea (Camellia sinensis) with the highest concentration in green tea. slaulederkind 2023-11-03T14:46:21Z CHEBI:4806 (-)-epigallocatechin 3-gallate EGCG epigallocatechin gallate experimental_condition_ontology XCO:0001093 epigallocatechin-3-gallate This is any condition in which the main influencing factor is epigallocatechin-3-gallate, a gallate ester which is an antimutagen found in tea (Camellia sinensis) with the highest concentration in green tea. MESH:C045651 This is any condition in which the main influencing factor is CFT-1, a green tea variety called Camellia sinensis (L.) O. Kuntze cv. CFT&#8208;1, which is rich in EGCG (antimutagen epigallocatechin-3-gallate). slaulederkind 2023-11-03T15:30:13Z CFT&#8208;1 green tea infusion CFT-1 Camellia sinensis (L.) O. Kuntze cv. CFT&#8208;1 Camellia sinensis CV.CFT&#8208;1 tea EGCG&#8208;rich tea experimental_condition_ontology XCO:0001094 CFT&#8208;1 tea infusion This is any condition in which the main influencing factor is CFT-1, a green tea variety called Camellia sinensis (L.) O. Kuntze cv. CFT&#8208;1, which is rich in EGCG (antimutagen epigallocatechin-3-gallate). PMID:31428352 https://en.wikipedia.org/wiki/Camellia_sinensis This is any condition in which the main influencing factor is FYT, a common green tea variety called Camellia sinensis (L.) O. Kuntze cv. Fuyun6. slaulederkind 2023-11-03T15:57:46Z Camellia sinensis (L.) O. Kuntze cv. FYT Camellia sinensis (L.) O. Kuntze cv. Fuyun6 Camellia sinensis CV.FYT tea FYT FYT green tea infusion Fuyun6 green tea experimental_condition_ontology XCO:0001095 FYT tea infusion This is any condition in which the main influencing factor is FYT, a common green tea variety called Camellia sinensis (L.) O. Kuntze cv. Fuyun6. PMID:31428352 https://en.wikipedia.org/wiki/Camellia_sinensis This is any condition in which the main influencing factor is sodium taurocholate, the sodium salt of taurocholic acid. Sodium taurocholate is the chief ingredient of the bile of carnivorous animals. It is used experimentally to induce severe acute pancreatitis in laboratory animals. slaulederkind 2023-11-06T16:23:56Z CAS:145-42-6 CID:23666345 Taurocholate sodium salt sodium 2-[(3alpha,7alpha,12alpha-trihydroxy-24-oxo-5beta-cholan-24-yl)amino]ethanesulfonate experimental_condition_ontology XCO:0001096 sodium taurocholate This is any condition in which the main influencing factor is sodium taurocholate, the sodium salt of taurocholic acid. Sodium taurocholate is the chief ingredient of the bile of carnivorous animals. It is used experimentally to induce severe acute pancreatitis in laboratory animals. MESH:D013656 PMID:35496266 This is any condition in which the main influencing factor is JZL184, an irreversible inhibitor of monoacylglycerol lipase (MAGL), the primary enzyme responsible for degrading the endocannabinoid 2-arachidonoylglycerol (2-AG). slaulederkind 2023-11-06T16:56:32Z CAS:1101854-58-3 CID:25021165 PMID:35496266 4-Nitrophenyl 4-[di(2H-1,3-benzodioxol-5-yl)(hydroxy)methyl]piperidine-1-carboxylate experimental_condition_ontology XCO:0001097 JZL184 This is any condition in which the main influencing factor is JZL184, an irreversible inhibitor of monoacylglycerol lipase (MAGL), the primary enzyme responsible for degrading the endocannabinoid 2-arachidonoylglycerol (2-AG). https://en.wikipedia.org/wiki/JZL184 This is any condition in which the main influencing factor is crystalline silica. Silica is synonymous with silicon dioxide (SiO2) and commonly found in nature as sand. Silica exists mainly as crystalline silica (mostly in the form of quartz). slaulederkind 2023-11-09T10:09:39Z CHEBI:30563 CHEBI:46727 MESH:D011791 MESH:D012822 FSD FSP fracking sand dust fracking sand particles respirable crystalline silica experimental_condition_ontology XCO:0001098 crystalline silica This is any condition in which the main influencing factor is crystalline silica. Silica is synonymous with silicon dioxide (SiO2) and commonly found in nature as sand. Silica exists mainly as crystalline silica (mostly in the form of quartz). https://safesilica.eu/crystalline-silica-the-science/ https://www.merriam-webster.com/ This is any condition in which the main influencing factor is respirable crystalline silica, which is breathable silica dust. The level of crystalline silica in the air surrounding an organism or breathed by an organism is determined by environmental conditions, work conditions, or controlled as part of an experiment. slaulederkind 2023-11-09T10:36:46Z CHEBI:30563 CHEBI:46727 MESH:D011791 MESH:D012822 air crystalline silica content respirable crystalline silica content controlled air FSD content controlled air fracking sand dust content controlled air fracking sand particle content experimental_condition_ontology XCO:0001099 controlled air crystalline silica content This is any condition in which the main influencing factor is respirable crystalline silica, which is breathable silica dust. The level of crystalline silica in the air surrounding an organism or breathed by an organism is determined by environmental conditions, work conditions, or controlled as part of an experiment. https://leadlab.com/what-is-crystalline-silica-testing/ https://www.merriam-webster.com/ This is any condition in which the main influencing factor is the use of manual or mechanical, non-surgical means to aid a patient or experimental animal in performing some biological activity for the purpose of examination, collection of samples, drug administration, therapy, or experimental manipulation. This may or may not require the use of tools or devices. slaulederkind 2023-11-09T13:03:47Z PMID:35627209 experimental_condition_ontology XCO:0001100 physical manipulation This is any condition in which the main influencing factor is the use of manual or mechanical, non-surgical means to aid a patient or experimental animal in performing some biological activity for the purpose of examination, collection of samples, drug administration, therapy, or experimental manipulation. This may or may not require the use of tools or devices. https://anti-doping.government.bg/en/m2-khimicheski-i-fizicheski-manipulatsii_p58.html https://www.merriam-webster.com/ This is any condition in which the main influencing factor is urinary catheterization, the insertion of a tune through the urethra into the bladder to allow urine to drain from the bladder for collection or to allow injection of some substance. slaulederkind 2023-11-09T13:23:26Z urethra catheterization urethral catheterization Foley catheter Robinson catheter experimental_condition_ontology XCO:0001101 urinary catheterization This is any condition in which the main influencing factor is urinary catheterization, the insertion of a tune through the urethra into the bladder to allow urine to drain from the bladder for collection or to allow injection of some substance. ISBN-13:978-1455756438 https://en.wikipedia.org/wiki/Urinary_catheterization This is any condition in which the main influencing factor is serotonin hydrochloride, the hydrochloride form of a primary amino compound (serotonin) that is the 5-hydroxy derivative of tryptamine. slaulederkind 2023-11-09T14:26:08Z CHEBI:181195 3-(2-aminoethyl)-1H-indol-5-ol;hydrochloride 5-HT hydrochloride 5-Hydroxytryptamine hydrochloride Serotonin HCl experimental_condition_ontology XCO:0001102 serotonin hydrochloride This is any condition in which the main influencing factor is serotonin hydrochloride, the hydrochloride form of a primary amino compound (serotonin) that is the 5-hydroxy derivative of tryptamine. CHEBI:28790 This is any condition in which the main influencing factor is 17beta-estradiol 3-benzoate, the C17&#946; benzoate ester of estradiol. slaulederkind 2023-11-09T14:47:50Z CHEBI:77006 &#946;-estradiol 3-benzoate (17beta)-17-hydroxyestra-1(10),2,4-trien-3-yl benzoate estradiol 3-benzoate estradiol benzoate experimental_condition_ontology XCO:0001103 17beta-estradiol 3-benzoate This is any condition in which the main influencing factor is 17beta-estradiol 3-benzoate, the C17&#946; benzoate ester of estradiol. CID:222757 This is any condition in which the main influencing factor is Q808, an experimental phthalazine tetrazole derivative being tested for effectiveness as an anti-inflammatory, anticonvulsant, and analgesic drug. slaulederkind 2023-11-10T15:07:40Z PMID:35831127 6-(4-chlorophenoxy)-tetrazolo[5,1-a]phthalazine QUAN0808 experimental_condition_ontology XCO:0001104 QUAN-0808 This is any condition in which the main influencing factor is Q808, an experimental phthalazine tetrazole derivative being tested for effectiveness as an anti-inflammatory, anticonvulsant, and analgesic drug. ISBN-13:978-1455756438 PMID:23238472 This is any condition in which the main influencing factor is a controlled in situ ophthalmic condition, an experimental or medical condition in which the internal or external environment of the eye(s) is altered. slaulederkind 2023-11-10T15:50:43Z controlled in situ eye condition experimental_condition_ontology XCO:0001105 controlled in situ ophthalmic condition This is any condition in which the main influencing factor is a controlled in situ ophthalmic condition, an experimental or medical condition in which the internal or external environment of the eye(s) is altered. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is retinal reperfusion, the flow of blood to the retina being restored after a period of blood vessel occlusion occurring experimentally. slaulederkind 2023-11-10T15:57:47Z DOID:9001725 retina ischemia-reperfusion retina ischemia/reperfusion retinal ischemia-reperfusion experimental_condition_ontology XCO:0001106 retinal reperfusion This is any condition in which the main influencing factor is retinal reperfusion, the flow of blood to the retina being restored after a period of blood vessel occlusion occurring experimentally. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a polymer, any of a class of natural or synthetic substances composed of very large molecules, called macromolecules, which are multiples of simpler chemical units called monomers. slaulederkind 2023-11-13T12:40:55Z PMID:36693849 experimental_condition_ontology XCO:0001107 polymer This is any condition in which the main influencing factor is a polymer, any of a class of natural or synthetic substances composed of very large molecules, called macromolecules, which are multiples of simpler chemical units called monomers. https://www.britannica.com/science/polymer This is any condition in which the main influencing factor is alginate, a naturally occurring anionic polymer typically obtained from brown seaweed. It is used as a wound dressing to keep the wound area moist. slaulederkind 2023-11-13T12:50:44Z PMID:36693849 experimental_condition_ontology XCO:0001108 alginate This is any condition in which the main influencing factor is alginate, a naturally occurring anionic polymer typically obtained from brown seaweed. It is used as a wound dressing to keep the wound area moist. PMID:22125349 This is any condition in which the main influencing factor is a glycosaminoglycan, any polysaccharide composed of repeating disaccharide units and containing a substantial proportion of amino monosaccharide residues. Glycosaminoglycans are constituents of mucoproteins, glycoproteins, and blood-group substances. slaulederkind 2023-11-13T13:21:20Z PMID:36693849 GAG mucopolysaccharide s-GAG snail glycosaminoglycan experimental_condition_ontology XCO:0001109 glycosaminoglycan This is any condition in which the main influencing factor is a glycosaminoglycan, any polysaccharide composed of repeating disaccharide units and containing a substantial proportion of amino monosaccharide residues. Glycosaminoglycans are constituents of mucoproteins, glycoproteins, and blood-group substances. CHEBI:18085 https://www.merriam-webster.com/ https://www.ncbi.nlm.nih.gov/books/NBK544295/ This is any condition in which the main influencing factor is dried snail-mucus gel (SMG), a natural substance derived from mucus harvested from snails (Achatina fulica or Helix lucorum). The chemical composition of SMG includes a high percentage of heparin-like glycosaminoglycan. slaulederkind 2023-11-13T14:10:33Z PMID:36693849 dried SMG dried snail-mucus gel dried snail-mucus glue experimental_condition_ontology XCO:0001110 d-SMG This is any condition in which the main influencing factor is dried snail-mucus gel (SMG), a natural substance derived from mucus harvested from snails (Achatina fulica or Helix lucorum). The chemical composition of SMG includes a high percentage of heparin-like glycosaminoglycan. PMID:36693849 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is mercury dichloride, a mercury coordination entity made up of linear triatomic molecules in which a mercury atom is bonded to two chlorines. Water-soluble, it is highly toxic. Once used in a wide variety of applications, its use has markedly declined as less toxic alternatives have been developed. slaulederkind 2023-11-14T09:45:49Z MESH:D008627 PMID:32599119 HgCl2 Mercuric chloride mercury(2+) chloride experimental_condition_ontology XCO:0001111 mercury dichloride This is any condition in which the main influencing factor is mercury dichloride, a mercury coordination entity made up of linear triatomic molecules in which a mercury atom is bonded to two chlorines. Water-soluble, it is highly toxic. Once used in a wide variety of applications, its use has markedly declined as less toxic alternatives have been developed. CHEBI:31823 This is any condition in which the main influencing factor is a nephrotoxic substance that causes injury to the kidney or damages its function. slaulederkind 2023-11-14T13:26:51Z nephrotoxic agent CHEBI:50909 PMID:32599119 kidney toxicity-inducing chemical nephrotoxicity-inducing chemical renal toxicity-inducing chemical experimental_condition_ontology XCO:0001112 nephrotoxic chemical This is any condition in which the main influencing factor is a nephrotoxic substance that causes injury to the kidney or damages its function. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is folic acid, an N-acyl-amino acid that is a form of the water-soluble vitamin B9. slaulederkind 2023-11-14T14:00:24Z MESH:D005492 PMID:33375730 folicin pteroylglutamic acid vitamin B9 experimental_condition_ontology folate XCO:0001113 folic acid This is any condition in which the main influencing factor is folic acid, an N-acyl-amino acid that is a form of the water-soluble vitamin B9. CHEBI:27470 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a controlled folic acid content diet, a solid diet in which the amount of folic acid is maintained at a specified level. Folic acid is an N-acyl-amino acid that is a form of the water-soluble vitamin B9. slaulederkind 2023-11-14T14:18:28Z MESH:D005492 PMID:33375730 controlled pteroylglutamic acid content diet controlled folicin content diet controlled vitamin B9 content diet experimental_condition_ontology XCO:0001114 controlled folic acid content diet This is any condition in which the main influencing factor is a controlled folic acid content diet, a solid diet in which the amount of folic acid is maintained at a specified level. Folic acid is an N-acyl-amino acid that is a form of the water-soluble vitamin B9. CHEBI:27470 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is (6S)-5-methyltetrahydrofolic acid, the primary biologically active form of folate (vitamin B9). slaulederkind 2023-11-14T16:20:34Z CHEBI:136009 CID:135398561 PMID:33375730 (6S)-5-MTHF Levomefolic acid N-[4-({[(6S)-2-amino-5-methyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid experimental_condition_ontology XCO:0001115 (6S)-5-methyltetrahydrofolic acid This is any condition in which the main influencing factor is (6S)-5-methyltetrahydrofolic acid, the primary biologically active form of folate (vitamin B9). CHEBI:136009 https://en.wikipedia.org/wiki/Levomefolic_acid This is any condition in which the main influencing factor is a controlled (6S)-5-methyltetrahydrofolic acid content diet, a solid diet in which the amount of (6S)-5-methyltetrahydrofolic acid is maintained at a specified level. (6S)-5-methyltetrahydrofolic acid is the primary biologically active form of folate (vitamin B9). slaulederkind 2023-11-14T16:35:06Z CHEBI:136009 PMID:33375730 controlled (6S)-5-MTHF content diet controlled 5-MTHF content diet experimental_condition_ontology XCO:0001116 controlled (6S)-5-methyltetrahydrofolic acid content diet This is any condition in which the main influencing factor is a controlled (6S)-5-methyltetrahydrofolic acid content diet, a solid diet in which the amount of (6S)-5-methyltetrahydrofolic acid is maintained at a specified level. (6S)-5-methyltetrahydrofolic acid is the primary biologically active form of folate (vitamin B9). PMID:35999905 https://en.wikipedia.org/wiki/Levomefolic_acid This is any condition in which the main influencing factor is pefloxacin, a substituted quinolone that is an antibacterial agent and inhibitor of DNA biosynthesis. slaulederkind 2023-11-14T17:41:45Z MESH:D015366 1-ethyl-6-fluoro-7-(4-methylpiperazin-1-yl)-4-oxo-1,4-dihydroquinoline-3-carboxylic acid pefloxacinium experimental_condition_ontology XCO:0001117 pefloxacin This is any condition in which the main influencing factor is pefloxacin, a substituted quinolone that is an antibacterial agent and inhibitor of DNA biosynthesis. CHEBI:50199 This is any condition in which the main influencing factor is the use of a prosthetic device to generate a unilateral anterior crossbite in laboratory animals. A unilateral anterior crossbite is a specific type of dental malocclusion that creates temporomandibular joint osteoarthritis via biomechanical stress in the experimental subject or patient. slaulederkind 2023-11-16T12:12:51Z PMID:37919852 experimental UAC experimental_condition_ontology XCO:0001118 experimental unilateral anterior crossbite This is any condition in which the main influencing factor is the use of a prosthetic device to generate a unilateral anterior crossbite in laboratory animals. A unilateral anterior crossbite is a specific type of dental malocclusion that creates temporomandibular joint osteoarthritis via biomechanical stress in the experimental subject or patient. ISBN-13:978-1455756438 PMID:26746151 This is any condition in which the main influencing factor is deionized water, a form of purified water that is filtered through one or two tanks of ion-exchange resin which replaces cations with hydrogen (H+) ions and anions with hydroxyl (OH-) ions, leaving a mineral-free water. slaulederkind 2023-11-16T13:38:37Z pure water PMID:32745584 deionized H2O experimental_condition_ontology XCO:0001119 deionized water This is any condition in which the main influencing factor is deionized water, a form of purified water that is filtered through one or two tanks of ion-exchange resin which replaces cations with hydrogen (H+) ions and anions with hydroxyl (OH-) ions, leaving a mineral-free water. https://www.merriam-webster.com/ https://www.waterdropfilter.com/blogs/water This is any condition in which the main influencing factor is almorexant, an experimental drug developed to combat insomnia. Almorexant is a competitive, dual OX1 and OX2 receptor antagonist and selectively inhibits the functional consequences of OX1 and OX2 receptor activation, such as intracellular Ca2+ mobilization. slaulederkind 2023-11-16T14:00:56Z PMID:32066707 (2R)-2-[(1S)-6,7-dimethoxy-1-[2-[4-(triluoromethyl)phenyl]ethyl]-3,4-dihydro-1H-isoquinolin-2-yl]-N-methyl-2-phenylacetamide ACT-078573 experimental_condition_ontology XCO:0001120 almorexant This is any condition in which the main influencing factor is almorexant, an experimental drug developed to combat insomnia. Almorexant is a competitive, dual OX1 and OX2 receptor antagonist and selectively inhibits the functional consequences of OX1 and OX2 receptor activation, such as intracellular Ca2+ mobilization. https://en.wikipedia.org/wiki/Almorexant This is any condition in which the main influencing factor is polyethylene glycol 400, a polymer composed of repeating ethyleneoxy units with an average molecular weight of 400. PEG 400 is a clear, colorless, liquid with low toxicity, affording wide use in a variety of pharmaceutical formulations. slaulederkind 2023-11-16T14:17:21Z CHEBI:46793 polyethylene glycol 400 experimental_condition_ontology XCO:0001121 PEG 400 This is any condition in which the main influencing factor is polyethylene glycol 400, a polymer composed of repeating ethyleneoxy units with an average molecular weight of 400. PEG 400 is a clear, colorless, liquid with low toxicity, affording wide use in a variety of pharmaceutical formulations. CHEBI:46793 https://en.wikipedia.org/wiki/PEG_400 This is any condition in which the main influencing factor is an anti-anxiety agent, a medication or other intervention that reduces anxiety. Anxiolytic medications are used for the treatment of anxiety disorders and their related psychological and physical symptoms. slaulederkind 2023-11-17T10:05:28Z MESH:D014151 PMID:37966567 anti-anxiety agent anti-anxiety drug antianxiety drug antipanic agent anxiolytic anxiolytic medication experimental_condition_ontology Not4Curation XCO:0001122 antianxiety agent This is any condition in which the main influencing factor is an anti-anxiety agent, a medication or other intervention that reduces anxiety. Anxiolytic medications are used for the treatment of anxiety disorders and their related psychological and physical symptoms. https://en.wikipedia.org/wiki/Anxiolytic https://www.merriam-webster.com/ This is any condition in which the main influencing factor is alpidem, a drug formerly used to treat anxiety disorders but its medical use was discontinued due to liver toxicity. slaulederkind 2023-11-17T10:28:29Z CHEBI:135649 MESH:C052036 PMID:32119089 experimental_condition_ontology XCO:0001123 alpidem This is any condition in which the main influencing factor is alpidem, a drug formerly used to treat anxiety disorders but its medical use was discontinued due to liver toxicity. https://en.wikipedia.org/wiki/Alpidem This is any condition in which the main influencing factor is amiodarone, an antianginal and class III antiarrhythmic drug that increases the duration of ventricular and atrial muscle action by inhibiting potassium channels and voltage-gated sodium channels. Following the channel inhibition is a resulting decrease in heart rate and in vascular resistance. slaulederkind 2023-11-17T11:29:29Z CHEBI:2663 PMID:32119089 (2-butyl-1-benzofuran-3-yl){4-[2-(diethylamino)ethoxy]-3,5-diiodophenyl}methanone Amiodarona Amiodaronum Cordarone experimental_condition_ontology XCO:0001124 amiodarone This is any condition in which the main influencing factor is amiodarone, an antianginal and class III antiarrhythmic drug that increases the duration of ventricular and atrial muscle action by inhibiting potassium channels and voltage-gated sodium channels. Following the channel inhibition is a resulting decrease in heart rate and in vascular resistance. MESH:D000638 This is any condition in which the main influencing factor is amoxicillin, a penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-(4-hydroxyphenyl)acetamido group. Amoxicillin is a broad-spectrum semisynthetic antibiotic similar to AMPICILLIN except that its resistance to gastric acid permits higher serum levels with oral administration. slaulederkind 2023-11-17T12:03:49Z PMID:32119089 amox amoxycillin experimental_condition_ontology XCO:0001125 amoxicillin This is any condition in which the main influencing factor is amoxicillin, a penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-(4-hydroxyphenyl)acetamido group. Amoxicillin is a broad-spectrum semisynthetic antibiotic similar to AMPICILLIN except that its resistance to gastric acid permits higher serum levels with oral administration. CHEBI:2676 MESH:D000658 This is any condition in which the main influencing factor is curcumin , a beta-diketone that is obtained from tumeric, the powdered root of Curcuma longa. Curcumin appears to possess a spectrum of pharmacological properties, due primarily to its inhibitory effects on metabolic enzymes. slaulederkind 2023-11-17T14:16:02Z PMID:37916359 (1E,6E)-1,7-bis(4-hydroxy-3-methoxyphenyl)hepta-1,6-diene-3,5-dione Diferuloylmethane experimental_condition_ontology XCO:0001126 curcumin This is any condition in which the main influencing factor is curcumin , a beta-diketone that is obtained from tumeric, the powdered root of Curcuma longa. Curcumin appears to possess a spectrum of pharmacological properties, due primarily to its inhibitory effects on metabolic enzymes. CHEBI:3962 MESH:D003474 This is any condition in which the main influencing factor is BHD (Buyang Huanwu Decoction), a multi-herbal composition (classic traditional chinese medicine formula) commonly prescribed in the treatment of cerebrovascular diseases. slaulederkind 2023-11-17T14:41:23Z BHD BHF Boyang Hwano Decoction Bu Yang Huan WU Tang Buyang Huanwu Formula Buyang Huanwu Tang experimental_condition_ontology XCO:0001127 Buyang Huanwu decoction This is any condition in which the main influencing factor is BHD (Buyang Huanwu Decoction), a multi-herbal composition (classic traditional chinese medicine formula) commonly prescribed in the treatment of cerebrovascular diseases. PMID:32171896 This is any condition in which the main influencing factor is a polysaccharide derivative, a carbohydrate derivative that is any derivative of a polysaccharide (a biomacromolecule consisting of large numbers of monosaccharide residues linked glycosidically). Various molecules can be covalently attached to the hydroxyl groups of polysaccharides and thus form polysaccaride derivatives. slaulederkind 2023-11-17T18:00:43Z PMID:32119089 polycarbohydrate derivative experimental_condition_ontology XCO:0001128 polysaccharide derivative This is any condition in which the main influencing factor is a polysaccharide derivative, a carbohydrate derivative that is any derivative of a polysaccharide (a biomacromolecule consisting of large numbers of monosaccharide residues linked glycosidically). Various molecules can be covalently attached to the hydroxyl groups of polysaccharides and thus form polysaccaride derivatives. CHEBI:65212 https://en.wikipedia.org/wiki/Polysaccharide#Derivatives This is any condition in which the main influencing factor is carboxymethylcellulose, a polysaccharide derivative that is cellulose in which carboxymethyl groups are bound to some of the hydroxyl groups of the glucopyranose monomers. slaulederkind 2023-11-17T18:06:34Z PMID:32119089 CMC carboxymethyl cellulose cellulose gum experimental_condition_ontology XCO:0001129 carboxymethylcellulose This is any condition in which the main influencing factor is carboxymethylcellulose, a polysaccharide derivative that is cellulose in which carboxymethyl groups are bound to some of the hydroxyl groups of the glucopyranose monomers. CHEBI:85146 https://en.wikipedia.org/wiki/Carboxymethyl_cellulose This is any condition in which the main influencing factor is amprenavir, a protease inhibitor designed to treat HIV infections. Amprenavir has been replaced by fosamprenavir, a prodrug of amprenavir. slaulederkind 2023-11-20T18:47:45Z CHEBI:40050 MESH:C095108 [(3S)-oxolan-3-yl] N-[(2S,3R)-4-[(4-aminophenyl)sulfonyl-(2-methylpropyl)amino]-3-hydroxy-1-phenylbutan-2-yl]carbamate experimental_condition_ontology XCO:0001130 amprenavir This is any condition in which the main influencing factor is amprenavir, a protease inhibitor designed to treat HIV infections. Amprenavir has been replaced by fosamprenavir, a prodrug of amprenavir. https://en.wikipedia.org/wiki/Amprenavir This is any condition in which the main influencing factor is azithromycin, a semi-synthetic, broad-spectrum, macrolide antibiotic structurally related to erythromycin. It has been used in the treatment of various types of bacterial infections. slaulederkind 2023-11-21T10:56:37Z CHEBI:2955 PMID:32119089 9-deoxo-9a-aza-9a-methyl-9a-homoerythromycin Azasite Zithromax experimental_condition_ontology XCO:0001131 azithromycin This is any condition in which the main influencing factor is azithromycin, a semi-synthetic, broad-spectrum, macrolide antibiotic structurally related to erythromycin. It has been used in the treatment of various types of bacterial infections. MESH:D017963 https://en.wikipedia.org/wiki/Azithromycin This is any condition in which the main influencing factor is sesame oil, an edible vegetable oil derived from sesame seeds. Sesame oil can be used as a solvent for an injected drug or an intravenous drip. slaulederkind 2023-11-21T14:26:20Z PMID:32119089 sesame seed oil experimental_condition_ontology XCO:0001132 sesame oil This is any condition in which the main influencing factor is sesame oil, an edible vegetable oil derived from sesame seeds. Sesame oil can be used as a solvent for an injected drug or an intravenous drip. https://en.wikipedia.org/wiki/Sesame_oil This is any condition in which the main influencing factor is bardoxolone, a synthetic triterpenoid compound with potential antineoplastic and anti-inflammatory activities. Bardoxolone blocks the synthesis of inducible nitric oxide synthase (iNOS) and inducible cyclooxygenase (COX-2), two enzymes involved in inflammation and carcinogenesis. slaulederkind 2023-11-21T14:43:36Z CHEBI:177450 CID:400010 PMID:32119089 (4aS,6aR,6bS,8aR,12aS,14aR,14bS)-11-cyano-2,2,6a,6b,9,9,12a-heptamethyl-10,14-dioxo-1,3,4,5,6,7,8,8a,14a,14b-decahydropicene-4a-carboxylic acid CDDO RTA 401 RTA-401 experimental_condition_ontology XCO:0001133 bardoxolone This is any condition in which the main influencing factor is bardoxolone, a synthetic triterpenoid compound with potential antineoplastic and anti-inflammatory activities. Bardoxolone blocks the synthesis of inducible nitric oxide synthase (iNOS) and inducible cyclooxygenase (COX-2), two enzymes involved in inflammation and carcinogenesis. NCI:C48382 This is any condition in which the main influencing factor is caffeine, a methylxanthine naturally occurring in some beverages and also used as a pharmacological agent. Caffeine's most notable pharmacological effect is as a central nervous system stimulant, increasing alertness and producing agitation. slaulederkind 2023-11-27T18:04:45Z CHEBI:27732 MESH:D002110 experimental_condition_ontology XCO:0001134 caffeine This is any condition in which the main influencing factor is caffeine, a methylxanthine naturally occurring in some beverages and also used as a pharmacological agent. Caffeine's most notable pharmacological effect is as a central nervous system stimulant, increasing alertness and producing agitation. MESH:D002110 This is any condition in which the main influencing factor is carbamazepine, a dibenzazepine that acts as a sodium channel blocker. Carbamazepine is used as an anticonvulsant and it may also be used in the management of bipolar disorder and neuropathic pain. slaulederkind 2023-11-30T14:31:38Z CHEBI:3387 CID:2554 5H-dibenzo[b,f]azepine-5-carboxamide CBZ Tegretol experimental_condition_ontology XCO:0001135 carbamazepine This is any condition in which the main influencing factor is carbamazepine, a dibenzazepine that acts as a sodium channel blocker. Carbamazepine is used as an anticonvulsant and it may also be used in the management of bipolar disorder and neuropathic pain. MESH:D002220 https://en.wikipedia.org/wiki/Carbamazepine This is any condition in which the main influencing factor is propylene glycol, a synthetic small organic alcohol that is hydrophylic. Propylene glycol has various laboratory, pharmaceutical, and industrial uses. slaulederkind 2023-11-30T14:55:03Z 1,2-dihydroxypropane 1,2-propanediol MESH:D019946 methyl glycol trimethyl glycol experimental_condition_ontology XCO:0001136 propylene glycol This is any condition in which the main influencing factor is propylene glycol, a synthetic small organic alcohol that is hydrophylic. Propylene glycol has various laboratory, pharmaceutical, and industrial uses. CID:1030 https://en.wikipedia.org/wiki/Propylene_glycol This is any condition in which the main influencing factor is carisoprodol, a carbamate ester which is a centrally acting skeletal muscle relaxant whose mechanism of action may be related to its sedative actions. Carisoprodol is used for the relief of discomfort associated with acute, painful musculoskeletal conditions. slaulederkind 2023-11-30T15:30:53Z CHEBI:3419 2-[(carbamoyloxy)methyl]-2-methylpentyl propan-2-ylcarbamate Carisoprodate Isomeprobamate experimental_condition_ontology XCO:0001137 carisoprodol This is any condition in which the main influencing factor is carisoprodol, a carbamate ester which is a centrally acting skeletal muscle relaxant whose mechanism of action may be related to its sedative actions. Carisoprodol is used for the relief of discomfort associated with acute, painful musculoskeletal conditions. MESH:D002328 https://www.ncbi.nlm.nih.gov/books/NBK553077 This is any condition in which the main influencing factor is cefprozil, a semisynthetic, second-generation cephalosporin. Cefprozil is used to treat bronchitis as well as ear, skin and other bacterial infections. slaulederkind 2023-11-30T15:49:04Z Cefzil experimental_condition_ontology XCO:0001138 cefprozil This is any condition in which the main influencing factor is cefprozil, a semisynthetic, second-generation cephalosporin. Cefprozil is used to treat bronchitis as well as ear, skin and other bacterial infections. CHEBI:3506 CID:5281006 This is any condition in which the main influencing factor is chloramphenicol, a topical,broad-spectrum antibiotic first isolated from cultures of Streptomyces venequelae but now produced synthetically. Chloramphenicol act s by interfering with bacterial protein synthesis slaulederkind 2023-12-01T08:16:50Z CHEBI:17698 CID:5959 2,2-dichloro-N-[(1R,2R)-2-hydroxy-1-(hydroxymethyl)-2-(4-nitrophenyl)ethyl]acetamide experimental_condition_ontology XCO:0001139 chloramphenicol This is any condition in which the main influencing factor is chloramphenicol, a topical,broad-spectrum antibiotic first isolated from cultures of Streptomyces venequelae but now produced synthetically. Chloramphenicol act s by interfering with bacterial protein synthesis MESH:D002701 This is any condition in which the main influencing factor is chlormezanone, an anxiolytic drug, a muscle relaxant and an antipsychotic agent whose clinical use was discontinued because of rare but serious cutaneous reactions. slaulederkind 2023-12-01T08:45:42Z CID:2717 Chlormethazanone Chlormethazone Clormetazanone experimental_condition_ontology XCO:0001140 chlormezanone This is any condition in which the main influencing factor is chlormezanone, an anxiolytic drug, a muscle relaxant and an antipsychotic agent whose clinical use was discontinued because of rare but serious cutaneous reactions. CHEBI:3619 This is any condition in which the main influencing factor is a negative control oligonucleotide. A negative control oligonucleotide is an oligonucleotide with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental oligonucleotide used. slaulederkind 2023-12-01T09:58:36Z scrambled control RNA oligomer scrambled control RNA oligonucleotide experimental_condition_ontology XCO:0001141 scrambled control oligonucleotide This is any condition in which the main influencing factor is a negative control oligonucleotide. A negative control oligonucleotide is an oligonucleotide with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental oligonucleotide used. https://en.wikipedia.org/wiki/Oligonucleotide https://www.oligotherapeutics.org/april-2019-paper-of-the-month/ This is any condition in which the main influencing factor is a MIR143 mimic transferred into an organism or cell culture. MIR143 mimic is a chemically modified double-stranded RNA molecule designed to mimic endogenous MIR143 function. MIR143 is associated with cardiovascular and other diseases. slaulederkind 2023-12-01T09:58:47Z transfection of MIR-143 mimic transfection of MIR143 mimic transfer of MIR-143 mimic transfer of miR143 mimic experimental_condition_ontology XCO:0001142 transfer of MIR143 mimic This is any condition in which the main influencing factor is a MIR143 mimic transferred into an organism or cell culture. MIR143 mimic is a chemically modified double-stranded RNA molecule designed to mimic endogenous MIR143 function. MIR143 is associated with cardiovascular and other diseases. RGD:1346221 https://www.thermofisher.com/us/en/home/life-science/epigenetics-noncoding-rna-research/mirna-analysis/mirna-mimics-inhibitors.html This is any condition in which the main influencing factor is Limosilactobacillus reuteri (a lactic acid bacterium). L. reuteri is a probiotic bacterium found in a variety of natural environments, including the gastrointestinal tract of humans and other animals. slaulederkind 2023-12-01T11:19:30Z PMID:37422471 L. reuteri Lactobacillus fermentum biotype II Lactobacillus reuteri experimental_condition_ontology XCO:0001143 Limosilactobacillus reuteri This is any condition in which the main influencing factor is Limosilactobacillus reuteri (a lactic acid bacterium). L. reuteri is a probiotic bacterium found in a variety of natural environments, including the gastrointestinal tract of humans and other animals. PMID:35336098 https://en.wikipedia.org/wiki/Limosilactobacillus_reuteri Thhis is any condition in which the main influencing factor is chlorpropamide, an N-sulfonylurea that is a hypoglycaemic agent used in the treatment of type 2 (non-insulin-dependent) diabetes mellitus not responding to dietary modification. slaulederkind 2023-12-04T11:26:47Z PMID:32119089 CID:2727 Chloropropamide experimental_condition_ontology XCO:0001144 chlorpropamide Thhis is any condition in which the main influencing factor is chlorpropamide, an N-sulfonylurea that is a hypoglycaemic agent used in the treatment of type 2 (non-insulin-dependent) diabetes mellitus not responding to dietary modification. CHEBI:3650 MESH:D002747 This is any condition in which the main influencing factor is cimetidine, an H2-receptor antagonist that inhibits gastric acid secretion, as well as pepsin and gastrin output. slaulederkind 2023-12-04T11:54:03Z CHEBI:3699 CID:2756 PMID:32119089 2-cyano-1-methyl-3-(2-{[(5-methyl-1H-imidazol-4-yl)methyl]sulfanyl}ethyl)guanidine Tagamet experimental_condition_ontology XCO:0001145 cimetidine This is any condition in which the main influencing factor is cimetidine, an H2-receptor antagonist that inhibits gastric acid secretion, as well as pepsin and gastrin output. MESH:D002927 This is any condition in which the main influencing factor is clarithromycin, a synthetic macrolide antibiotic used in the treatment of respiratory-tract, skin and soft-tissue infections. Clarithromycin is derived from erythromycin and is a protein synthesis inhibitor in bacteria. slaulederkind 2023-12-04T13:52:47Z CID:84029 Clarithromycine Clathromycin experimental_condition_ontology XCO:0001146 clarithromycin This is any condition in which the main influencing factor is clarithromycin, a synthetic macrolide antibiotic used in the treatment of respiratory-tract, skin and soft-tissue infections. Clarithromycin is derived from erythromycin and is a protein synthesis inhibitor in bacteria. CHEBI:3732 MESH:D017291 This is any condition whose main influencing factor is clofibrate, a fibric acid derivative used in the treatment of hyperlipoproteinemia type III and severe hypertriglyceridemia. slaulederkind 2023-12-04T14:05:02Z CHEBI:3750 CID:2796 PMID:32119089 ethyl 2-(4-chlorophenoxy)-2-methylpropanoate ethyl clofibrate experimental_condition_ontology XCO:0001147 clofibrate This is any condition whose main influencing factor is clofibrate, a fibric acid derivative used in the treatment of hyperlipoproteinemia type III and severe hypertriglyceridemia. MESH:D002994 This is any condition whose main influencing factor is clopidogrel, a ticlopidine analog and platelet P2Y12 receptor antagonist that inhibits adenosine diphosphate-mediated platelet aggregation. It is used to prevent thromboembolism in patients with arterial occlusive diseases. slaulederkind 2023-12-04T14:19:35Z CHEBI:37941 PMID:32119089 Plavix methyl (2S)-(2-chlorophenyl)(6,7-dihydrothieno[3,2-c]pyridin-5(4H)-yl)acetate experimental_condition_ontology XCO:0001148 clopidogrel This is any condition whose main influencing factor is clopidogrel, a ticlopidine analog and platelet P2Y12 receptor antagonist that inhibits adenosine diphosphate-mediated platelet aggregation. It is used to prevent thromboembolism in patients with arterial occlusive diseases. MESH:D000077144 This is any condition whose main influencing factor is clozapine, a tricylic dibenzodiazepinethat binds several types of central nervous system receptors. Clozapine is a serotonin antagonist, with strong binding to 5-HT 2A/2C receptor subtype. It also displays strong affinity to several dopaminergic receptors, but shows only weak antagonism at the dopamine D2 receptor. slaulederkind 2023-12-04T14:30:46Z CHEBI:3766 PMID:32119089 8-chloro-11-(4-methylpiperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine experimental_condition_ontology XCO:0001149 clozapine This is any condition whose main influencing factor is clozapine, a tricylic dibenzodiazepinethat binds several types of central nervous system receptors. Clozapine is a serotonin antagonist, with strong binding to 5-HT 2A/2C receptor subtype. It also displays strong affinity to several dopaminergic receptors, but shows only weak antagonism at the dopamine D2 receptor. MESH:D003024 This is any condition whose main influencing factor is compound Z, a pterin phosphate that is an oxidation product of cPMP (fosdenopterin). It is functionally related to a neopterin. Compound Z is a pharmacologically inactive product of fosdenopterin metabolism. slaulederkind 2023-12-04T14:51:06Z CHEBI:60211 PMID:32119089 2-amino-6-{[(4S,5R)-2,5-dihydroxy-2-oxido-1,3,2-dioxaphosphinan-4-yl]carbonyl}pteridin-4(3H)-one experimental_condition_ontology XCO:0001150 compound Z This is any condition whose main influencing factor is compound Z, a pterin phosphate that is an oxidation product of cPMP (fosdenopterin). It is functionally related to a neopterin. Compound Z is a pharmacologically inactive product of fosdenopterin metabolism. CID:135889290 This is any condition whose main influencing factor is Augmentin, a fixed-ratio combination of amoxicillin trihydrate and potassium clavulanate. Augmentin is a broad-spectrum antibiotic. slaulederkind 2023-12-04T15:22:17Z CID:23665637 MESH:D019980 PMID:32119089 Amoxicillin clavulanate potassium Amoxicillin-Clavulanic Acid Amoxycillin-Clavulanic Acid Clavamox co-amoxiclav experimental_condition_ontology XCO:0001151 Augmentin This is any condition whose main influencing factor is Augmentin, a fixed-ratio combination of amoxicillin trihydrate and potassium clavulanate. Augmentin is a broad-spectrum antibiotic. MESH:D019980 This is any condition whose main influencing factor is diltiazem, a benzothiazepine derivative that is a calcium-channel blocker and vasodilator. Diltiazem is used in the hydrochloride form in the management of angina pectoris and hypertension. slaulederkind 2023-12-04T15:40:48Z CID:39186 MESH:D004110 PMID:32119089 (2S,3S)-5-[2-(dimethylamino)ethyl]-2-(4-methoxyphenyl)-4-oxo-2,3,4,5-tetrahydro-1,5-benzothiazepin-3-yl acetate experimental_condition_ontology XCO:0001152 diltiazem This is any condition whose main influencing factor is diltiazem, a benzothiazepine derivative that is a calcium-channel blocker and vasodilator. Diltiazem is used in the hydrochloride form in the management of angina pectoris and hypertension. CHEBI:101278 This is any condition whose main influencing factor is diphenhydramine, an histamine H1 antagonist used for for hypersensitivity reactions, for pruritus, as a hypnotic, and as an ingredient in common cold preparations. slaulederkind 2023-12-04T15:53:25Z CHEBI:4636 CID:3100 PMID:32119089 2-(diphenylmethoxy)-N,N-dimethylethanamine Benedryl experimental_condition_ontology XCO:0001153 diphenhydramine This is any condition whose main influencing factor is diphenhydramine, an histamine H1 antagonist used for for hypersensitivity reactions, for pruritus, as a hypnotic, and as an ingredient in common cold preparations. MESH:D004155 This is any condition whose main influencing factor is dipyridamole, a phosphodiesterase inhibitor that blocks uptake and metabolism of adenosine by erythrocytes and vascular endothelial cells. Dipyridamole is an inhibitor of platelet aggregation and a vasodilator agent. slaulederkind 2023-12-05T12:10:08Z CID:3108 PMID:32119089 2,2',2'',2'''-[(4,8-dipiperidin-1-ylpyrimido[5,4-d]pyrimidine-2,6-diyl)dinitrilo]tetraethanol 2,6-Bis(diethanolamino)-4,8-dipiperidinopyrimido(5,4-d)pyrimidine experimental_condition_ontology XCO:0001154 dipyridamole This is any condition whose main influencing factor is dipyridamole, a phosphodiesterase inhibitor that blocks uptake and metabolism of adenosine by erythrocytes and vascular endothelial cells. Dipyridamole is an inhibitor of platelet aggregation and a vasodilator agent. CHEBI:4653 MESH:D004176 This is any condition whose main influencing factor is disopyramide, a sodium channel blocker and class I anti-arrhythmic agent with a depressant action on the heart similar to that of guanidine. Disopyramide also possesses some anticholinergic and local anesthetic properties. slaulederkind 2023-12-05T13:44:50Z CHEBI:4657 CID:3114 4-(diisopropylamino)-2-phenyl-2-pyridin-2-ylbutanamide experimental_condition_ontology XCO:0001155 disopyramide This is any condition whose main influencing factor is disopyramide, a sodium channel blocker and class I anti-arrhythmic agent with a depressant action on the heart similar to that of guanidine. Disopyramide also possesses some anticholinergic and local anesthetic properties. MESH:D004206 https://en.wikipedia.org/wiki/Disopyramide This is any condition whose main influencing factor is erythromycin, any of several wide-spectrum macrolide antibiotics obtained from actinomycete Saccharopolyspora erythraea (Streptomyces erythraeus). Erythromycin inhibits protein synthesis by binding to 50S ribosomal subunits, thus interfering with translocation of amino acids during translation and assembly of proteins slaulederkind 2023-12-05T13:56:45Z CID:12560 PMID:32119089 experimental_condition_ontology XCO:0001156 erythromycin This is any condition whose main influencing factor is erythromycin, any of several wide-spectrum macrolide antibiotics obtained from actinomycete Saccharopolyspora erythraea (Streptomyces erythraeus). Erythromycin inhibits protein synthesis by binding to 50S ribosomal subunits, thus interfering with translocation of amino acids during translation and assembly of proteins CHEBI:48923 MESH:D004917 This is any condition in which the main influencing factor is esomeprazole, an inhibitor of gastric acid secretion used for the treatment of gastro-oesophageal reflux disease, dyspepsia, peptic ulcer disease, and Zollinger-Ellison syndrome. slaulederkind 2023-12-05T14:18:05Z CID:9568614 MESH:D064098 experimental_condition_ontology XCO:0001157 esomeprazole This is any condition in which the main influencing factor is esomeprazole, an inhibitor of gastric acid secretion used for the treatment of gastro-oesophageal reflux disease, dyspepsia, peptic ulcer disease, and Zollinger-Ellison syndrome. CHEBI:50275 This is any condition whose main influencing factor is ethambutol, an ethylenediamine derivative that is an antimycobacterial drug, effective against Mycobacterium tuberculosis and some other mycobacteria. slaulederkind 2023-12-05T14:29:06Z CID:14052 MESH:D004977 PMID:32119089 (2S,2'S)-2,2'-(ethane-1,2-diyldiimino)dibutan-1-ol experimental_condition_ontology XCO:0001158 ethambutol This is any condition whose main influencing factor is ethambutol, an ethylenediamine derivative that is an antimycobacterial drug, effective against Mycobacterium tuberculosis and some other mycobacteria. CHEBI:4877 This is any condition whose main influencing factor is felbamate, a PEGylated phenylcarbamate derivative that acts as an antagonist of NMDA receptors. Felbamate is used as an anticonvulsant, primarily for the treatment of seizures in severe refractory epilepsy. slaulederkind 2023-12-07T11:57:35Z CHEBI:4995 PMID:32119089 2-phenylpropane-1,3-diyl dicarbamate experimental_condition_ontology XCO:0001159 felbamate This is any condition whose main influencing factor is felbamate, a PEGylated phenylcarbamate derivative that acts as an antagonist of NMDA receptors. Felbamate is used as an anticonvulsant, primarily for the treatment of seizures in severe refractory epilepsy. MESH:D000078328 This is any condition in which the main influencing factor is flucloxacillin, a penicillin anti-bacterial drug used to treat skin infections, external ear infections, infections of leg ulcers, diabetic foot infections, and infection of bone slaulederkind 2023-12-07T13:24:24Z CHEBI:5098 CID:21319 6beta-[3-(2-chloro-6-fluorophenyl)-5-methyl-1,2-oxazole-4-carboxamido]-2,2-dimethylpenam-3alpha-carboxylic acid Floxacillin experimental_condition_ontology XCO:0001160 flucloxacillin This is any condition in which the main influencing factor is flucloxacillin, a penicillin anti-bacterial drug used to treat skin infections, external ear infections, infections of leg ulcers, diabetic foot infections, and infection of bone MESH:D005436 https://en.wikipedia.org/wiki/Flucloxacillin This is any condition whose main influencing factor is fluoxetine, the first highly specific serotonin reuptake inhibitor (SSRI). It is used as an antidepressant and often has a more acceptable side-effects profile than traditional antidepressants. slaulederkind 2023-12-07T13:36:29Z CID:3386 Methyl({3-phenyl-3-[4-(trifluoromethyl)phenoxy]propyl})amine N-Methyl-3-(p-trifluoromethylphenoxy)-3-phenylpropylamine rac-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine experimental_condition_ontology XCO:0001161 fluoxetine This is any condition whose main influencing factor is fluoxetine, the first highly specific serotonin reuptake inhibitor (SSRI). It is used as an antidepressant and often has a more acceptable side-effects profile than traditional antidepressants. MESH:D005473 This is any condition in which the main influencing factor is flutamide ,a monocarboxylic acid amide which has a role as an androgen receptor antagonist and an antineoplastic agent. slaulederkind 2023-12-07T13:51:59Z CHEBI:5132 MESH:D005485 2-methyl-N-[4-nitro-3-(trifluoromethyl)phenyl]propanamide 4'-Nitro-3'-trifluoromethylisobutyranilide NFBA niftolid experimental_condition_ontology XCO:0001162 flutamide This is any condition in which the main influencing factor is flutamide ,a monocarboxylic acid amide which has a role as an androgen receptor antagonist and an antineoplastic agent. CID:3397 This is any condition whose main influencing factor is hydroxyzine, a histamine H1 receptor antagonist that is an anxiolytic drug, a dermatologic drug, an antipruritic drug and an anticoronaviral agent. slaulederkind 2023-12-07T14:15:00Z CHEBI:5818 PMID:32119089 2-(2-{4-[(4-chlorophenyl)(phenyl)methyl]piperazin-1-yl}ethoxy)ethanol experimental_condition_ontology XCO:0001163 hydroxyzine This is any condition whose main influencing factor is hydroxyzine, a histamine H1 receptor antagonist that is an anxiolytic drug, a dermatologic drug, an antipruritic drug and an anticoronaviral agent. CID:3658 MESH:D006919 This is any condition whose main influencing factor is labetalol, a salicylamide derivative that is a non-cardioselective blocker of beta-adrenergic receptors and alpha-1 adrenergic receptors used to treat high blood pressure. slaulederkind 2023-12-07T15:57:48Z CID:3869 PMID:32119089 2-hydroxy-5-{1-hydroxy-2-[(1-methyl-3-phenylpropyl)amino]ethyl}benzamide 3-Carboxamido-4-hydroxy-alpha-((1-methyl-3-phenylpropylamino)methyl)benzyl alcohol kabetalol experimental_condition_ontology XCO:0001164 labetalol This is any condition whose main influencing factor is labetalol, a salicylamide derivative that is a non-cardioselective blocker of beta-adrenergic receptors and alpha-1 adrenergic receptors used to treat high blood pressure. CHEBI:6343 MESH:D007741 This is any condition whose main influencing factor is lapatinib, a quinazoline derivative that inhibits epidermal growth factor receptor (Egfr) and erb-b2 receptor tyrosine kinase 2 (Erbb2/Her2) tyrosine kinases. It is used for the treatment of advanced or metastatic breast cancer, where tumors overexpress Erbb2/Her2. slaulederkind 2023-12-07T19:22:36Z CHEBI:49603 CID:208908 N-[3-chloro-4-(3-fluorobenzyloxy)phenyl]-6-[5-({[2-(methanesulfonyl)ethyl]amino}methyl)furan-2-yl]quinazolin-4-amine lapatinib ditosylate experimental_condition_ontology XCO:0001165 lapatinib This is any condition whose main influencing factor is lapatinib, a quinazoline derivative that inhibits epidermal growth factor receptor (Egfr) and erb-b2 receptor tyrosine kinase 2 (Erbb2/Her2) tyrosine kinases. It is used for the treatment of advanced or metastatic breast cancer, where tumors overexpress Erbb2/Her2. MESH:D000077341 This is any condition in which the main influencing factor is hydroxypropyl methylcellulose, a semisynthetic, inert, viscoelastic polymer used in eye drops, as well as an excipient and controlled-delivery component in oral medicaments, found in a variety of commercial products. slaulederkind 2023-12-07T19:37:18Z CHEBI:30618 (hydroxypropyl)methyl cellulose HPMC hydroxypropyl methyl cellulose hypromellose experimental_condition_ontology XCO:0001166 hydroxypropyl methylcellulose This is any condition in which the main influencing factor is hydroxypropyl methylcellulose, a semisynthetic, inert, viscoelastic polymer used in eye drops, as well as an excipient and controlled-delivery component in oral medicaments, found in a variety of commercial products. https://en.wikipedia.org/wiki/Hypromellose This is any condition in which the main influencing factor is any poly(ethylene glycol) derivative composed of PEG-ylated sorbitan [2-(1,2-dihydroxyethyl)tetrahydrofuran-3,4-diol] normally containing a total of 20 oxyethylene groups, with one or more of the terminal hydroxy groups esterified with a fatty acyl group. They are used as emulsifiers and dispersing agents in some pharmaceuticals products and as defoamers and emulsifiers in some foods. slaulederkind 2023-12-07T19:52:38Z polysorbates tweens experimental_condition_ontology XCO:0001167 polysorbate This is any condition in which the main influencing factor is any poly(ethylene glycol) derivative composed of PEG-ylated sorbitan [2-(1,2-dihydroxyethyl)tetrahydrofuran-3,4-diol] normally containing a total of 20 oxyethylene groups, with one or more of the terminal hydroxy groups esterified with a fatty acyl group. They are used as emulsifiers and dispersing agents in some pharmaceuticals products and as defoamers and emulsifiers in some foods. CHEBI:53422 This is any condition in which the main influencing factor is polysorbate 80, a polymer composed of PEG-ylated sorbitan and oleic acid. Polysorbate 80 is a nonionic surfactant and emulsifier often used in pharmaceuticals, foods, and cosmetics. slaulederkind 2023-12-07T20:01:09Z (x)-sorbitan mono-9-octadecenoate poly(oxy-1,2-ethanediyl) Kolliphor PS 80 PS 80 Tween 80 polyoxyethylene (80) sorbitan monooleate experimental_condition_ontology XCO:0001168 polysorbate 80 This is any condition in which the main influencing factor is polysorbate 80, a polymer composed of PEG-ylated sorbitan and oleic acid. Polysorbate 80 is a nonionic surfactant and emulsifier often used in pharmaceuticals, foods, and cosmetics. CHEBI:53426 https://en.wikipedia.org/wiki/Polysorbate_80 This is any condition in which the vehicle is made up of deionized water and a specified amount of ethanol, serving as a solvent for some specified chemical. slaulederkind 2023-12-07T22:13:55Z ethanol in deionized water used as vehicle experimental_condition_ontology XCO:0001169 controlled ethanol content deionized water used as vehicle This is any condition in which the vehicle is made up of deionized water and a specified amount of ethanol, serving as a solvent for some specified chemical. https://www.merriam-webster.com/ This is any condition whose main influencing factor is levofloxacin, a fluoroquinolone antibiotic with activity against both gram-negative and gram-positive bacteria compared to R-(+)-ofloxacin and remains stereochemically stable following administration (i.e. it does not invert to the inactive isomer). Levofloxacin is an inhibitor of bacterial topoisomerase IV and DNA gyrase. slaulederkind 2023-12-08T14:26:27Z CHEBI:63598 MESH:D064704 (3S)-9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid experimental_condition_ontology XCO:0001170 levofloxacin true This is any condition whose main influencing factor is levofloxacin, a fluoroquinolone antibiotic with activity against both gram-negative and gram-positive bacteria compared to R-(+)-ofloxacin and remains stereochemically stable following administration (i.e. it does not invert to the inactive isomer). Levofloxacin is an inhibitor of bacterial topoisomerase IV and DNA gyrase. CID:149096 This is any condition whose main influencing factor is levofloxacin, a fluoroquinolone antibiotic that is active against both gram-negative and gram-positive bacteria. Levofloxacin is an inhibitor of both bacterial topoisomerase IV and DNA gyrase. slaulederkind 2023-12-08T15:45:16Z XCO:0001170 CHEBI:63598 MESH:D064704 (3S)-9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid experimental_condition_ontology XCO:0001171 levofloxacin This is any condition whose main influencing factor is levofloxacin, a fluoroquinolone antibiotic that is active against both gram-negative and gram-positive bacteria. Levofloxacin is an inhibitor of both bacterial topoisomerase IV and DNA gyrase. CHEBI:63598 CID:149096 This is any condition in which the main influencing factor is lopinavir, an HIV protease inhibitor used in a fixed-dose combination with ritonavir. Lopinavir is also a cytochrome P-450 inhibitor. slaulederkind 2023-12-08T16:01:36Z CHEBI:31781 CID:92727 (2S)-N-[(2S,4S,5S)-5-{[(2,6-dimethylphenoxy)acetyl]amino}-4-hydroxy-1,6-diphenylhexan-2-yl]-3-methyl-2-(2-oxotetrahydropyrimidin-1(2H)-yl)butanamide LPV experimental_condition_ontology XCO:0001172 lopinavir This is any condition in which the main influencing factor is lopinavir, an HIV protease inhibitor used in a fixed-dose combination with ritonavir. Lopinavir is also a cytochrome P-450 inhibitor. MESH:D061466 This is any condition in which the main influencing factor is loracarbef, a carbacephem antibiotic used to treat a wide range of infections caused by both gram-positive and gram-negative bacteria. slaulederkind 2023-12-08T16:13:54Z CHEBI:47544 7beta-[(2R)-2-amino-2-phenylacetyl]nitrilo-3-chloro-3,4-didehydrocepham-4-carboxylic acid loracarbef anhydrous experimental_condition_ontology XCO:0001173 loracarbef This is any condition in which the main influencing factor is loracarbef, a carbacephem antibiotic used to treat a wide range of infections caused by both gram-positive and gram-negative bacteria. CID:5284585 This is any condition whose main influencing factor is lumiracoxib, a highly selective cyclooxygenase 2 inhibitor used for the treatment of osteoarthritis until it was withdrawn from use due to concerns of hepatotoxicity. slaulederkind 2023-12-08T16:29:47Z CID:151166 MESH:C473384 PMID:32119089 LUR lumiracoxibum {2-[(2-chloro-6-fluorophenyl)amino]-5-methylphenyl}acetic acid experimental_condition_ontology XCO:0001174 lumiracoxib This is any condition whose main influencing factor is lumiracoxib, a highly selective cyclooxygenase 2 inhibitor used for the treatment of osteoarthritis until it was withdrawn from use due to concerns of hepatotoxicity. CHEBI:73044 This is any condition in which the main influencing factor is acetone, a methyl ketone that consists of propane bearing an oxo group at C2. Acetone is used as a solvent and an antiseptic. It is one of the ketone bodies produced during ketoacidosis. Acetone is used to make drugs and other chemicals. slaulederkind 2023-12-08T19:35:08Z MESH:D000096 2-propanal 2-propanone beta-ketopropane dimethyl ketone propan-2-one experimental_condition_ontology XCO:0001175 acetone This is any condition in which the main influencing factor is acetone, a methyl ketone that consists of propane bearing an oxo group at C2. Acetone is used as a solvent and an antiseptic. It is one of the ketone bodies produced during ketoacidosis. Acetone is used to make drugs and other chemicals. CHEBI:15347 CID:180 This is any condition whose main influencing factor is LY2886721, an inhibitor of protease beta-secretase 1 (BACE1), which is a key protease controlling the formation of amyloid &#946; (a peptide hypothesized to play a significant role in the pathogenesis of Alzheimer's disease). slaulederkind 2023-12-09T10:23:21Z CID:49837968 PMID:32119089 LY-2886721 N-(3-((4aS,7aS)-2-amino-4a,5,7,7a-tetrahydro-4H-furo[3,4-d][1,3]thiazin-7a-yl)-4-fluorophenyl)-5-fluoropicolinamide experimental_condition_ontology XCO:0001176 LY2886721 This is any condition whose main influencing factor is LY2886721, an inhibitor of protease beta-secretase 1 (BACE1), which is a key protease controlling the formation of amyloid &#946; (a peptide hypothesized to play a significant role in the pathogenesis of Alzheimer's disease). PMID:25609634 This is any condition in which the main influencing factor is megestrol, a 3-oxo Delta(4)-steroid that is a progestational hormone used most commonly as the acetate ester. As the acetate, it is more potent than progesterone both as a progestagen and as an ovulation inhibitor. Megestrol has also been used in the palliative treatment of breast cancer and as an appetite enhancer in cachectic subjects. slaulederkind 2023-12-09T10:34:00Z CID:19090 PMID:32119089 17-Hydroxy-6-methylpregna-4,6-diene-3,20-dione 6-Methyl-17-hydroxypregna-4,6-diene-3,20-dione Pregna-4,6-diene-3,20-dione, 17-hydroxy-6-methyl- experimental_condition_ontology XCO:0001177 megestrol This is any condition in which the main influencing factor is megestrol, a 3-oxo Delta(4)-steroid that is a progestational hormone used most commonly as the acetate ester. As the acetate, it is more potent than progesterone both as a progestagen and as an ovulation inhibitor. Megestrol has also been used in the palliative treatment of breast cancer and as an appetite enhancer in cachectic subjects. CHEBI:6722 MESH:D008535 This is any condition in which the main influencing factor is methimazole, a thioureylene antithyroid agent that inhibits the formation of thyroid hormones by interfering with the incorporation of iodine into tyrosyl residues of thyroglobulin through inhibition of the peroxidase enzyme. slaulederkind 2023-12-09T11:24:32Z CHEBI:50673 CID:1349907 1-Methyl-2-mercaptoimidazole 1-Methylimidazole-2-thiol 2-Mercapto-1-methylimidazole experimental_condition_ontology XCO:0001178 methimazole This is any condition in which the main influencing factor is methimazole, a thioureylene antithyroid agent that inhibits the formation of thyroid hormones by interfering with the incorporation of iodine into tyrosyl residues of thyroglobulin through inhibition of the peroxidase enzyme. MESH:D008713 This is any condition in which the main influencing factor is iopromide, an organoiodine compound and a dicarboxylic acid diamide used as an x-ray contrast agent for angiography. Iopromide is also a nephrotoxic agent. slaulederkind 2023-12-11T15:49:02Z CHEBI:63578 MESH:C038192 N,N'-bis(2,3-dihydroxypropyl)-2,4,6-triiodo-5-[(methoxyacetyl)amino]-N-methylisophthalamide iopromid experimental_condition_ontology XCO:0001179 iopromide This is any condition in which the main influencing factor is iopromide, an organoiodine compound and a dicarboxylic acid diamide used as an x-ray contrast agent for angiography. Iopromide is also a nephrotoxic agent. CID:3736 This is any condition in which the major influencing factor is OC43p, a synthetic peptide whose sequence (VSKIVHFFKTFTTSTALAFA) is derived from the Human coronavirus OC43 gene ORF1ab/ORF1ab polyprotein. This sequence is homologous to the myelin basic protein pronociceptive peptide MBP84-104 from human/rat. slaulederkind 2023-12-11T16:45:35Z OC43:653-673 VSKIVHFFKTFTTSTALAFA human coronavirus OC43&#8208;encoded polypeptide experimental_condition_ontology MHV p65-like protein ORF1a polyprotein ORF1ab polyprotein polyprotein pp1a polyprotein pp1ab XCO:0001180 OC43p This is any condition in which the major influencing factor is OC43p, a synthetic peptide whose sequence (VSKIVHFFKTFTTSTALAFA) is derived from the Human coronavirus OC43 gene ORF1ab/ORF1ab polyprotein. This sequence is homologous to the myelin basic protein pronociceptive peptide MBP84-104 from human/rat. PMID:35466531 This is any condition in which the major influencing factor is OC43p-SCR, a synthetic peptide whose sequence (VFIAHSVKFTKSFTLATTFA) is a scrambled version of OC43p, a peptide derived from the Human coronavirus OC43 gene ORF1ab/ORF1ab polyprotein. This OC43p&#8208;SCR sequence is used as an experimental control for OC43p. slaulederkind 2023-12-11T17:22:19Z OC43p&#8208;SCR1 VFIAHSVKFTKSFTLATTFA experimental_condition_ontology XCO:0001181 OC43p&#8208;SCR This is any condition in which the major influencing factor is OC43p-SCR, a synthetic peptide whose sequence (VFIAHSVKFTKSFTLATTFA) is a scrambled version of OC43p, a peptide derived from the Human coronavirus OC43 gene ORF1ab/ORF1ab polyprotein. This OC43p&#8208;SCR sequence is used as an experimental control for OC43p. PMID:35466531 This is any condition in which the main influencing factor is methyldopa, a centrally acting sympatholytic agent and an antihypertensive agent. It is an analog of DOPA (3,4&#8208;hydroxyphenylanine), and it is a prodrug, meaning that the drug requires biotransformation to an active metabolite for therapeutic effects. Methyldopa is in the alpha-2 adrenergic receptor agonist family of medications. It works by stimulating the brain to decrease the activity of the sympathetic nervous system. slaulederkind 2023-12-12T13:26:35Z MESH:D008750 &#945;-methyldopa alpha medopa alpha-methyl-L-dopa alphamethyldopa experimental_condition_ontology XCO:0001182 methyldopa This is any condition in which the main influencing factor is methyldopa, a centrally acting sympatholytic agent and an antihypertensive agent. It is an analog of DOPA (3,4&#8208;hydroxyphenylanine), and it is a prodrug, meaning that the drug requires biotransformation to an active metabolite for therapeutic effects. Methyldopa is in the alpha-2 adrenergic receptor agonist family of medications. It works by stimulating the brain to decrease the activity of the sympathetic nervous system. CID:38853 https://en.wikipedia.org/wiki/Methyldopa This is any condition in which the main influencing factor is metiamide, a histamine H2 receptor antagonist developed from another H2 antagonist, burimamide. It was an intermediate compound in the development of the successful anti-ulcer drug cimetidine. slaulederkind 2023-12-12T13:48:07Z CHEBI:6896 CID:1548992 PMID:32119089 1-Methyl-3-(2-{[(5-methyl-1H-imidazol-4-yl)methyl]thio}ethyl)thiourea N-Methyl-N'-(2-{[(5-methyl-1H-imidazol-4-yl)methyl]sulfanyl}ethyl)thiourea methiamide experimental_condition_ontology XCO:0001183 metiamide This is any condition in which the main influencing factor is metiamide, a histamine H2 receptor antagonist developed from another H2 antagonist, burimamide. It was an intermediate compound in the development of the successful anti-ulcer drug cimetidine. https://en.wikipedia.org/wiki/Metiamide This is any condition in which the main influencing factor is mibefradil, a benzimidazoyl-substituted tetralin that selectively binds and inhibits T-type calcium channels. Mibefradil is a vasodilator and antihypertensive agent. slaulederkind 2023-12-12T14:02:56Z CHEBI:6920 CID:60663 Acetic acid, methoxy-, 2-(2-((3-(1H-benzimidazol-2-yl)propyl)methylamino)ethyl)-6-fluoro-1,2,3,4-tetrahydro-1-(1-methylethyl)-2-naphthalenyl ester, (1S-cis)- [(1S,2S)-2-[2-[3-(1H-benzimidazol-2-yl)propyl-methylamino]ethyl]-6-fluoro-1-propan-2-yl-3,4-dihydro-1H-naphthalen-2-yl] 2-methoxyacetate experimental_condition_ontology XCO:0001184 mibefradil This is any condition in which the main influencing factor is mibefradil, a benzimidazoyl-substituted tetralin that selectively binds and inhibits T-type calcium channels. Mibefradil is a vasodilator and antihypertensive agent. MESH:D020748 This is any condition in which the main influencing factor is MK-0773, an experimental drug that was under development for the treatment of sarcopenia. MK-0773 is a 4-azasteroid and agonist of the androgen receptor (SARM, selective androgen receptor modulator). slaulederkind 2023-12-12T14:42:14Z CID:11950726 PMID:32119089 (1S,3aS,3bS,5aR,9aS,9bS,11aS)-8-fluoro-N-(1H-imidazo[4,5-b]pyridin-2-ylmethyl)-6,9a,11a-trimethyl-7-oxo-2,3,3a,3b,4,5,5a,9b,10,11-decahydro-1H-indeno[5,4-f]quinoline-1-carboxamide PF-05314882 experimental_condition_ontology XCO:0001185 MK-0773 This is any condition in which the main influencing factor is MK-0773, an experimental drug that was under development for the treatment of sarcopenia. MK-0773 is a 4-azasteroid and agonist of the androgen receptor (SARM, selective androgen receptor modulator). https://en.wikipedia.org/wiki/MK-0773 This is any condition in which the main influencing factor is MK-03207, a highly potent calcitonin gene-related peptide (CGRP) receptor antagonist designed to be an antimigraine therapeutic. slaulederkind 2023-12-12T14:57:03Z CID:25019940 2-((8R)-8-(3,5-Difluorophenyl)-10-oxo-6,9-diazaspiro(4.5)dec-9-yl)-N-((2R)-2'-oxo-1,1',2',3-tetrahydrospiro(indene-2,3'-pyrrolo(2,3-b)pyridin)-5-yl)acetamide MK3207 experimental_condition_ontology XCO:0001186 MK-3207 This is any condition in which the main influencing factor is MK-03207, a highly potent calcitonin gene-related peptide (CGRP) receptor antagonist designed to be an antimigraine therapeutic. PMID:24900170 This is any condition in which the main influencing factor is ampicillin, a semi-synthetic derivative of penicillin that functions as an orally active broad-spectrum antibiotic. Ampicillin is a penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-phenylacetamido group. slaulederkind 2023-12-14T12:00:21Z CHEBI:28971 MESH:D000667 6beta-[(2R)-2-amino-2-phenylacetamido]-2,2-dimethylpenam-3alpha-carboxylic acid aminobenzylpenicillin experimental_condition_ontology XCO:0001187 ampicillin This is any condition in which the main influencing factor is ampicillin, a semi-synthetic derivative of penicillin that functions as an orally active broad-spectrum antibiotic. Ampicillin is a penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-phenylacetamido group. CID:6249 This is any condition in which the main influencing factor is neomycin sulfate, the sulfate salt form of neomycin, a broad spectrum aminoglycoside antibiotic derived from Streptomyces fradiae with antibacterial activity. Neomycin is an antibiotic complex consisting of 3 components: the two isomeric components B and C are the active components, and neomycin A is the minor component. Neomycin is a protein synthesis inhibitor and bacteriacidal agent. slaulederkind 2023-12-14T13:05:10Z CHEBI:31635 PMID:32119089 SID:483925982 experimental_condition_ontology XCO:0001188 neomycin sulfate This is any condition in which the main influencing factor is neomycin sulfate, the sulfate salt form of neomycin, a broad spectrum aminoglycoside antibiotic derived from Streptomyces fradiae with antibacterial activity. Neomycin is an antibiotic complex consisting of 3 components: the two isomeric components B and C are the active components, and neomycin A is the minor component. Neomycin is a protein synthesis inhibitor and bacteriacidal agent. CID:62403 This is any condition in which the main influencing factor is metronidazole, a commonly used antibiotic, belonging to the nitroimidazole class of antibiotics. Metronidazole is frequently used to treat gastrointestinal infections and parasitic infections such as trichomoniasis, giardiasis, and amebiasis. The antiparasitic of properties of metronidazole set it apart from many other antibacterial drugs, allowing it to treat a wider variety of infections. slaulederkind 2023-12-14T13:22:30Z CHEBI:6909 MESH:D008795 2-(2-methyl-5-nitro-1H-imidazol-1-yl)ethanol experimental_condition_ontology XCO:0001189 metronidazole This is any condition in which the main influencing factor is metronidazole, a commonly used antibiotic, belonging to the nitroimidazole class of antibiotics. Metronidazole is frequently used to treat gastrointestinal infections and parasitic infections such as trichomoniasis, giardiasis, and amebiasis. The antiparasitic of properties of metronidazole set it apart from many other antibacterial drugs, allowing it to treat a wider variety of infections. CID:4173 This is any condition in which the main influencing factor is amphotericin B, macrolide antifungal and antiprotozoal antibiotic produced by Streptomyces nodosus. slaulederkind 2023-12-14T13:36:38Z CHEBI:2682 (1R,3S,5R,6R,9R,11R,15S,16R,17R,18S,19E,21E,23E,25E,27E,29E,31E,33R,35S,36R,37S)-33-[(3-amino-3,6-dideoxy-beta-D-mannopyranosyl)oxy]-1,3,5,6,9,11,17,37-octahydroxy-15,16,18-trimethyl-13-oxo-14,39-dioxabicyclo[33.3.1]nonatriaconta-19,21,23,25,27,29,31-heptaene-36-carboxylic acid amphotericin experimental_condition_ontology XCO:0001190 amphotericin B This is any condition in which the main influencing factor is amphotericin B, macrolide antifungal and antiprotozoal antibiotic produced by Streptomyces nodosus. CID:5280965 MESH:D000666 This is any condition in which the main influencing factor is nabumetone, a prodrug that is converted to the active metabolite, 6-methoxy-2-naphthylacetic acid. Nabumetone is a methyl ketone non-steroidal anti-inflammatory drug and cyclooxygenase-2 (COX2) inhibitor that is used in the management of pain associated with osteoarthritis and rheumatoid arthritis. slaulederkind 2023-12-15T11:08:39Z CID:4409 PMID:32119089 4-(6-Methoxy-2-naphthyl)-2-butanone 4-(6-methoxynaphthalen-2-yl)butan-2-one Relafen experimental_condition_ontology XCO:0001191 nabumetone This is any condition in which the main influencing factor is nabumetone, a prodrug that is converted to the active metabolite, 6-methoxy-2-naphthylacetic acid. Nabumetone is a methyl ketone non-steroidal anti-inflammatory drug and cyclooxygenase-2 (COX2) inhibitor that is used in the management of pain associated with osteoarthritis and rheumatoid arthritis. CHEBI:7443 MESH:D000077430 This is any condition in which the main influencing factor is nadolol, a non-selective beta-adrenergic antagonist with a long half-life, used in cardiovascular disease to treat arrhythmias, angina pectoris, and hypertension. Nadolol is also used to treat vascular headaches. slaulederkind 2023-12-15T11:34:46Z CHEBI:7444 rac-(2R,3S)-5-[3-(tert-butylamino)-2-hydroxypropoxy]-1,2,3,4-tetrahydronaphthalene-2,3-diol experimental_condition_ontology XCO:0001192 nadolol This is any condition in which the main influencing factor is nadolol, a non-selective beta-adrenergic antagonist with a long half-life, used in cardiovascular disease to treat arrhythmias, angina pectoris, and hypertension. Nadolol is also used to treat vascular headaches. CID:39147 MESH:D009248 This is any condition in which the main influencing factor is naproxen, a methoxynaphthalene that is 2-methoxynaphthalene substituted by a carboxy ethyl group at position 6. Naproxen is a non-steroidal anti-inflammatory drug commonly used for the reduction of pain, fever, inflammation and stiffness. Naproxen inhibits both the COX-1 and COX-2 enzymes. slaulederkind 2023-12-15T11:49:04Z CID:156391 MESH:D009288 (2S)-2-(6-methoxynaphthalen-2-yl)propanoic acid (S)-(+)-2-(6-Methoxy-2-naphthyl)propionic acid experimental_condition_ontology XCO:0001193 naproxen This is any condition in which the main influencing factor is naproxen, a methoxynaphthalene that is 2-methoxynaphthalene substituted by a carboxy ethyl group at position 6. Naproxen is a non-steroidal anti-inflammatory drug commonly used for the reduction of pain, fever, inflammation and stiffness. Naproxen inhibits both the COX-1 and COX-2 enzymes. CHEBI:7476 This is any condition in which the main influencing factor is NB-360, a dual BACE1/BACE2 (beta-secretase 1/beta-secretase 2) inhibitor that stops the progression of amyloid-&#946; (A&#946;) deposition and reduces neuroinflammation. slaulederkind 2023-12-15T15:38:28Z CAS:1262857-73-7 CID:66665322 PMID:32119089 experimental_condition_ontology NB-360 HCl XCO:0001194 NB-360 This is any condition in which the main influencing factor is NB-360, a dual BACE1/BACE2 (beta-secretase 1/beta-secretase 2) inhibitor that stops the progression of amyloid-&#946; (A&#946;) deposition and reduces neuroinflammation. https://www.medchemexpress.com/nb-360.html This is any condition in which the main influencing factor is nefazodone, an aromatic ether with multiple roles, including that of an antidepressant, a serotonergic antagonist, a serotonin uptake inhibitor, an alpha-adrenergic antagonist and an analgesic. slaulederkind 2023-12-28T13:14:53Z CHEBI:7494 MESH:C051752 2-{3-[4-(3-chlorophenyl)piperazin-1-yl]propyl}-5-ethyl-4-(2-phenoxyethyl)-2,4-dihydro-3H-1,2,4-triazol-3-one experimental_condition_ontology XCO:0001195 nefazodone This is any condition in which the main influencing factor is nefazodone, an aromatic ether with multiple roles, including that of an antidepressant, a serotonergic antagonist, a serotonin uptake inhibitor, an alpha-adrenergic antagonist and an analgesic. CID:4449 This is any condition in which the main influencing factor is an ether, any of a class of compounds that contain an ether group, an oxygen atom connected to two alkyl or aryl groups. They have the general formula R&#8722;O&#8722;R&#8242;, where R and R&#8242; represent the alkyl or aryl groups. slaulederkind 2023-12-28T13:36:58Z CHEBI:25698 MESH:D004987 experimental_condition_ontology XCO:0001196 ethers This is any condition in which the main influencing factor is an ether, any of a class of compounds that contain an ether group, an oxygen atom connected to two alkyl or aryl groups. They have the general formula R&#8722;O&#8722;R&#8242;, where R and R&#8242; represent the alkyl or aryl groups. https://en.wikipedia.org/wiki/Ether This is any condition in which the main influencing factor is nevirapine, a non-nucleoside reverse transcriptase inhibitor (NNRTI) used in combination with nucleoside analogues for treatment of Human Immunodeficiency Virus Type 1 (HIV-1) infections and acquired immunodeficiency syndrome (AIDS). slaulederkind 2023-12-28T13:52:45Z CHEBI:63613 11-Cyclopropyl-4-methyl-5,11-dihydro-6H-dipyrido[3,2-b:2',3'-e][1,4]diazepin-6-one 2-cyclopropyl-7-methyl-2,4,9,15-tetraazatricyclo[9.4.0.0^{3,8}]pentadeca-1(11),3,5,7,12,14-hexaen-10-one experimental_condition_ontology XCO:0001197 nevirapine This is any condition in which the main influencing factor is nevirapine, a non-nucleoside reverse transcriptase inhibitor (NNRTI) used in combination with nucleoside analogues for treatment of Human Immunodeficiency Virus Type 1 (HIV-1) infections and acquired immunodeficiency syndrome (AIDS). CID:4463 MESH:D019829 This is any condition in which the main influencing factor is nitrofurantoin, a urinary anti-bacterial agent effective against most gram-positive and gram-negative organisms. Nitrofurantoin is converted by bacterial nitroreductases to electrophilic intermediates which inhibit the citric acid cycle as well as synthesis of DNA, RNA, and protein. slaulederkind 2023-12-28T14:15:53Z CHEBI:71415 1-{[(5-nitro-2-furyl)methylene]amino}imidazolidine-2,4-dione experimental_condition_ontology XCO:0001198 nitrofurantoin This is any condition in which the main influencing factor is nitrofurantoin, a urinary anti-bacterial agent effective against most gram-positive and gram-negative organisms. Nitrofurantoin is converted by bacterial nitroreductases to electrophilic intermediates which inhibit the citric acid cycle as well as synthesis of DNA, RNA, and protein. CID:6604200 MESH:D009582 This is any condition in which the main influencing factor is oxandrolone, a synthetic, anabolic steroid hormone analog of testosterone. slaulederkind 2023-12-29T11:30:06Z CHEBI:7820 MESH:D010074 17beta-hydroxy-17alpha-methyl-2-oxa-5alpha-androstan-3-one DODECAHYDRO-3-HYDROXY-6-(HYDROXY-METHYL)-3,3A,6-TRIMETH YL-1H-BENZ experimental_condition_ontology XCO:0001199 oxandrolone This is any condition in which the main influencing factor is oxandrolone, a synthetic, anabolic steroid hormone analog of testosterone. CID:5878 This is any condition in which the main influencing factor is panadiplon (U-78875), an anxiolytic drug with a novel chemical structure. Panadiplon has a similar pharmacological profile to the benzodiazepine family of drugs, but with mainly anxiolytic properties and relatively little sedative or amnestic effect, and so is classified as a nonbenzodiazepine anxiolytic. slaulederkind 2023-12-29T12:44:41Z CAS:124423-84-3 CID:3033821 U-78875 experimental_condition_ontology XCO:0001200 panadiplon This is any condition in which the main influencing factor is panadiplon (U-78875), an anxiolytic drug with a novel chemical structure. Panadiplon has a similar pharmacological profile to the benzodiazepine family of drugs, but with mainly anxiolytic properties and relatively little sedative or amnestic effect, and so is classified as a nonbenzodiazepine anxiolytic. https://en.wikipedia.org/wiki/Panadiplon This is any condition in which the main influencing factor is paroxetine, a serotonin uptake inhibitor that is effective in the treatment of depression and anxiety. slaulederkind 2023-12-29T13:24:50Z CID:43815 MESH:D017374 (3S,4R)-3-[(1,3-benzodioxol-5-yloxy)methyl]-4-(4-fluorophenyl)piperidine Piperidine, 3-((1,3-benzodioxol-5-yloxy)methyl)-4-(4-fluorophenyl)-, (3S,4R)- experimental_condition_ontology XCO:0001201 paroxetine This is any condition in which the main influencing factor is paroxetine, a serotonin uptake inhibitor that is effective in the treatment of depression and anxiety. CHEBI:7936 This is any condition in which the main influencing factor is a penicillin, one of a group of β-lactam antibiotics originally obtained from Penicillium molds. Penicillins are widely used for different bacterial infections, though many types of bacteria have developed resistance following extensive use. slaulederkind 2023-12-29T13:38:29Z CHEBI:17334 MESH:D010406 PMID:32119089 P PCN PEN penicillins penicillin G penicillin V experimental_condition_ontology XCO:0001202 penicillin This is any condition in which the main influencing factor is a penicillin, one of a group of β-lactam antibiotics originally obtained from Penicillium molds. Penicillins are widely used for different bacterial infections, though many types of bacteria have developed resistance following extensive use. https://en.wikipedia.org/wiki/Penicillin This is any condition in which the main influencing factor is phenobarbital, a barbiturate that acts as a nonselective central nervous system depressant. Phenobarbital potentiates GABA action on GABA-A receptors, modulates chloride currents through receptor channels, and inhibits glutamate induced depolarizations. slaulederkind 2023-12-29T17:24:51Z CID:4763 MESH:D010634 Luminal phenobarb phenobarbitone experimental_condition_ontology XCO:0001203 phenobarbital This is any condition in which the main influencing factor is phenobarbital, a barbiturate that acts as a nonselective central nervous system depressant. Phenobarbital potentiates GABA action on GABA-A receptors, modulates chloride currents through receptor channels, and inhibits glutamate induced depolarizations. MESH:D010634 This is any condition in which the main influencing factor is pentoxifylline, a synthetic dimethylxanthine derivative that inhibits phosphodiesterase and affects blood rheology. It improves blood flow by increasing erythrocyte and leukocyte flexibility. Pentoxifylline has both anti-oxidant and anti-inflammatory properties. slaulederkind 2024-01-02T14:30:47Z CHEBI:7986 PMID:32119089 3,7-Dihydro-3,7-dimethyl-1-(5-oxohexyl)-1H-purine-2,6-dione 3,7-dimethyl-1-(5-oxohexyl)purine-2,6-dione PTX experimental_condition_ontology XCO:0001204 pentoxifylline This is any condition in which the main influencing factor is pentoxifylline, a synthetic dimethylxanthine derivative that inhibits phosphodiesterase and affects blood rheology. It improves blood flow by increasing erythrocyte and leukocyte flexibility. Pentoxifylline has both anti-oxidant and anti-inflammatory properties. CID:4740 MESH:D010431 This is any condition in which the main influencing factor is perhexiline maleate, a coronary vasodilator used as a prophylactic antianginal agent. Perhexiline inhibits mitochondrial carnitine palmitoyltransferase-1 and -2. slaulederkind 2024-01-02T14:59:49Z CID:5284439 PMID:32119089 2-(2,2-dicyclohexylethyl)piperidine Piperidine, 2-(2,2-dicyclohexylethyl)- perhexiline experimental_condition_ontology XCO:0001205 perhexiline maleate This is any condition in which the main influencing factor is perhexiline maleate, a coronary vasodilator used as a prophylactic antianginal agent. Perhexiline inhibits mitochondrial carnitine palmitoyltransferase-1 and -2. MESH:D010480 PMID:37110858 This is any condition in which the main influencing factor is probenecid, the prototypical uricosuric agent, a drug that promotes the excretion of uric acid. Probenecid inhibits the renal excretion of organic anions and reduces tubular reabsorption of urate. Because probenecid reduces the renal tubular excretion of other drugs, it has been used as an adjunct to antibacterial therapy. slaulederkind 2024-01-02T15:14:50Z CHEBI:8426 CID:4911 4-(Dipropylsulfamoyl)benzoic acid p-(Dipropylsulfamoyl)benzoic acid probenecid acid experimental_condition_ontology XCO:0001206 probenecid This is any condition in which the main influencing factor is probenecid, the prototypical uricosuric agent, a drug that promotes the excretion of uric acid. Probenecid inhibits the renal excretion of organic anions and reduces tubular reabsorption of urate. Because probenecid reduces the renal tubular excretion of other drugs, it has been used as an adjunct to antibacterial therapy. MESH:D011339 https://www.sciencedirect.com/topics/neuroscience/uricosuric This is any condition in which the main influencing factor is propranolol, a widely used non-cardioselective beta-adrenergic antagonist. Propranolol functions as an anxiolytic drug, an anti-arrhythmia drug, a vasodilator agent, and an antihypertensive agent. slaulederkind 2024-01-02T16:01:49Z CHEBI:8499 PMID:32119089 1-(isopropylamino)-3-(1-naphthyloxy)propan-2-ol 2-Propanol, 1-((1-methylethyl)amino)-3-(1-naphthalenyloxy)- 3-(naphthalen-1-yloxy)-1-(propan-2-ylamino)propan-2-ol beta-Propranolol experimental_condition_ontology XCO:0001207 propranolol This is any condition in which the main influencing factor is propranolol, a widely used non-cardioselective beta-adrenergic antagonist. Propranolol functions as an anxiolytic drug, an anti-arrhythmia drug, a vasodilator agent, and an antihypertensive agent. CID:4946 MESH:D011433 This is any condition in which the main influencing factor is MWNT-7, a multi&#8208;walled carbon nanotube, which is a molecule consisting of three or more concentric graphene cylinders. Fibers of MWNT-7 range in size from 5.11 &#956;m to 84.7 nm. slaulederkind 2024-01-04T12:18:08Z MWCNT-7 Mitsui-7 NT50a XNRI-7 experimental_condition_ontology XCO:0001208 MWNT-7 This is any condition in which the main influencing factor is MWNT-7, a multi&#8208;walled carbon nanotube, which is a molecule consisting of three or more concentric graphene cylinders. Fibers of MWNT-7 range in size from 5.11 &#956;m to 84.7 nm. CHEBI:50596 PMID:37513116 This is any condition in which the main influencing factor is lixisenatide, a 44 amino acid polypeptide and glucagon-like peptide 1 receptor agonist used as an adjunct to diet and exercise for the treatment of adults with type II diabetes. slaulederkind 2024-01-04T13:20:30Z CID:90472060 PMID:37423944 H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 experimental_condition_ontology XCO:0001209 lixisenatide This is any condition in which the main influencing factor is lixisenatide, a 44 amino acid polypeptide and glucagon-like peptide 1 receptor agonist used as an adjunct to diet and exercise for the treatment of adults with type II diabetes. CHEBI:85662 https://en.wikipedia.org/wiki/Lixisenatide This is any condition in which the main influencing factor is neomycin, a broad spectrum aminoglycoside antibiotic derived from Streptomyces fradiae with antibacterial activity. Neomycin is an antibiotic complex consisting of 3 components: the two isomeric components B and C are the active components, and neomycin A is a minor component and a degradation product of B and C. Neomycin is a protein synthesis inhibitor and bacteriacidal agent, primarily effective against gram-negative bacteria. slaulederkind 2024-01-05T11:08:45Z CHEBI:7507 MESH:D009355 PMID:33790226 experimental_condition_ontology XCO:0001210 neomycin This is any condition in which the main influencing factor is neomycin, a broad spectrum aminoglycoside antibiotic derived from Streptomyces fradiae with antibacterial activity. Neomycin is an antibiotic complex consisting of 3 components: the two isomeric components B and C are the active components, and neomycin A is a minor component and a degradation product of B and C. Neomycin is a protein synthesis inhibitor and bacteriacidal agent, primarily effective against gram-negative bacteria. https://pubchem.ncbi.nlm.nih.gov/#query=neomycin https://www.ncbi.nlm.nih.gov/books/NBK560603 This is any condition in which the main influencing factor is Parabacteroides distasonis, an anaerobic, gram-negative bacillus of the CFB group of bacteria. P. distasonis is an aerotolerant anaerobe found in the gastrointestinal tract of numerous species. slaulederkind 2024-01-05T12:24:25Z MESH:C000641579 Bacteroides distasonis experimental_condition_ontology XCO:0001211 Parabacteroides distasonis This is any condition in which the main influencing factor is Parabacteroides distasonis, an anaerobic, gram-negative bacillus of the CFB group of bacteria. P. distasonis is an aerotolerant anaerobe found in the gastrointestinal tract of numerous species. NCBI:txid823 PMID:33790226 This is any condition in which the main influencing factor is bacteria, any of a domain of chiefly round, spiral, or rod-shaped single-celled prokaryotic microorganisms that are represented in most ecological niches on earth. slaulederkind 2024-01-05T13:06:43Z NCBI:txid2 experimental_condition_ontology XCO:0001212 bacteria This is any condition in which the main influencing factor is bacteria, any of a domain of chiefly round, spiral, or rod-shaped single-celled prokaryotic microorganisms that are represented in most ecological niches on earth. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is Parabacteroides johnsonii, an anaerobic, gram-negative bacillus of the CFB group of bacteria. P. johnsonii is an anaerobe isolated from human fecal matter. slaulederkind 2024-01-05T14:08:16Z NCBI:txid387661 PMID:33790226 M-165T Parabacteroides johnsonii M-165 experimental_condition_ontology XCO:0001213 Parabacteroides johnsonii This is any condition in which the main influencing factor is Parabacteroides johnsonii, an anaerobic, gram-negative bacillus of the CFB group of bacteria. P. johnsonii is an anaerobe isolated from human fecal matter. PMID:17267966 https://en.wikipedia.org/wiki/Parabacteroides_johnsonii This is any condition in which the main influencing factor is reverse osmosis-filtered water, purified water that has sediment and chlorine removed from it with a prefilter before solutes are removed by a semipermeable membrane. Reverse osmosis-filtered water also passes through a postfilter after the semi-permeable membrane. slaulederkind 2024-01-05T14:27:10Z PMID:33790226 RO-filtered H2O RO-filtered water experimental_condition_ontology XCO:0001214 reverse osmosis-filtered water This is any condition in which the main influencing factor is reverse osmosis-filtered water, purified water that has sediment and chlorine removed from it with a prefilter before solutes are removed by a semipermeable membrane. Reverse osmosis-filtered water also passes through a postfilter after the semi-permeable membrane. https://www.freshwatersystems.com/blogs/blog/what-is-reverse-osmosis#1 This is any condition in which the main influencing factor is a drink made up of reverse osmosis-filtered water and a specified amount of fructose consumed by an organism as part of an experiment. Fructose is one of three dietary monosaccharides, along with glucose and galactose, that are absorbed directly into the bloodstream during digestion. slaulederkind 2024-01-05T16:06:22Z PMID:33790226 controlled fructose content RO-filtered drinking water experimental_condition_ontology XCO:0001215 controlled fructose content reverse osmosis-filtered drinking water This is any condition in which the main influencing factor is a drink made up of reverse osmosis-filtered water and a specified amount of fructose consumed by an organism as part of an experiment. Fructose is one of three dietary monosaccharides, along with glucose and galactose, that are absorbed directly into the bloodstream during digestion. https://www.freshwatersystems.com/blogs/blog/what-is-reverse-osmosis#1 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a drink made up of water and a specified amount of glucose consumed by a subject. Glucose is a monosaccharide sugar, C6H12O6, occurring widely in plant and animal tissues. Glucose is one of the three dietary monosaccharides, along with fructose and galactose, that are absorbed directly into the bloodstream during digestion slaulederkind 2024-01-05T16:23:57Z PMID:33790226 controlled dextrose content drinking water experimental_condition_ontology XCO:0001216 controlled glucose content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of glucose consumed by a subject. Glucose is a monosaccharide sugar, C6H12O6, occurring widely in plant and animal tissues. Glucose is one of the three dietary monosaccharides, along with fructose and galactose, that are absorbed directly into the bloodstream during digestion https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a drink made up of reverse osmosis-filtered water and a specified amount of glucose consumed by an organism as part of an experiment. Glucose is one of three dietary monosaccharides, along with fructose and galactose, that are absorbed directly into the bloodstream during digestion. slaulederkind 2024-01-05T16:40:50Z PMID:33790226 controlled dextrose content reverse osmosis-filtered drinking water controlled glucose content RO-filtered drinking water experimental_condition_ontology XCO:0001217 controlled glucose content reverse osmosis-filtered drinking water This is any condition in which the main influencing factor is a drink made up of reverse osmosis-filtered water and a specified amount of glucose consumed by an organism as part of an experiment. Glucose is one of three dietary monosaccharides, along with fructose and galactose, that are absorbed directly into the bloodstream during digestion. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a drink made up of water and a specified amount of ampicillin, a semi-synthetic derivative of penicillin that functions as an orally active broad-spectrum antibiotic. Ampicillin is a penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-phenylacetamido group. slaulederkind 2024-01-05T16:56:23Z CHEBI:28971 MESH:D000667 controlled aminobenzylpenicillin content drinking water experimental_condition_ontology XCO:0001218 controlled ampicillin content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of ampicillin, a semi-synthetic derivative of penicillin that functions as an orally active broad-spectrum antibiotic. Ampicillin is a penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-phenylacetamido group. CID:6249 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a medium-chain triglyceride-containing ketogenic diet (MCTKD), a solid diet with a specific ratio of fat weight to carbohydrate plus protein weight. MCTKDs with different ketogenic ratios are designated by KR values. Medium chain triglycerides are absorbed and transported more efficiently than other types of fat in the diet and yield more ketones produced in the liver per unit of dietary energy. slaulederkind 2024-01-08T14:26:56Z KD ketogenic diet MCT-KD MCTKD experimental_condition_ontology XCO:0001219 medium-chain triglyceride-containing ketogenic diet This is any condition in which the main influencing factor is a medium-chain triglyceride-containing ketogenic diet (MCTKD), a solid diet with a specific ratio of fat weight to carbohydrate plus protein weight. MCTKDs with different ketogenic ratios are designated by KR values. Medium chain triglycerides are absorbed and transported more efficiently than other types of fat in the diet and yield more ketones produced in the liver per unit of dietary energy. PMID:36386439 This is any condition in which the main influencing factor is a medium-chain triglyceride-containing ketogenic diet (MCTKD), KR 2.0, a solid diet with a specific ratio of fat weight to carbohydrate plus protein weight of approximately 2.0. A diet with a higher KR ratio delivers more fat than a diet with a lower KR. slaulederkind 2024-01-08T14:47:02Z MCT-KD, KR 2.0 MCTKD, KR 2.0 medium-chain triglyceride-containing ketogenic diet, ketogenic ratio 2.0 experimental_condition_ontology XCO:0001220 medium-chain triglyceride-containing ketogenic diet, KR 2.0 This is any condition in which the main influencing factor is a medium-chain triglyceride-containing ketogenic diet (MCTKD), KR 2.0, a solid diet with a specific ratio of fat weight to carbohydrate plus protein weight of approximately 2.0. A diet with a higher KR ratio delivers more fat than a diet with a lower KR. PMID:36386439 This is any condition in which the main influencing factor is a medium-chain triglyceride-containing ketogenic diet (MCTKD), KR 1.4, a solid diet with a specific ratio of fat weight to carbohydrate plus protein weight of approximately 1.4. A diet with a higher KR ratio delivers more fat than a diet with a lower KR. slaulederkind 2024-01-08T14:54:32Z MCT-KD, KR 1.4 MCTKD, KR 1.4 medium-chain triglyceride-containing ketogenic diet, ketogenic ratio 1.4 experimental_condition_ontology XCO:0001221 medium-chain triglyceride-containing ketogenic diet, KR 1.4 This is any condition in which the main influencing factor is a medium-chain triglyceride-containing ketogenic diet (MCTKD), KR 1.4, a solid diet with a specific ratio of fat weight to carbohydrate plus protein weight of approximately 1.4. A diet with a higher KR ratio delivers more fat than a diet with a lower KR. PMID:36386439 This is any condition in which the main influencing factor is ritonavir, a CYP3A inhibitor and antiretroviral drug from the protease inhibitor class used to treat HIV infection and AIDS. Ritonavir is often used as a fixed-dose combination with another protease inhibitor, lopinavir. Ritonavir is also used in combination with dasabuvir sodium hydrate, ombitasvir and paritaprevir for treatment of chronic hepatitis C virus genotype 1 infection and cirrhosis of the liver. slaulederkind 2024-01-08T15:19:08Z CID:392622 MESH:D019438 N-[(2S,4S,5S)-4-hydroxy-1,6-diphenyl-5-{[(1,3-thiazol-5-ylmethoxy)carbonyl]amino}hexan-2-yl]-N(2)-(methyl{[2-(propan-2-yl)-1,3-thiazol-4-yl]methyl}carbamoyl)-L-valinamide experimental_condition_ontology XCO:0001222 ritonavir This is any condition in which the main influencing factor is ritonavir, a CYP3A inhibitor and antiretroviral drug from the protease inhibitor class used to treat HIV infection and AIDS. Ritonavir is often used as a fixed-dose combination with another protease inhibitor, lopinavir. Ritonavir is also used in combination with dasabuvir sodium hydrate, ombitasvir and paritaprevir for treatment of chronic hepatitis C virus genotype 1 infection and cirrhosis of the liver. CHEBI:45409 This is any condition in which the main influencing factor is sitaxentan, a drug designed for the treatment of pulmonary arterial hypertension (PAH). The use of sitaxentan was discontinued because of the side effect of hepatotoxicity. slaulederkind 2024-01-08T15:28:14Z CHEBI:135736 experimental_condition_ontology XCO:0001223 sitaxentan This is any condition in which the main influencing factor is sitaxentan, a drug designed for the treatment of pulmonary arterial hypertension (PAH). The use of sitaxentan was discontinued because of the side effect of hepatotoxicity. CID:216235 This is any condition in which the main influencing factor is sudoxicam, a benzothiazine derivative and non-steroidal anti-inflammatory drug. Sudoxicam also has anti-edema and antipyretic activity. slaulederkind 2024-01-09T14:26:00Z CID:54682951 MESH:C100301 experimental_condition_ontology XCO:0001224 sudoxicam This is any condition in which the main influencing factor is sudoxicam, a benzothiazine derivative and non-steroidal anti-inflammatory drug. Sudoxicam also has anti-edema and antipyretic activity. https://www.medchemexpress.com/sudoxicam.html https://www.scbt.com/p/sudoxicam-34042-85-8 This is any condition in which the main influencing factor is sumatriptan, a serotonin agonist that acts selectively at 5HT1 receptors. It i s used for the acute treatment of migraine with or without aura in adults. slaulederkind 2024-01-09T14:36:52Z MESH:D018170 1-{3-[2-(dimethylamino)ethyl]-1H-indol-5-yl}-N-methylmethanesulfonamide Imitrex experimental_condition_ontology XCO:0001225 sumatriptan This is any condition in which the main influencing factor is sumatriptan, a serotonin agonist that acts selectively at 5HT1 receptors. It i s used for the acute treatment of migraine with or without aura in adults. CHEBI:10650 CID:5358 This is any condition in which the main influencing factor is tacrine, a centerally active cholinesterase inhibitor that crosses the blood-brain barrier. Tacrine has been used to counter the effects of muscle relaxants, as a respiratory stimulant, and in the treatment of Alzheimer's disease and other central nervous system disorders. Tacrine is also a histamine N-methyltransferase inhibitor. slaulederkind 2024-01-09T14:46:59Z CHEBI:45980 CID:1935 experimental_condition_ontology XCO:0001226 tacrine This is any condition in which the main influencing factor is tacrine, a centerally active cholinesterase inhibitor that crosses the blood-brain barrier. Tacrine has been used to counter the effects of muscle relaxants, as a respiratory stimulant, and in the treatment of Alzheimer's disease and other central nervous system disorders. Tacrine is also a histamine N-methyltransferase inhibitor. MESH:D013619 This is any condition in which the main influencing factor is teriparatide, a recombinant human parathyroid hormone analogue that is used to treat osteoporosis in women or men with a high risk for bone fracture. Teriparatide is made up of the first amino(N)-terminal 34 amino acids of human PTH (parathyroid hormone) and is an osteoanabolic agent. slaulederkind 2024-01-09T15:24:19Z CHEBI:135983 GEO:GSE121109 PTH (1-34) TPTD human PTH (1-34) experimental_condition_ontology XCO:0001227 teriparatide This is any condition in which the main influencing factor is teriparatide, a recombinant human parathyroid hormone analogue that is used to treat osteoporosis in women or men with a high risk for bone fracture. Teriparatide is made up of the first amino(N)-terminal 34 amino acids of human PTH (parathyroid hormone) and is an osteoanabolic agent. SID:483927060 This is any condition in which the main influencing factor is electrical muscle stimulation (EMS), a transcutaneous method of stimulating skeletal muscle. EMS is designed to facilitate passive activation of a large number of motor units and induce synchronous recruitment of muscle fibers, with the aim of strengthening or maintaining muscle mass. slaulederkind 2024-01-11T14:53:45Z PMID:30933441 EMS experimental_condition_ontology XCO:0001228 electrical muscle stimulation This is any condition in which the main influencing factor is electrical muscle stimulation (EMS), a transcutaneous method of stimulating skeletal muscle. EMS is designed to facilitate passive activation of a large number of motor units and induce synchronous recruitment of muscle fibers, with the aim of strengthening or maintaining muscle mass. PMID:36705372 This is any condition in which the main influencing factor is Baihu-Guizhi decoction, an anti-arthritic drug of traditional Chinese medicine (TCM). Baihu-Guizhi decoction (BHGZD) is extensively used for the treatment of rheumatoid arthritis (RA). slaulederkind 2024-01-11T15:21:04Z PMID:35799788 PMID:36195951 BHGZD experimental_condition_ontology XCO:0001229 Baihu-Guizhi decoction This is any condition in which the main influencing factor is Baihu-Guizhi decoction, an anti-arthritic drug of traditional Chinese medicine (TCM). Baihu-Guizhi decoction (BHGZD) is extensively used for the treatment of rheumatoid arthritis (RA). PMID:34675809 This is any condition in which the main influencing factor is Imwitor 742, a blend of mono-, di- and triglycerides, mainly of caprylic and capric acid. Imwitor 742 acts as a solubilizer for poorly soluble drugs in oral administration forms (i.e. capsules), as a penetration enhancer in topical drug forms, and as a co-emulsifier in emulsions. slaulederkind 2024-01-11T16:07:16Z PMID:32119089 Glycerol Monocaprylocaprate, type I Glyceryl Mono- and Dicaprylocaprate experimental_condition_ontology XCO:0001230 Imwitor 742 This is any condition in which the main influencing factor is Imwitor 742, a blend of mono-, di- and triglycerides, mainly of caprylic and capric acid. Imwitor 742 acts as a solubilizer for poorly soluble drugs in oral administration forms (i.e. capsules), as a penetration enhancer in topical drug forms, and as a co-emulsifier in emulsions. https://marcordev.com/wp-content/uploads/2020/07/IMWITOR_742_TDSH-1.pdf This is any condition in which the main influencing factor is a solvent, a liquid that can dissolve other substances (solutes) without any change in their chemical composition. slaulederkind 2024-01-11T16:13:49Z MESH:D012997 solvents experimental_condition_ontology XCO:0001231 solvent This is any condition in which the main influencing factor is a solvent, a liquid that can dissolve other substances (solutes) without any change in their chemical composition. CHEBI:46787 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is an emulsifier, a surface-active agent (such as a soap) promoting the formation and stabilization of an emulsion (a fine dispersion of minute droplets of one liquid in another in which it is not soluble). slaulederkind 2024-01-11T16:29:53Z CHEBI:63046 PMID:32119089 experimental_condition_ontology XCO:0001232 emulsifier This is any condition in which the main influencing factor is an emulsifier, a surface-active agent (such as a soap) promoting the formation and stabilization of an emulsion (a fine dispersion of minute droplets of one liquid in another in which it is not soluble). https://languages.oup.com/google-dictionary-en/ https://www.merriam-webster.com/ This is any condition in which the main influencing factor is telcagepant, a calcitonin gene-related peptide (CGRP) receptor antagonist which was an investigational drug for the acute treatment and prevention of migraine. Development of telcagepant was discontinued due to hepatic side effects. slaulederkind 2024-01-12T11:09:21Z CID:11319053 MK-0974 MK0974 N-[(3R,6S)-6-(2,3-Difluorophenyl)hexahydro-2-oxo-1-(2,2,2-trifluoroethyl)-1H-azepin-3-yl]-4-(2,3-dihydro-2-oxo-1H-imidazo[4,5-b]pyridin-1-yl)-1-piperidinecarboxamide experimental_condition_ontology XCO:0001233 telcagepant This is any condition in which the main influencing factor is telcagepant, a calcitonin gene-related peptide (CGRP) receptor antagonist which was an investigational drug for the acute treatment and prevention of migraine. Development of telcagepant was discontinued due to hepatic side effects. https://en.wikipedia.org/wiki/Telcagepant This is any condition in which the main influencing factor is telithromycin, a semi-synthetic erythromycin derivative which belongs to a new chemical class of antibiotics called ketolides. Similar to the macrolide antibiotics, telithromycin prevents bacterial growth by interfering with bacterial protein synthesis. slaulederkind 2024-01-12T11:21:08Z CHEBI:29688 MESH:C106791 Ketek experimental_condition_ontology XCO:0001234 telithromycin This is any condition in which the main influencing factor is telithromycin, a semi-synthetic erythromycin derivative which belongs to a new chemical class of antibiotics called ketolides. Similar to the macrolide antibiotics, telithromycin prevents bacterial growth by interfering with bacterial protein synthesis. CID:3002190 This is any condition in which the main influencing factor is tetracycline, a broad-spectrum polyketide antibiotic produced by the Streptomyces genus of actinobacteria. Tetracycline is both an antibacterial and antiprotozoal drug. slaulederkind 2024-01-12T12:11:59Z CHEBI:27902 MESH:D013752 (4S,4aS,5aS,6S,12aS)-4-(dimethylamino)-3,6,10,12,12a-pentahydroxy-6-methyl-1,11-dioxo-1,4,4a,5,5a,6,11,12a-octahydrotetracene-2-carboxamide experimental_condition_ontology XCO:0001235 tetracycline This is any condition in which the main influencing factor is tetracycline, a broad-spectrum polyketide antibiotic produced by the Streptomyces genus of actinobacteria. Tetracycline is both an antibacterial and antiprotozoal drug. CID:54675776 This is any condition whose main influencing factor is Morinda officinalis polysaccharide, a crude polysaccharide extract from the root of Morinda officinalis, a plant used in traditional Chinese medicine. slaulederkind 2024-01-12T13:30:17Z PMID:34466146 M. officinalis polysaccharide MOP Morinda officinalis polysaccharides MOP-100 MOP-60 experimental_condition_ontology XCO:0001236 Morinda officinalis polysaccharide This is any condition whose main influencing factor is Morinda officinalis polysaccharide, a crude polysaccharide extract from the root of Morinda officinalis, a plant used in traditional Chinese medicine. PMID:31465803 This is any condition whose main influencing factor is an experimental varicocele generated by partial ligation of the left renal vein. A varicocele is an abnormal dilation of the pampiniform plexus (veins) of the spermatic cord.. slaulederkind 2024-01-12T13:50:18Z PMID:28138407 experimental_condition_ontology XCO:0001237 experimental varicocele This is any condition whose main influencing factor is an experimental varicocele generated by partial ligation of the left renal vein. A varicocele is an abnormal dilation of the pampiniform plexus (veins) of the spermatic cord.. ISBN-13:978-1455756438 PMID:34466146 This is any condition in which the main influencing factor is ticlopidine, an inhibitor of platelet aggregation. It is a prodrug that is metabolised to an active form, which blocks the ADP receptor that is involved in GPIIb/IIIa receptor activation leading to platelet aggregation. slaulederkind 2024-01-12T18:37:58Z CHEBI:9588 MESH:D013988 5-(2-chlorobenzyl)-4,5,6,7-tetrahydrothieno[3,2-c]pyridine experimental_condition_ontology XCO:0001238 ticlopidine This is any condition in which the main influencing factor is ticlopidine, an inhibitor of platelet aggregation. It is a prodrug that is metabolised to an active form, which blocks the ADP receptor that is involved in GPIIb/IIIa receptor activation leading to platelet aggregation. CID:5472 This is any condition in which the main influencing factor is gefitinib, an EGFR (epidermal growth factor receptor) tyrosine kinase inhibitor used for the treatment of non-small cell lung cancer. slaulederkind 2024-01-15T13:18:12Z CID:123631 MESH:D000077156 N-(3-chloro-4-fluorophenyl)-7-methoxy-6-(3-morpholin-4-ylpropoxy)quinazolin-4-amine ZD1839 experimental_condition_ontology XCO:0001239 gefitinib This is any condition in which the main influencing factor is gefitinib, an EGFR (epidermal growth factor receptor) tyrosine kinase inhibitor used for the treatment of non-small cell lung cancer. CHEBI:49668 This is any condition in which the main influencing factor is afatinib, an inhibitor of epidermal growth factor receptor (EGFR, ERBB2, ERBB3, ERBB4) tyrosine kinases used for the treatment of metastatic non-small cell lung cancer. slaulederkind 2024-01-15T13:43:35Z CHEBI:61390 CID:10184653 (2E)-N-{4-[(3-chloro-4-fluorophenyl)amino]-7-[(3S)-tetrahydrofuran-3-yloxy]quinazolin-6-yl}-4-(dimethylamino)but-2-enamide experimental_condition_ontology XCO:0001240 afatinib This is any condition in which the main influencing factor is afatinib, an inhibitor of epidermal growth factor receptor (EGFR, ERBB2, ERBB3, ERBB4) tyrosine kinases used for the treatment of metastatic non-small cell lung cancer. MESH:D000077716 This is any condition in which the main influencing factor is tienilic acid, a loop diuretic with uricosuric action. Tienilic acid was marketed for the treatment of hypertension until being withdrawn in 1982 because of reports of hepatotoxicity. slaulederkind 2024-01-15T15:48:27Z CHEBI:9590 MESH:D013989 [2,3-dichloro-4-(2-thienylcarbonyl)phenoxy]acetic acid ticrynafen experimental_condition_ontology XCO:0001241 tienilic acid This is any condition in which the main influencing factor is tienilic acid, a loop diuretic with uricosuric action. Tienilic acid was marketed for the treatment of hypertension until being withdrawn in 1982 because of reports of hepatotoxicity. CID:38409 This is any condition in which the main influencing factor is tolcapone, a catechol O-methyltransferase (COMT) inhibitor used in the treatment of Parkinson disease. slaulederkind 2024-01-15T16:12:42Z CHEBI:63630 CID:4659569 (3,4-dihydroxy-5-nitrophenyl)(4-methylphenyl)methanone experimental_condition_ontology XCO:0001242 tolcapone This is any condition in which the main influencing factor is tolcapone, a catechol O-methyltransferase (COMT) inhibitor used in the treatment of Parkinson disease. MESH:D000077867 This is any condition in which the major influencing factor is wind, the movement of air of any velocity, especially an experimentally controlled velocity. The air may be ambient or otherwise controlled. slaulederkind 2024-01-16T13:30:43Z PMID:35799788 experimental_condition_ontology XCO:0001243 wind This is any condition in which the major influencing factor is wind, the movement of air of any velocity, especially an experimentally controlled velocity. The air may be ambient or otherwise controlled. https://www.merriam-webster.com/ This is any condition in which the major influencing factor is the ambient environment, an encompassing atmosphere which includes temperature, light, sound, and air content as parameters. slaulederkind 2024-01-16T13:50:10Z atmosphere experimental_condition_ontology XCO:0001244 ambient environment This is any condition in which the major influencing factor is the ambient environment, an encompassing atmosphere which includes temperature, light, sound, and air content as parameters. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is an antiemetic, a drug used to prevent nausea or vomiting. An antiemetic may affect the medullary control centers (the vomiting center and the chemoreceptive trigger zone) or peripheral receptors. slaulederkind 2024-01-16T14:27:16Z MESH:D000932 https://www.merriam-webster.com/dictionary/antiemetic experimental_condition_ontology XCO:0001245 antiemetic This is any condition in which the main influencing factor is an antiemetic, a drug used to prevent nausea or vomiting. An antiemetic may affect the medullary control centers (the vomiting center and the chemoreceptive trigger zone) or peripheral receptors. CHEBI:50919 This is any condition in which the main influencing factor is trimethobenzamide, a drug used to prevent nausea and vomiting in humans. slaulederkind 2024-01-16T14:35:01Z CID:5577 MESH:C100146 N-{4-[2-(dimethylamino)ethoxy]benzyl}-3,4,5-trimethoxybenzamide experimental_condition_ontology XCO:0001246 trimethobenzamide This is any condition in which the main influencing factor is trimethobenzamide, a drug used to prevent nausea and vomiting in humans. CHEBI:27796 This is any condition in which the main influencing factor is sterile water, which is high quality water used for medical irrigation, injection, or inhalation and has been prepared to eliminate microbial contamination. Sterile water may be used as a pharmaceutical solvent. slaulederkind 2024-01-16T14:59:01Z sterile H2O experimental_condition_ontology XCO:0001247 sterile water This is any condition in which the main influencing factor is sterile water, which is high quality water used for medical irrigation, injection, or inhalation and has been prepared to eliminate microbial contamination. Sterile water may be used as a pharmaceutical solvent. https://www.merriam-webster.com/ https://www.rxlist.com/sterile-water-drug.htm This is any condition in which the main influencing factor is poloxamers, nonionic triblock copolymers composed of a central hydrophobic chain of polyoxypropylene (poly(propylene oxide)) flanked by two hydrophilic chains of polyoxyethylene (poly(ethylene oxide)). The length of the copolymer chains can be varied to alter the properties of the whole molecule. slaulederkind 2024-01-16T15:27:53Z MESH:D020442 PMID:32119089 Kolliphors Pluronics Synperonics experimental_condition_ontology XCO:0001248 poloxamers This is any condition in which the main influencing factor is poloxamers, nonionic triblock copolymers composed of a central hydrophobic chain of polyoxypropylene (poly(propylene oxide)) flanked by two hydrophilic chains of polyoxyethylene (poly(ethylene oxide)). The length of the copolymer chains can be varied to alter the properties of the whole molecule. https://en.wikipedia.org/wiki/Poloxamer This is any condition in which the main influencing factor is Poloxamer 407 (P407), a nonionic triblock copolymer with a polyoxypropylene molecular mass of 4000 g/mol and a 70% polyoxyethylene content. P407 is used as an emulsifying agent and solubilizing agent in cosmetic and personal products. slaulederkind 2024-01-16T16:33:41Z P407 experimental_condition_ontology XCO:0001249 Poloxamer 407 This is any condition in which the main influencing factor is Poloxamer 407 (P407), a nonionic triblock copolymer with a polyoxypropylene molecular mass of 4000 g/mol and a 70% polyoxyethylene content. P407 is used as an emulsifying agent and solubilizing agent in cosmetic and personal products. CID:24751 https://en.wikipedia.org/wiki/Poloxamer This is any condition in which the main influencing factor is Poria cocos, a fungus used extensively as a medicinal mushroom in traditional Chinese medicine. slaulederkind 2024-01-18T13:48:59Z China root Macrohyporia cocos Macrohyporia extensa PC Wolfiporia cocos Wolfiporia extensa fu ling hoelen matsuhodo poria tuckahoe experimental_condition_ontology XCO:0001250 Poria cocos This is any condition in which the main influencing factor is Poria cocos, a fungus used extensively as a medicinal mushroom in traditional Chinese medicine. https://en.wikipedia.org/wiki/Wolfiporia_extensa This is any condition in which the main influencing factor is Alismatis rhizoma, the rhizomes of A. orientale (Alisma orientale, a flowering plant species found in Asia) which have been used as a traditional Chinese medicine and as a kampo Japanese medicine. Terpenoids have been identified as characteristic constituents of Alisma orientale. slaulederkind 2024-01-18T14:09:22Z CHEBI:26873 PMID:27080939 AR Alisma orientale (Sam.) Juzep rhizomes Asian water plantain experimental_condition_ontology XCO:0001251 Alismatis rhizoma This is any condition in which the main influencing factor is Alismatis rhizoma, the rhizomes of A. orientale (Alisma orientale, a flowering plant species found in Asia) which have been used as a traditional Chinese medicine and as a kampo Japanese medicine. Terpenoids have been identified as characteristic constituents of Alisma orientale. https://en.wikipedia.org/wiki/Alisma_orientale This is any condition in which the main influencing factor is PC-AR, an extract derived from a 60%-40% mix (by weight) of Poria cocos and Alismatis rhizoma. slaulederkind 2024-01-18T15:11:22Z Poria cocos-Alismatis rhizoma aqueous extract of Poria cocos-Alismatis rhizoma experimental_condition_ontology XCO:0001252 PC-AR This is any condition in which the main influencing factor is PC-AR, an extract derived from a 60%-40% mix (by weight) of Poria cocos and Alismatis rhizoma. PMID:37840052 This is any condition in which the main influencing factor is Huatan Jiangzhuo decoction, a combination of six traditional Chinese medicines that is used for lipid metabolism-related disorders. slaulederkind 2024-01-18T15:29:08Z PMID:33936248 HJD HTJZD experimental_condition_ontology XCO:0001253 Huatan Jiangzhuo decoction This is any condition in which the main influencing factor is Huatan Jiangzhuo decoction, a combination of six traditional Chinese medicines that is used for lipid metabolism-related disorders. PMID:33641781 This is any condition in which the main influencing factor is troglitazone, a hypoglycemic agent that was taken off the market due to hepatotoxicity issues. Troglitazone is also an antioxidant, a vasodilator agent, an anticonvulsant, an anticoagulant, an antineoplastic agent, and a long-chain-fatty-acid--CoA ligase inhibitor. slaulederkind 2024-01-19T10:41:51Z CHEBI:9753 MESH:D000077288 PMID:32119089 5-{4-[(6-hydroxy-2,5,7,8-tetramethyl-3,4-dihydro-2H-chromen-2-yl)methoxy]benzyl}-1,3-thiazolidine-2,4-dione experimental_condition_ontology XCO:0001254 troglitazone This is any condition in which the main influencing factor is indomethacin, a non-steroidal anti-inflammatory drug (NSAID) used to treat mild to moderate acute pain and relieve symptoms of arthritis (osteoarthritis and rheumatoid arthritis) or gout. Indomethacin also inhibits the motility of polymorphonuclear leukocytes. slaulederkind 2024-01-19T10:58:34Z CHEBI:49662 CID:3715 [1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]acetic acid indometacin experimental_condition_ontology XCO:0001255 indomethacin This is any condition in which the main influencing factor is indomethacin, a non-steroidal anti-inflammatory drug (NSAID) used to treat mild to moderate acute pain and relieve symptoms of arthritis (osteoarthritis and rheumatoid arthritis) or gout. Indomethacin also inhibits the motility of polymorphonuclear leukocytes. MESH:D007213 https://www.mayoclinic.org/drugs-supplements/indomethacin-oral-route/description/drg-20069700 This is any condition in which the main influencing factor is total parenteral nutrition (TPN), a method of feeding that bypasses the gastrointestinal tract by using an intravenous route. Total parenteral nutrition exists when no significant nutrition is obtained by other routes. slaulederkind 2024-01-19T11:31:20Z PMID:32644462 TNA TPN total nutrient admixture CVN central venous nutrition peripheral parenteral nutrition experimental_condition_ontology XCO:0001256 total parenteral nutrition This is any condition in which the main influencing factor is total parenteral nutrition (TPN), a method of feeding that bypasses the gastrointestinal tract by using an intravenous route. Total parenteral nutrition exists when no significant nutrition is obtained by other routes. https://en.wikipedia.org/wiki/Parenteral_nutrition https://medlineplus.gov/ency/patientinstructions/000177.htm This is any condition in which the main influencing factor is trovafloxacin, a broad spectrum antibiotic more effective against Gram-positive bacteria than Gram-negative bacteria. Trovafloxacin exerts its antibacterial activity by inhibiting the uncoiling of supercoiled DNA by blocking the activity of DNA gyrase and topoisomerase IV. slaulederkind 2024-01-19T13:03:35Z CHEBI:9763 MESH:C080163 7-[(1R,5S,6s)-6-amino-3-azabicyclo[3.1.0]hex-3-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-1,4-dihydro-1,8-naphthyridine-3-carboxylic acid TVFX experimental_condition_ontology XCO:0001257 trovafloxacin This is any condition in which the main influencing factor is trovafloxacin, a broad spectrum antibiotic more effective against Gram-positive bacteria than Gram-negative bacteria. Trovafloxacin exerts its antibacterial activity by inhibiting the uncoiling of supercoiled DNA by blocking the activity of DNA gyrase and topoisomerase IV. CID:62959 This is any condition in which the main influencing factor is valproate, a branched-chain saturated fatty acid anion that is the conjugate base of valproic acid. Valproic acid is used in the treatment of epilepsy and bipolar disorder. slaulederkind 2024-01-22T09:34:42Z CHEBI:60654 2-propylpentanoate VPA experimental_condition_ontology XCO:0001258 valproate This is any condition in which the main influencing factor is valproate, a branched-chain saturated fatty acid anion that is the conjugate base of valproic acid. Valproic acid is used in the treatment of epilepsy and bipolar disorder. CID:3549980 This is any condition in which the main influencing factor is valsartan, a monocarboxylic acid amide and angiotensin II type 1 receptor blocker that is used to treat hypertension. Valsartan is also used in the management of heart failure and type 2 diabetes-associated nephropathy. slaulederkind 2024-01-22T09:54:58Z CHEBI:9927 N-pentanoyl-N-{[2'-(1H-tetrazol-5-yl)[1,1'-biphenyl]-4-yl]methyl}-L-valine experimental_condition_ontology XCO:0001259 valsartan This is any condition in which the main influencing factor is valsartan, a monocarboxylic acid amide and angiotensin II type 1 receptor blocker that is used to treat hypertension. Valsartan is also used in the management of heart failure and type 2 diabetes-associated nephropathy. CID:60846 MESH:D000068756 This is any condition in which the main influencing factor is pH-adjusted sterile water, an acidity- or alkalinity-adjusted sterile water that is equilibrated to a specific pH. slaulederkind 2024-01-22T11:22:07Z sterile H2O, pH-adjusted experimental_condition_ontology XCO:0001260 sterile water, pH-adjusted This is any condition in which the main influencing factor is pH-adjusted sterile water, an acidity- or alkalinity-adjusted sterile water that is equilibrated to a specific pH. https://www.merriam-webster.com https://www.rxlist.com/sterile-water-drug.htm This is any condition in which the main influencing factor is Ma Xing Shi Gan decoction, an anti-inflammatory and antiviral drug of traditional Chinese medicine (TCM). Ma Xing Shi Gan decoction has shown some effectiveness in the treatment of COVID-19 infection. slaulederkind 2024-01-22T13:02:45Z PMID:32360484 MXSG MXSG Decoction Maxing Shigan Decoction Maxingshigan Decoction experimental_condition_ontology XCO:0001261 Ma Xing Shi Gan decoction This is any condition in which the main influencing factor is Ma Xing Shi Gan decoction, an anti-inflammatory and antiviral drug of traditional Chinese medicine (TCM). Ma Xing Shi Gan decoction has shown some effectiveness in the treatment of COVID-19 infection. PMID:33324213 This is any condition in which the main influencing factor is ximelagatran, which is an anticoagulant, a serine protease inhibitor and a prodrug for melagatran. slaulederkind 2024-01-23T11:32:13Z CHEBI:65172 MESH:C426686 ethyl N-{(1R)-1-cyclohexyl-2-[(2S)-2-{[4-(N'-hydroxycarbamimidoyl)benzyl]carbamoyl}azetidin-1-yl]-2-oxoethyl}glycinate experimental_condition_ontology XCO:0001262 ximelagatran This is any condition in which the main influencing factor is ximelagatran, which is an anticoagulant, a serine protease inhibitor and a prodrug for melagatran. CID:9574101 This is any condition in which the main influencing factor is zafirlukast, a leukotriene receptor antagonist (LTRA) and cytochrome P450 2C9 (CYP2C9) inhibitor. slaulederkind 2024-01-23T13:19:13Z CHEBI:10100 MESH:C062735 cyclopentyl 3-[2-methoxy-4-(2-methylphenylsulfonylcarbamoyl)benzyl]-1-methyl-1H-indol-5-ylcarbamate experimental_condition_ontology XCO:0001263 zafirlukast This is any condition in which the main influencing factor is zafirlukast, a leukotriene receptor antagonist (LTRA) and cytochrome P450 2C9 (CYP2C9) inhibitor. CID:5717 This is any condition in which the main influencing factor is phloretin, an antineoplastic agent and natural dihydrochalcone found in many fruits. slaulederkind 2024-01-23T13:32:00Z CHEBI:17276 MESH:D010693 PMID:36793870 3-(4-hydroxyphenyl)-1-(2,4,6-trihydroxyphenyl)propan-1-one PHL experimental_condition_ontology XCO:0001264 phloretin This is any condition in which the main influencing factor is phloretin, an antineoplastic agent and natural dihydrochalcone found in many fruits. CID:4788 This is any condition in which the main influencing factor is stress, which is a physical, chemical, or emotional factor that causes bodily or mental tension and may be a factor in disease causation. slaulederkind 2024-01-23T14:18:33Z pressure strain tension experimental_condition_ontology XCO:0001265 stress This is any condition in which the main influencing factor is stress, which is a physical, chemical, or emotional factor that causes bodily or mental tension and may be a factor in disease causation. https://www.merriam-webster.com This is any condition in which the main influencing factor is cage tilt, a procedure designed to cause mild stress in laboratory animals. Typically, the cage is tilted at 30 - 45 degrees for a few hours at a time to overnight. slaulederkind 2024-01-23T14:47:18Z PMID:34568850 cage tilt stress experimental_condition_ontology XCO:0001266 cage tilt This is any condition in which the main influencing factor is cage tilt, a procedure designed to cause mild stress in laboratory animals. Typically, the cage is tilted at 30 - 45 degrees for a few hours at a time to overnight. PMID:26650668 https://www.merriam-webster.com This is any condition in which the main influencing factor is a reversed light/dark cycle, a light/dark cycle that is opposite of the normal day/night conditions the subject or patient experiences. slaulederkind 2024-01-23T15:27:16Z PMID:36793870 reverse day/night lighting reverse light/dark cycle reversed day/night lighting continuous lighting partially reversed day/night lighting experimental_condition_ontology XCO:0001267 reversed light/dark cycle This is any condition in which the main influencing factor is a reversed light/dark cycle, a light/dark cycle that is opposite of the normal day/night conditions the subject or patient experiences. https://www.merriam-webster.com This is any condition in which the main influencing factor is a tail clip procedure, a procedure done in the process of collecting blood from a laboratory animal. The subject is usually lightly restrained by the handler or by a mechancal device, while a few millimeters is cut off the end of the tail. slaulederkind 2024-01-23T16:02:29Z PMID:36793870 tail snip tail-clip experimental_condition_ontology XCO:0001268 tail clip This is any condition in which the main influencing factor is a tail clip procedure, a procedure done in the process of collecting blood from a laboratory animal. The subject is usually lightly restrained by the handler or by a mechancal device, while a few millimeters is cut off the end of the tail. PMID:18459706 This is any condition in which the main influencing factor is forced swimming, a situation in which the subject (typically a laboratory rodent) inside a water-filled chamber must swim to survive. slaulederkind 2024-01-23T16:19:18Z PMID:26650668 PMID:36793870 FST Porsolt forced swimming test behavioural despair test forced swim test forced swimming test experimental_condition_ontology XCO:0001269 forced swimming This is any condition in which the main influencing factor is forced swimming, a situation in which the subject (typically a laboratory rodent) inside a water-filled chamber must swim to survive. https://www.merriam-webster.com This is any condition in which the main influencing factor is forced swimming in cold water, a situation in which the subject (typically a laboratory rodent), inside a water-filled cylinder, must swim to survive. slaulederkind 2024-01-23T16:31:48Z cold water FST forced cold water swim forced cold water swim test forced cold water swimming test experimental_condition_ontology XCO:0001270 forced cold water swimming This is any condition in which the main influencing factor is forced swimming in cold water, a situation in which the subject (typically a laboratory rodent), inside a water-filled cylinder, must swim to survive. PMID:36793870 https://en.wikipedia.org/wiki/Behavioural_despair_test This is any condition in which the main influencing factor is zimelidine, an SRI (serotonin uptake inhibitor) antidepressant whose use was discontinued because of the risk of Guillain-Barre syndrome as a side effect. slaulederkind 2024-01-25T09:24:24Z CAS:56775-88-3 CHEBI:135357 MESH:D015031 2-Propen-1-amine, 3-(4-bromophenyl)-N,N-dimethyl-3-(3-pyridinyl)-, (Z)- experimental_condition_ontology XCO:0001271 zimelidine This is any condition in which the main influencing factor is zimelidine, an SRI (serotonin uptake inhibitor) antidepressant whose use was discontinued because of the risk of Guillain-Barre syndrome as a side effect. CID:5365247 This is any condition in which the main influencing factor is zolpidem, an imidazopyridine derivative and short-acting GABA-A receptor agonist that is used for the treatment of insomnia. slaulederkind 2024-01-25T09:47:44Z CHEBI:10125 CID:5732 N,N-dimethyl-2-[6-methyl-2-(4-methylphenyl)imidazo[1,2-a]pyridin-3-yl]acetamide experimental_condition_ontology XCO:0001272 zolpidem This is any condition in which the main influencing factor is zolpidem, an imidazopyridine derivative and short-acting GABA-A receptor agonist that is used for the treatment of insomnia. MESH:D000077334 This is any condition in which the main influencing factor is a high-protein/ammoniagenic diet, which is a standard diet supplemented with additional amino acids including leucine (~13% of amino acids), valine (~11% of amino acids), and the absence of isoleucine. slaulederkind 2024-01-25T12:58:34Z experimental_condition_ontology XCO:0001273 high-protein/ammoniagenic diet This is any condition in which the main influencing factor is a high-protein/ammoniagenic diet, which is a standard diet supplemented with additional amino acids including leucine (~13% of amino acids), valine (~11% of amino acids), and the absence of isoleucine. PMID:10459831 PMID:36539425 This is any condition in which the main influencing factor is telmisartan, a biphenyl compound and benzimidazole derivative that acts as an angiotensin II type 1 receptor antagonist used in the management of hypertension. slaulederkind 2024-01-25T13:22:29Z CHEBI:9434 CID:65999 4'-[(1,7'-dimethyl-2'-propyl-1H,3'H-2,5'-bibenzimidazol-3'-yl)methyl][1,1'-biphenyl]-2-carboxylic acid experimental_condition_ontology XCO:0001274 telmisartan This is any condition in which the main influencing factor is telmisartan, a biphenyl compound and benzimidazole derivative that acts as an angiotensin II type 1 receptor antagonist used in the management of hypertension. MESH:D000077333 This is any condition in which the main influencing factor is unpredictable chronic mild stress, an experimental model of depression that involves exposing laboratory animals (usually mice or rats) at unpredictable times over several weeks to a series of minor-intensity stressors. This process results in the development of a number of behavioral alterations in a large majority of animals, including anhedonia (loss of pleasure) and apathy. slaulederkind 2024-01-29T12:15:10Z CMS CUMS UCMS chronic unpredictable mild stress chronic unpredictable stress experimental_condition_ontology XCO:0001275 unpredictable chronic mild stress This is any condition in which the main influencing factor is unpredictable chronic mild stress, an experimental model of depression that involves exposing laboratory animals (usually mice or rats) at unpredictable times over several weeks to a series of minor-intensity stressors. This process results in the development of a number of behavioral alterations in a large majority of animals, including anhedonia (loss of pleasure) and apathy. PMID:34406704 PMID:7202217 This is any condition in which the main influencing factor is bromobenzene, the simplest member of the class of bromobenzenes, that is benzene in which a single hydrogen has been substituted by a bromine. Bromobenzene is used as a solvent, particularly for large-scale crystallizations, and for the introduction of phenyl groups in organic synthesis. slaulederkind 2024-01-30T12:12:23Z CID:7961 MESH:C032036 Benzene, bromo Monobromobenzene PhBr Phenyl bromide experimental_condition_ontology XCO:0001276 bromobenzene This is any condition in which the main influencing factor is bromobenzene, the simplest member of the class of bromobenzenes, that is benzene in which a single hydrogen has been substituted by a bromine. Bromobenzene is used as a solvent, particularly for large-scale crystallizations, and for the introduction of phenyl groups in organic synthesis. CHEBI:3179 This is any condition in which the main influencing factor is nicotinamide, a pyridine derivative that is a component of the coenzyme NAD, a form of vitamin B3, an antioxidant, a histone deacetylase inhibitor, and an anti-inflammatory agent. slaulederkind 2024-01-30T12:34:51Z vitamin B3 CHEBI:17154 MESH:D009536 3-pyridinecarboxamide NAM niacinamide experimental_condition_ontology XCO:0001277 nicotinamide This is any condition in which the main influencing factor is nicotinamide, a pyridine derivative that is a component of the coenzyme NAD, a form of vitamin B3, an antioxidant, a histone deacetylase inhibitor, and an anti-inflammatory agent. CID:936 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of nicotinamide, in which the amount of nicotinamide consumed is maintained at a specified level. slaulederkind 2024-01-30T12:51:51Z CHEBI:17154 CID:936 MESH:D009536 controlled NAM content drinking water controlled niacinamide content drinking water experimental_condition_ontology XCO:0001278 controlled nicotinamide content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of nicotinamide, in which the amount of nicotinamide consumed is maintained at a specified level. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is partial bladder outlet obstruction, an experimental constriction of the neck of the urinary bladder to restrict urine flow and model changes that occur in clinical bladder outlet obstruction (BOO). Partial bladder outlet obstruction may be achieved surgically by passing a catheter through the urethra into the bladder, suturing around the neck of the bladder, and removing the catheter. slaulederkind 2024-02-01T10:29:45Z GEO:GSE167430 https://my.clevelandclinic.org/health/diseases/15181-bladder-outlet-obstruction pBOO experimental_condition_ontology XCO:0001279 partial bladder outlet obstruction This is any condition in which the main influencing factor is partial bladder outlet obstruction, an experimental constriction of the neck of the urinary bladder to restrict urine flow and model changes that occur in clinical bladder outlet obstruction (BOO). Partial bladder outlet obstruction may be achieved surgically by passing a catheter through the urethra into the bladder, suturing around the neck of the bladder, and removing the catheter. PMID:20590549 This is any condition in which the main influencing factor is the open field task, which is designed to measure the movement and other behavior exhibited by a subject responding to an experimentally defined, open space. The open field test is used to assess activity and behavior in laboratory animals, usually rodents. slaulederkind 2024-02-05T12:42:37Z PMID:25742564 PMID:36793870 open field maze open field test experimental_condition_ontology XCO:0001280 open field task This is any condition in which the main influencing factor is the open field task, which is designed to measure the movement and other behavior exhibited by a subject responding to an experimentally defined, open space. The open field test is used to assess activity and behavior in laboratory animals, usually rodents. https://en.wikipedia.org/wiki/Open_field_(animal_test) https://med.stanford.edu/sbfnl/services/bm/sm/openfield.html This is any condition in which the main influencing factor is sodium octanoate, an organic sodium salt comprising equal numbers of sodium and octanoate ions. slaulederkind 2024-02-05T16:24:49Z CID:23664772 PMID:34939931 octanoic acid, sodium salt sodium caprylate sodium n-octanoate experimental_condition_ontology XCO:0001281 sodium octanoate This is any condition in which the main influencing factor is sodium octanoate, an organic sodium salt comprising equal numbers of sodium and octanoate ions. CHEBI:132100 This is any condition in which the main influencing factor is sodium carboxymethylcellulose, a cellulose derivative which is a beta-(1,4)-D-glucopyranose polymer. Sodium carboxymethylcellulose is a commonly used form of carboxymethylcellulose. slaulederkind 2024-02-06T11:57:19Z CHEBI:85146 CID:6328154 CMC-Na carboxymethylcellulose sodium carboxymethylcellulose sodium salt carmellose sodium experimental_condition_ontology XCO:0001282 sodium carboxymethylcellulose This is any condition in which the main influencing factor is sodium carboxymethylcellulose, a cellulose derivative which is a beta-(1,4)-D-glucopyranose polymer. Sodium carboxymethylcellulose is a commonly used form of carboxymethylcellulose. MESH:D002266 https://en.wikipedia.org/wiki/Carboxymethyl_cellulose#References This is any condition in which the main influencing factor is grouped housing, a living situation involving four or more individual subjects housed in the same structure. slaulederkind 2024-02-08T16:10:11Z group housing experimental_condition_ontology XCO:0001283 grouped housing This is any condition in which the main influencing factor is grouped housing, a living situation involving four or more individual subjects housed in the same structure. PMID:15033287 PMID:37044360 This is any condition in which the main influencing factor is a soiled cage, a housing condition designed to create stress in subjects living in such housing. The soiled cage is typically a cage in which excess water has been introduced to the bedding (for example: 200 ml water in 100 g of sawdust bedding). slaulederkind 2024-02-08T16:47:00Z wet cage experimental_condition_ontology XCO:0001284 soiled cage This is any condition in which the main influencing factor is a soiled cage, a housing condition designed to create stress in subjects living in such housing. The soiled cage is typically a cage in which excess water has been introduced to the bedding (for example: 200 ml water in 100 g of sawdust bedding). PMID:15033287 PMID:36793870 This is any condition in which the main influencing factor is oxaliplatin, an organoplatinum complex that is a commonly used as a chemothrepeutic drug for treatment of metastatic colorectal cancer. slaulederkind 2024-02-16T15:16:38Z GEO:GSE160543 (SP-4-2)[(1R,2R)-cyclohexane-1,2-diamine-kappa(2)N,N'][ethanedioato(2-)-kappa(2)O(1),O(2)]platinum experimental_condition_ontology XCO:0001285 oxaliplatin This is any condition in which the main influencing factor is oxaliplatin, an organoplatinum complex that is a commonly used as a chemothrepeutic drug for treatment of metastatic colorectal cancer. XCO:0000088 This is any condition in which the main influencing factor is a Von Frey monofilament stimulus, usually encountered in a Von Frey assay, which is used to evaluate mechanical allodynia in laboratory rodents. The von Frey test, which may be manual or electronic, uses von Frey monofilaments (hair or fibers), which are small pieces of nylon rod, approximately 50 mm in length, and of varying diameters, to test a rodent's sensitivity to punctate mechanical pressure on the plantar surface of a rear paw. Von Frey filaments are able to deliver force in the range of 0.08 to 2940 mN. slaulederkind 2024-02-19T15:10:13Z PMID:34808752 von Frey assay condition experimental_condition_ontology XCO:0001286 von Frey monofilament stimulus This is any condition in which the main influencing factor is a Von Frey monofilament stimulus, usually encountered in a Von Frey assay, which is used to evaluate mechanical allodynia in laboratory rodents. The von Frey test, which may be manual or electronic, uses von Frey monofilaments (hair or fibers), which are small pieces of nylon rod, approximately 50 mm in length, and of varying diameters, to test a rodent's sensitivity to punctate mechanical pressure on the plantar surface of a rear paw. Von Frey filaments are able to deliver force in the range of 0.08 to 2940 mN. PMID:28932184 https://en.wikipedia.org/wiki/Nociception_assay This is any condition in which the main influencing factor is a hot plate stimulus, usually encountered by laboratory rodents in thermal hyperalgesia testing. The hot plate test is a useful screening tool for interventions of analgesia and involves placing the subject on its feet on a temperature-regulatable hot plate inside a cylindrical chamber. slaulederkind 2024-02-19T15:33:23Z PMID:34808752 experimental_condition_ontology XCO:0001287 hot plate stimulus This is any condition in which the main influencing factor is a hot plate stimulus, usually encountered by laboratory rodents in thermal hyperalgesia testing. The hot plate test is a useful screening tool for interventions of analgesia and involves placing the subject on its feet on a temperature-regulatable hot plate inside a cylindrical chamber. https://en.wikipedia.org/wiki/Hot_plate_test https://maze.conductscience.com/portfolio/hot-plate/ This is any condition in which the main influencing factor is an acetone drop stimulus, usually encountered in a test used to measure cold allodynia behavior in the experimental subject, typically a rodent. The test involves applying a small drop (50 - 100 ul) of acetone to the mid-plantar area of the hind paw and recording the resulting behavior for one minute. The skin temperature of the subject drops ~3 - 5 degrees during the test. slaulederkind 2024-02-22T13:16:18Z PMID:34808752 experimental_condition_ontology XCO:0001288 acetone drop stimulus This is any condition in which the main influencing factor is an acetone drop stimulus, usually encountered in a test used to measure cold allodynia behavior in the experimental subject, typically a rodent. The test involves applying a small drop (50 - 100 ul) of acetone to the mid-plantar area of the hind paw and recording the resulting behavior for one minute. The skin temperature of the subject drops ~3 - 5 degrees during the test. PMID:30228362 This is any condition in which the main influencing factor is tenotomy, any process involving transcutaneous or surgical techniques for incision of a tendon to investigate and/or treat a pathological condition. Tenotomy may involve needle puncture, incision, or complete transection of a tendon. slaulederkind 2024-02-22T14:12:59Z PMID:35897746 open tenotomy experimental_condition_ontology XCO:0001289 tenotomy This is any condition in which the main influencing factor is tenotomy, any process involving transcutaneous or surgical techniques for incision of a tendon to investigate and/or treat a pathological condition. Tenotomy may involve needle puncture, incision, or complete transection of a tendon. https://my.clevelandclinic.org/health/treatments/24123-tenotomy This is any condition in which the main influencing factor is Achilles tendon transection, a process involving a surgical technique for complete transection of the calcaneal and plantaris tendon to investigate tendon healing in an experimental animal model. slaulederkind 2024-02-22T14:31:22Z Achille's tenotomy open Achilles tenotomy experimental_condition_ontology XCO:0001290 Achilles tendon transection This is any condition in which the main influencing factor is Achilles tendon transection, a process involving a surgical technique for complete transection of the calcaneal and plantaris tendon to investigate tendon healing in an experimental animal model. PMID:35897746 https://en.wikipedia.org/wiki/Achilles_tendon This is any condition in which the main influencing factor is particulate matter (particle pollution), a mixture of inhalable, solid particles and liquid droplets found in the air. The size of particulate matter ranges from visible to microscopic. slaulederkind 2024-02-23T11:04:16Z PMID:35897746 PM particle pollution experimental_condition_ontology XCO:0001291 particulate matter This is any condition in which the main influencing factor is particulate matter (particle pollution), a mixture of inhalable, solid particles and liquid droplets found in the air. The size of particulate matter ranges from visible to microscopic. https://www.epa.gov/pm-pollution/particulate-matter-pm-basics#PM This is any condition in which the main influencing factor is PM2.5, which is particulate matter consisting of fine inhalable particles, with diameters that are generally 2.5 micrometers and smaller. slaulederkind 2024-02-23T11:17:32Z PMID:35897746 2.5 um particulate matter experimental_condition_ontology XCO:0001293 PM2.5 This is any condition in which the main influencing factor is PM2.5, which is particulate matter consisting of fine inhalable particles, with diameters that are generally 2.5 micrometers and smaller. https://www.epa.gov/pm-pollution/particulate-matter-pm-basics#PM This is any condition in which the main influencing factor is PM10, which is particulate matter consisting of inhalable particles, with diameters that are generally 10 micrometers and smaller. slaulederkind 2024-02-23T11:22:35Z PMID:35897746 10 um particulate matter experimental_condition_ontology XCO:0001294 PM10 This is any condition in which the main influencing factor is PM10, which is particulate matter consisting of inhalable particles, with diameters that are generally 10 micrometers and smaller. https://www.epa.gov/pm-pollution/particulate-matter-pm-basics#PM This is any condition in which the main influencing factor is gingerol, a beta-hydroxy ketone that is 5-hydroxydecan-3-one substituted by a 4-hydroxy-3-methoxyphenyl moiety at position 1. Gingerol is a constituent of fresh ginger and other plants. Gingerol may have antifungal and antineoplastic properties. slaulederkind 2024-02-23T13:21:55Z CID:442793 MESH:C007845 PMID:35897746 (5S)-5-hydroxy-1-(4-hydroxy-3-methoxyphenyl)decan-3-one (6)-Gingerol 6-Gingerol experimental_condition_ontology XCO:0001295 gingerol This is any condition in which the main influencing factor is gingerol, a beta-hydroxy ketone that is 5-hydroxydecan-3-one substituted by a 4-hydroxy-3-methoxyphenyl moiety at position 1. Gingerol is a constituent of fresh ginger and other plants. Gingerol may have antifungal and antineoplastic properties. CHEBI:10136 https://en.wikipedia.org/wiki/File:Gingerol_cytotoxic_activity.jpg This is any condition in which the main influencing factor is blood transfusion, an intravenous transfer of blood or blood components from one subject to another or from one subject back to the same subject (after treatment or storage of blood/blood product). slaulederkind 2024-02-23T13:48:00Z PMID:35897746 transfusion autologous blood transfusion homologous blood transfusion experimental_condition_ontology XCO:0001296 blood transfusion This is any condition in which the main influencing factor is blood transfusion, an intravenous transfer of blood or blood components from one subject to another or from one subject back to the same subject (after treatment or storage of blood/blood product). https://en.wikipedia.org/wiki/Blood_transfusion https://www.merriam-webster.com This is any condition in which the main influencing factor is autologous blood transfusion, the intravenous reinfusion of blood or blood components to the same individual from whom they were taken. slaulederkind 2024-02-23T13:55:44Z PMID:35897746 experimental_condition_ontology XCO:0001297 autologous blood transfusion This is any condition in which the main influencing factor is autologous blood transfusion, the intravenous reinfusion of blood or blood components to the same individual from whom they were taken. PMID:8400524 https://www.merriam-webster.com This is any condition in which the main influencing factor is bleomycin, a complex of related glycopeptide antibiotics from Streptomyces verticillus consisting of bleomycin A2 and B2. Bleomycin inhibits DNA metabolism and is used as an antineoplastic, especially for solid tumors. slaulederkind 2024-02-23T14:57:46Z PMID:33881353 bleomycin a2 experimental_condition_ontology XCO:0001298 bleomycin This is any condition in which the main influencing factor is bleomycin, a complex of related glycopeptide antibiotics from Streptomyces verticillus consisting of bleomycin A2 and B2. Bleomycin inhibits DNA metabolism and is used as an antineoplastic, especially for solid tumors. CID:5360373 This is any condition in which the main influencing factor is a middle cerebral artery (MCA) occlusion sham procedure, which follows the same surgical process as an MCA occlusion without blocking the middle cerebral artery. slaulederkind 2024-02-26T14:15:53Z PMID:2643202 PMID:33935709 MCA occlusion sham procedure MCA occlusion sham surgery middle cerebral artery occlusion sham surgery experimental_condition_ontology XCO:0001299 middle cerebral artery occlusion sham procedure This is any condition in which the main influencing factor is a middle cerebral artery (MCA) occlusion sham procedure, which follows the same surgical process as an MCA occlusion without blocking the middle cerebral artery. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is cerebral reperfusion, any situation in which the flow of blood to the cerebral hemispheres is restored after a period of blood vessel occlusion occurring experimentally. slaulederkind 2024-02-27T14:36:39Z PMID:33935709 cerebral ischemia-reperfusion cerebral ischemia/reperfusion cerebrum ischemia-reperfusion cerebrum ischemia/reperfusion cerebrum reperfusion experimental_condition_ontology XCO:0001300 cerebral reperfusion This is any condition in which the main influencing factor is cerebral reperfusion, any situation in which the flow of blood to the cerebral hemispheres is restored after a period of blood vessel occlusion occurring experimentally. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is AEGE extract, an herbal mixture extracted from the dried roots and rhizomes or stems of Acanthopanax senticosus Harms (ASH; Eleutherococcus senticosus; Siberian Ginseng) and Gastrodia elata Blume (Tianma; GE). slaulederkind 2024-02-27T15:16:18Z AEGE ASE and GEB GEB-ASE experimental_condition_ontology XCO:0001301 AEGE extract This is any condition in which the main influencing factor is AEGE extract, an herbal mixture extracted from the dried roots and rhizomes or stems of Acanthopanax senticosus Harms (ASH; Eleutherococcus senticosus; Siberian Ginseng) and Gastrodia elata Blume (Tianma; GE). PMID:33935709 This is any condition in which the main influencing factor is dapagliflozin, a sodium-glucose cotransporter 2 (SGLT2) inhibitor used for managing diabetes mellitus type 2. slaulederkind 2024-03-01T10:57:39Z CHEBI:85078 MESH:C529054 PMID:37383701 (1S)-1,5-anhydro-1-[4-chloro-3-(4-ethoxybenzyl)phenyl]-D-glucitol DAPA experimental_condition_ontology XCO:0001302 dapagliflozin This is any condition in which the main influencing factor is dapagliflozin, a sodium-glucose cotransporter 2 (SGLT2) inhibitor used for managing diabetes mellitus type 2. CID:9887712 This is any condition in which the main influencing factor is sinomenine, a unique plant alkaloid that releases histamine in association with degranulation of tissue mast cells in mammalian tissues. Sinomenine has been used in herbal medicine for the treatment of rheumatism and arthritis. Sinomenine also has anti-angiogenic, anti-inflammatory, and anti-apoptotic effects. slaulederkind 2024-03-01T11:26:11Z CHEBI:9163 MESH:C009271 PMID:61710 cocculine cucoline cuculine experimental_condition_ontology XCO:0001303 sinomenine This is any condition in which the main influencing factor is sinomenine, a unique plant alkaloid that releases histamine in association with degranulation of tissue mast cells in mammalian tissues. Sinomenine has been used in herbal medicine for the treatment of rheumatism and arthritis. Sinomenine also has anti-angiogenic, anti-inflammatory, and anti-apoptotic effects. CID:5459308 This is any condition in which the main influencing factor is Danlu tongdu, a Chinese patent medicine made up of five traditional Chinese drugs, including Salviae miltiorrhizae, Astragali radix, Eucommiae cortex, Corydalis rhizoma and Cervi cornus colla. Danlu tongdu is used in treatment of lumbar spinal stenosis and lumbosacral disc herniations, but has some adverse side-effects on liver. slaulederkind 2024-03-04T17:50:54Z DLTD experimental_condition_ontology XCO:0001304 Danlu tongdu This is any condition in which the main influencing factor is Danlu tongdu, a Chinese patent medicine made up of five traditional Chinese drugs, including Salviae miltiorrhizae, Astragali radix, Eucommiae cortex, Corydalis rhizoma and Cervi cornus colla. Danlu tongdu is used in treatment of lumbar spinal stenosis and lumbosacral disc herniations, but has some adverse side-effects on liver. PMID:36408216 This is any condition in which the main influencing factor is pulmonary artery occlusion, a clinical or experimental surgical procedure which restricts the amount of blood flow to the lung via the pulmonary artery. slaulederkind 2024-03-05T13:47:25Z PMID:36631871 PAB pulmonary artery banding pulmonary artery ligation experimental_condition_ontology XCO:0001305 pulmonary artery occlusion This is any condition in which the main influencing factor is pulmonary artery occlusion, a clinical or experimental surgical procedure which restricts the amount of blood flow to the lung via the pulmonary artery. PMID:32809673 This is a condition induced by an mechanical procedure involving controlled trauma to skeletal muscle. The controlled muscle trauma may be to model contusion, strain, or laceration. slaulederkind 2024-03-08T14:04:49Z experimental mechanical muscle injury experimental muscle contusion experimental muscle laceration experimental muscle strain experimental_condition_ontology XCO:0001306 experimental traumatic muscle injury This is a condition induced by an mechanical procedure involving controlled trauma to skeletal muscle. The controlled muscle trauma may be to model contusion, strain, or laceration. PMID:23328717 PMID:24011855 This is a condition induced by an mechanical procedure involving controlled trauma to skeletal muscle, such as the vastus medialis (part of the quadriceps muscle). Controlled muscle contusion has been used to model myofascial pain syndrome and other skeletal muscle injuries. slaulederkind 2024-03-08T14:37:50Z experimental muscle bruise experimental_condition_ontology XCO:0001307 experimental muscle contusion This is a condition induced by an mechanical procedure involving controlled trauma to skeletal muscle, such as the vastus medialis (part of the quadriceps muscle). Controlled muscle contusion has been used to model myofascial pain syndrome and other skeletal muscle injuries. PMID:23328717 PMID:24011855 This is any condition in which the main influencing factor is Erxian decoction, a six-herb formulation from traditional Chinese medicine (TCM). Erxian decoction (ERX) has been used for the treatment of menopausal symptoms and also for spinal cord injury. slaulederkind 2024-03-18T14:40:55Z EXD Er-Xian Decoction experimental_condition_ontology Er xian tang Erxian tang Two Immortals Decoction XCO:0001308 Erxian decoction This is any condition in which the main influencing factor is Erxian decoction, a six-herb formulation from traditional Chinese medicine (TCM). Erxian decoction (ERX) has been used for the treatment of menopausal symptoms and also for spinal cord injury. PMID:30658181 PMID:36387579 This is any condition in which the main influencing factor is methylprednisolone sodium succinate, the sodium succinate salt of a synthetic glucocorticoid receptor agonist with immunosuppressive and anti-inflammatory effects. Methylprednisolone sodium succinate is converted into active prednisolone in the body, which activates the glucocorticoid receptor. slaulederkind 2024-03-18T15:13:22Z CHEBI:6890 MPL sodium succinate experimental_condition_ontology XCO:0001309 methylprednisolone sodium succinate This is any condition in which the main influencing factor is methylprednisolone sodium succinate, the sodium succinate salt of a synthetic glucocorticoid receptor agonist with immunosuppressive and anti-inflammatory effects. Methylprednisolone sodium succinate is converted into active prednisolone in the body, which activates the glucocorticoid receptor. CID:23680530 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of methylprednisolone sodium succinate, the sodium succinate salt of a synthetic glucocorticoid receptor agonist with immunosuppressive and anti-inflammatory effects. slaulederkind 2024-03-18T15:25:49Z CHEBI:6890 controlled MPL sodium succinate content drinking water experimental_condition_ontology XCO:0001310 controlled methylprednisolone sodium succinate content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of methylprednisolone sodium succinate, the sodium succinate salt of a synthetic glucocorticoid receptor agonist with immunosuppressive and anti-inflammatory effects. CID:23680530 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is Pkc-IN-1, a potent, ATP-competitive inhibitor of PKC&#945; and PKC&#946;. slaulederkind 2024-03-18T16:52:03Z CAS:1046787-18-1 CID:25155745 5-[(2S,5R)-2,5-dimethyl-4-(tetrahydro-2H-pyran-4-ylmethyl)piperazin-l-yl]carbonyl-N-(5-fluoro-2-methylpyrimidin-4-yl)-6, 6-dimethyl-1,4, 5, 6-tetrahydropyrrolo[3,4-c]pyrazol-3-amine Cmpd 1 Cmpd A experimental_condition_ontology XCO:0001311 Pkc-IN-1 This is any condition in which the main influencing factor is Pkc-IN-1, a potent, ATP-competitive inhibitor of PKC&#945; and PKC&#946;. PMID:37805649 This is any condition in which the main influencing factor is a solid diet in which the amount of Pkc-IN-1 is maintained at a specified level. Pkc-IN-1 is a potent, ATP-competitive inhibitor of PKC&#945; and PKC&#946;. slaulederkind 2024-03-19T12:09:44Z controlled Cmpd 1 content diet controlled Cmpd A content diet experimental_condition_ontology XCO:0001312 controlled Pkc-IN-1 content diet This is any condition in which the main influencing factor is a solid diet in which the amount of Pkc-IN-1 is maintained at a specified level. Pkc-IN-1 is a potent, ATP-competitive inhibitor of PKC&#945; and PKC&#946;. PMID:37805649 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is transection of the inferior alveolar nerve, a model of a peripheral nerve injury. The inferior alveolar nerve (IAN) is a branch of the mandibular nerve in the lower jaw. The inferior alveolar nerve branches into the mylohyoid nerve and the mental nerve. slaulederkind 2024-03-19T12:35:17Z IANX transection of the inferior alveolar nerve experimental_condition_ontology XCO:0001313 inferior alveolar nerve transection This is any condition in which the main influencing factor is transection of the inferior alveolar nerve, a model of a peripheral nerve injury. The inferior alveolar nerve (IAN) is a branch of the mandibular nerve in the lower jaw. The inferior alveolar nerve branches into the mylohyoid nerve and the mental nerve. PMID:37946211 https://www.ncbi.nlm.nih.gov/books/NBK546712/ This is any condition in which the main influencing factor is forced activity in rotating cylinder, which can be used with rodents as a model of human shift work. The rotating cylinder (~1 revolution per 3 minutes) forces the subject to move and reposition repeatedly during a specified period. slaulederkind 2024-03-19T13:33:03Z shift work simulation night shift work simulation experimental_condition_ontology XCO:0001314 forced activity in rotating cylinder This is any condition in which the main influencing factor is forced activity in rotating cylinder, which can be used with rodents as a model of human shift work. The rotating cylinder (~1 revolution per 3 minutes) forces the subject to move and reposition repeatedly during a specified period. PMID:35236346 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is Tianhe Zhuifeng Gao, a complex mixture of herbal and other medicinal ingredients. Tianhe Zhuifeng Gao is an external analgesic used as a plaster formulation or a liquid extract. slaulederkind 2024-03-19T17:19:02Z TZG Zhui Feng Gao experimental_condition_ontology XCO:0001315 Tianhe Zhuifeng Gao This is any condition in which the main influencing factor is Tianhe Zhuifeng Gao, a complex mixture of herbal and other medicinal ingredients. Tianhe Zhuifeng Gao is an external analgesic used as a plaster formulation or a liquid extract. PMID:37860777 https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=28457a0b-e7de-4e37-a554-edf4e2000898&audience=consumer This is any condition in which the main influencing factor is methamphetamine, a member of the class of amphetamines in which the amino group of (S)-amphetamine carries a methyl substituent. slaulederkind 2024-03-21T15:13:20Z CID:10836 MESH:D008694 PMID:33238484 (2S)-N-methyl-1-phenylpropan-2-amine experimental_condition_ontology XCO:0001316 methamphetamine This is any condition in which the main influencing factor is methamphetamine, a member of the class of amphetamines in which the amino group of (S)-amphetamine carries a methyl substituent. CHEBI:6809 This is any condition in which the main influencing factor is an experimental surgical procedure involving hemilaminectomy/laminectomy of the fourth cervical vertebra and delivery of a controlled contusion to one side of the spinal cord by a mechanical apparatus. slaulederkind 2024-03-21T17:02:00Z spinal cord injury at C4 spinal cord injury at the fourth cervical vertebra spinal cord hemi-contusion at C4 experimental_condition_ontology XCO:0001317 C4 spinal cord hemi-contusion This is any condition in which the main influencing factor is an experimental surgical procedure involving hemilaminectomy/laminectomy of the fourth cervical vertebra and delivery of a controlled contusion to one side of the spinal cord by a mechanical apparatus. PMID:25929319 PMID:34267212 This is any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to a specific area of motor cortex. This is done with implanted electrode(s). slaulederkind 2024-03-21T17:30:51Z brain stimulation via implanted electrode array experimental_condition_ontology XCO:0001318 motor cortex stimulation via implanted electrode array This is any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to a specific area of motor cortex. This is done with implanted electrode(s). PMID:34267212 http://braininfo.rprc.washington.edu/Default.aspx This is any condition in which the main influencing factor is implantation of a 3D printed scaffold, an artificial construct which mimics the extracellular matrix of the host tissue. The scaffold may be made of natural or synthetic polymers, metal, or ceramic. slaulederkind 2024-03-25T14:44:30Z PMID:35040587 experimental_condition_ontology XCO:0001319 3D printed scaffold implantation This is any condition in which the main influencing factor is implantation of a 3D printed scaffold, an artificial construct which mimics the extracellular matrix of the host tissue. The scaffold may be made of natural or synthetic polymers, metal, or ceramic. https://www.sciencedirect.com/science/article/pii/S2590238522002983 https://www.sciencedirect.com/topics/materials-science/scaffold-for-tissue-engineering This is any condition in which the main influencing factor is implantation of a 3D printed gelatin-methacryloyl (GelMA) scaffold, a tissue scaffold made of the bioprintable, natural polymer hydrogel gelatin methacryloyl. GelMA has been widely utilized for diverse tissue engineering applications. slaulederkind 2024-03-25T15:16:51Z PMID:35040587 PMID:38507816 3D printed gelatin methacryloyl scaffold implant 3D printed gelatin methacryloyl scaffold implantation experimental_condition_ontology XCO:0001320 3D printed GelMA scaffold implantation This is any condition in which the main influencing factor is implantation of a 3D printed gelatin-methacryloyl (GelMA) scaffold, a tissue scaffold made of the bioprintable, natural polymer hydrogel gelatin methacryloyl. GelMA has been widely utilized for diverse tissue engineering applications. PMID:38507816 This is any condition in which the main influencing factor is implantation of a 3D printed polycaprolactone (PCL) scaffold, a tissue scaffold made of the printable, synthetic polymer material polycaprolactone. PCL has been used in bone tissue engineering due to its advantages such as good biocompatibility, slow degradation rate, and the potential for loadbearing applications. PCL has also been tested for tendon repair. slaulederkind 2024-03-25T15:49:18Z 3D printed polycaprolactone scaffold implantation experimental_condition_ontology XCO:0001321 3D printed PCL scaffold implantation This is any condition in which the main influencing factor is implantation of a 3D printed polycaprolactone (PCL) scaffold, a tissue scaffold made of the printable, synthetic polymer material polycaprolactone. PCL has been used in bone tissue engineering due to its advantages such as good biocompatibility, slow degradation rate, and the potential for loadbearing applications. PCL has also been tested for tendon repair. PMID:35040587 This is any condition in which the main influencing factor is implantation of a 3D printed β‐TCP scaffold, a tissue scaffold made of a printable, bioceramic material (mainly β‐tricalcium phosphate/β‐TCP). β-tricalcium phosphate (β-TCP) is one the most used and potent synthetic bone graft substitutes. β-TCP has the beneficial properties of biocompatibility, osteoconductivity, osteoinductivity, and biodegradability. slaulederkind 2024-03-26T13:38:24Z PMID:35040587 3D printed β-tricalcium phosphate scaffold implant 3D printed β-tricalcium phosphate scaffold implantation experimental_condition_ontology XCO:0001322 3D printed β‐TCP scaffold implantation This is any condition in which the main influencing factor is implantation of a 3D printed β‐TCP scaffold, a tissue scaffold made of a printable, bioceramic material (mainly β‐tricalcium phosphate/β‐TCP). β-tricalcium phosphate (β-TCP) is one the most used and potent synthetic bone graft substitutes. β-TCP has the beneficial properties of biocompatibility, osteoconductivity, osteoinductivity, and biodegradability. PMID:35669331 This is any condition in which the main influencing factor is an experimental drill-hole bone defect, a controlled, precisely defined defect created with a surgical bone drill. This type of bone defect is made in laboratory animals to study the healing of bone fractures and sometimes for delivery of therapeutic substances. slaulederkind 2024-03-26T14:13:37Z PMID:35040587 https://www.osmosis.org/answers/trephination experimental_condition_ontology burr holing trepanation trepanning trephination XCO:0001323 experimental drill-hole bone defect This is any condition in which the main influencing factor is an experimental drill-hole bone defect, a controlled, precisely defined defect created with a surgical bone drill. This type of bone defect is made in laboratory animals to study the healing of bone fractures and sometimes for delivery of therapeutic substances. PMID:35849443 This is any condition in which the main influencing factor is an injection or infusion of human neural progenitor cells derived from the H1 human embryonic stem cell line (H1-hESC). slaulederkind 2024-03-26T14:55:28Z PMID:18564034 https://www.wicell.org/home/stem-cells/catalog-of-stem-cell-lines/wa01.cmsx H1-derived hNPCs experimental_condition_ontology XCO:0001324 H1-hESC-derived hNPCs This is any condition in which the main influencing factor is an injection or infusion of human neural progenitor cells derived from the H1 human embryonic stem cell line (H1-hESC). PMID:35030322 This is any condition in which the main influencing factor is 3-aminoisobutyric acid, which is isobutyric acid in which one of the methyl hydrogens is substituted by an amino group. During exercise, 3-aminoisobutyric acid is secreted by muscle cells into the blood, and when this molecule interacts with adipocytes, it may induce signaling pathways that regulate the metabolism of fats, insulin, and cholesterol. slaulederkind 2024-03-28T13:08:38Z CAS:144-90-1 CHEBI:27389 3-amino-2-methylpropanoic acid BAIBA beta-aminoisobutyric acid experimental_condition_ontology XCO:0001325 3-aminoisobutyric acid This is any condition in which the main influencing factor is 3-aminoisobutyric acid, which is isobutyric acid in which one of the methyl hydrogens is substituted by an amino group. During exercise, 3-aminoisobutyric acid is secreted by muscle cells into the blood, and when this molecule interacts with adipocytes, it may induce signaling pathways that regulate the metabolism of fats, insulin, and cholesterol. CID:64956 This is any condition in which the main influencing factor is a left anterior descending coronary artery occlusion sham procedure, which follows the same surgical process as an left anterior descending coronary artery occlusion without blocking the left anterior descending coronary artery. slaulederkind 2024-03-28T13:27:56Z LAD occlusion sham procedure interventricular artery occlusion sham procedure left anterior descending artery occlusion sham procedure experimental_condition_ontology XCO:0001326 left anterior descending coronary artery occlusion sham procedure This is any condition in which the main influencing factor is a left anterior descending coronary artery occlusion sham procedure, which follows the same surgical process as an left anterior descending coronary artery occlusion without blocking the left anterior descending coronary artery. PMID:35282369 This is any condition in which the main influencing factor is letrozole, a triazole and benzonitrile derivative that is a selective non-steroidal aromatase inhibitor, similar to anastrozole. Letrozole is used in the treatment of metastatic or locally advanced breast cancer in postmenopausal women. slaulederkind 2024-03-28T14:12:18Z CHEBI:6413 CID:3902 4,4'-(1H-1,2,4-triazol-1-ylmethanediyl)dibenzonitrile experimental_condition_ontology XCO:0001327 letrozole This is any condition in which the main influencing factor is letrozole, a triazole and benzonitrile derivative that is a selective non-steroidal aromatase inhibitor, similar to anastrozole. Letrozole is used in the treatment of metastatic or locally advanced breast cancer in postmenopausal women. MESH:D000077289 This is any condition in which the main influencing factor is a mogroside, a glycoside of cucurbitane derivatives found in certain plants, such as monkfruit (S. grosvenorii). Mogrosides are extracted from monkfruit and used in the manufacture of sugar substitutes. Mogrosides have shown some efficacy as anticarcinogens, anti-inflammatory agents, sugar- and lipid-lowering agents. slaulederkind 2024-03-28T14:43:56Z CHEBI:139477 PMID:35418943 mogrosides experimental_condition_ontology XCO:0001328 mogroside This is any condition in which the main influencing factor is a mogroside, a glycoside of cucurbitane derivatives found in certain plants, such as monkfruit (S. grosvenorii). Mogrosides are extracted from monkfruit and used in the manufacture of sugar substitutes. Mogrosides have shown some efficacy as anticarcinogens, anti-inflammatory agents, sugar- and lipid-lowering agents. https://en.wikipedia.org/wiki/Mogroside https://www.future-science.com/doi/10.4155/fmc-2017-0255 This is any condition in which the main influencing factor is an opioid analgesic. Opioids (synthetic or semisynthetic) and opiates (related natural alkaloids) make up this class of medication used in the management and treatment of pain. slaulederkind 2024-04-01T13:31:08Z narcotic analgesic experimental_condition_ontology XCO:0001329 opioid analgesic This is any condition in which the main influencing factor is an opioid analgesic. Opioids (synthetic or semisynthetic) and opiates (related natural alkaloids) make up this class of medication used in the management and treatment of pain. CHEBI:35482 PMID:31643200 https://www.ncbi.nlm.nih.gov/books/NBK459161/ This is any condition in which the main influencing factor is oxycodone, a semisynthetic opioid analgesic derived from thebaine. slaulederkind 2024-04-01T14:11:43Z CID:5284603 MESH:D010098 14-hydroxy-3-methoxy-17-methyl-4,5alpha-epoxymorphinan-6-one experimental_condition_ontology XCO:0001330 oxycodone This is any condition in which the main influencing factor is oxycodone, a semisynthetic opioid analgesic derived from thebaine. CHEBI:7852 This is any condition in which the main influencing factor is any pregestational maternal exposure to oxycodone. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F1 offspring. slaulederkind 2024-04-01T15:32:46Z CHEBI:7852 CID:5284603 PMID:25839742 PMID:33490084 maternal exposure to oxycodone prior to a pregnancy pregestational maternal exposure to 14-hydroxy-3-methoxy-17-methyl-4,5alpha-epoxymorphinan-6-one experimental_condition_ontology XCO:0001331 pregestational maternal exposure to oxycodone This is any condition in which the main influencing factor is any pregestational maternal exposure to oxycodone. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F1 offspring. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to oxycodone. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F1 offspring. slaulederkind 2024-04-01T16:10:18Z CHEBI:7852 PMID:25839742 PMID:33490084 maternal exposure to oxycodone during pregnancy experimental_condition_ontology XCO:0001332 gestational maternal exposure to oxycodone This is any condition in which the main influencing factor is any gestational maternal exposure to oxycodone. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to oxycodone during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure during the postnatal, preweaning period on the F1 offspring. slaulederkind 2024-04-02T11:12:02Z CHEBI:7852 PMID:33490084 maternal exposure to oxycodone during nursing of offspring experimental_condition_ontology XCO:0001333 maternal exposure to oxycodone during nursing This is any condition in which the main influencing factor is any maternal exposure to oxycodone during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure during the postnatal, preweaning period on the F1 offspring. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to oxycodone that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2024-04-04T10:34:20Z CHEBI:7852 PMID:33490084 experimental_condition_ontology XCO:0001334 multigenerational maternal exposure to oxycodone This is any condition in which the main influencing factor is any maternal exposure to oxycodone that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any maternal exposure to oxycodone that has transgenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation. slaulederkind 2024-04-04T11:04:06Z CHEBI:7852 PMID:33490084 experimental_condition_ontology XCO:0001335 transgenerational maternal exposure to oxycodone This is any condition in which the main influencing factor is any maternal exposure to oxycodone that has transgenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is enrofloxacin, an antibiotic and antineoplastic agent from the fluoroquinolone family used in veterinary medicine. slaulederkind 2024-04-05T10:35:00Z CHEBI:35720 MESH:D000077422 PMID:34267212 1-cyclopropyl-7-(4-ethylpiperazin-1-yl)-6-fluoro-4-oxo-1,4-dihydroquinoline-3-carboxylic acid Baytril experimental_condition_ontology XCO:0001336 enrofloxacin This is any condition in which the main influencing factor is enrofloxacin, an antibiotic and antineoplastic agent from the fluoroquinolone family used in veterinary medicine. CID:71188 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of enrofloxacin, in which the amount of enrofloxacin consumed is maintained at a specified level. Enrofloxacin is an antibiotic and antineoplastic agent from the fluoroquinolone family used in veterinary medicine. slaulederkind 2024-04-05T10:52:59Z CHEBI:35720 MESH:D000077422 PMID:34267212 controlled Baytril content drinking water experimental_condition_ontology XCO:0001337 controlled enrofloxacin content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of enrofloxacin, in which the amount of enrofloxacin consumed is maintained at a specified level. Enrofloxacin is an antibiotic and antineoplastic agent from the fluoroquinolone family used in veterinary medicine. CID:71188 https://www.merriam-webster.com This is any condition in which the main influencing factor is human, adipose-derived stromal cells, which are isolated from lipoaspirates from healthy adult donors. They are mesenchymal stem cells that can be expanded in culture slaulederkind 2024-04-08T13:22:27Z ASC AT?MSCs PLA cells adipose tissue mesenchymal stem cells adipose-derived mesenchymal stem cells human ASC human PLA cells human, adipose-derived stromal cells processed lipoaspirate cells experimental_condition_ontology XCO:0001338 human adipose-derived stromal cells This is any condition in which the main influencing factor is human, adipose-derived stromal cells, which are isolated from lipoaspirates from healthy adult donors. They are mesenchymal stem cells that can be expanded in culture PMID:35566725 This is any experimental condition in which the main influencing factor is human serum. Human serum is used in tissue engineering, transplantation and cell therapy applications, for the expansion of mesenchymal stem cells (MSC) from adipose tissue or bone marrow, ex vivo expansion of peripheral blood cells, etc. slaulederkind 2024-04-08T14:04:38Z MESH:D044967 PMID:35566725 human blood plasma without the clotting factors experimental_condition_ontology XCO:0001339 human serum This is any experimental condition in which the main influencing factor is human serum. Human serum is used in tissue engineering, transplantation and cell therapy applications, for the expansion of mesenchymal stem cells (MSC) from adipose tissue or bone marrow, ex vivo expansion of peripheral blood cells, etc. https://en.wikipedia.org/wiki/Serum_(blood) https://www.sigmaaldrich.com/US/en/product/sigma/h4522 This is any condition in which the main influencing factor is human, skin-derived ABCB5+ stromal cells, which are ABCB5-positive mesenchymal stem cells (MSCs) isolated from skin of healthy adult donors and can be expanded in culture. ABCB5+ MSCs are used in therapy for chronic wounds and other skin diseases. slaulederkind 2024-04-08T14:45:47Z PMID:35566725 ABCB5+ MSCs ABCB5-positive mesenchymal stem cells human, skin-derived ABCB5+ stromal cells experimental_condition_ontology XCO:0001340 human skin-derived ABCB5+ stromal cells This is any condition in which the main influencing factor is human, skin-derived ABCB5+ stromal cells, which are ABCB5-positive mesenchymal stem cells (MSCs) isolated from skin of healthy adult donors and can be expanded in culture. ABCB5+ MSCs are used in therapy for chronic wounds and other skin diseases. https://www.gesundheitsindustrie-bw.de/en/article/news/innovative-stem-cell-therapy-chronic-wounds This is any condition in which the main influencing factor is cultured cell-conditioned medium, which consists of the liquid nutrient medium the cells are grown in plus soluble factors secreted by the cells. slaulederkind 2024-04-08T16:41:42Z PMID:35566725 conditioned culture medium cultured cell-conditioned medium experimental_condition_ontology XCO:0001341 conditioned medium This is any condition in which the main influencing factor is cultured cell-conditioned medium, which consists of the liquid nutrient medium the cells are grown in plus soluble factors secreted by the cells. PMID:30595826 This is any condition in which the main influencing factor is human, adipose-derived stromal cell-conditioned medium, which consists of the liquid nutrient medium the cells are grown in plus soluble factors secreted by the cells. slaulederkind 2024-04-08T20:18:39Z PMID:35566725 human ASC-conditioned medium human PLA-conditioned medium experimental_condition_ontology XCO:0001342 human, adipose-derived stromal cell-conditioned medium This is any condition in which the main influencing factor is human, adipose-derived stromal cell-conditioned medium, which consists of the liquid nutrient medium the cells are grown in plus soluble factors secreted by the cells. PMID:30595826 This is any condition in which the main influencing factor is a co-culture of human, skin-derived ABCB5+ stromal cells and THP-1-derived macrophage-conditioned medium, which consists of the liquid nutrient medium the cells are grown in plus soluble factors secreted by the cells. slaulederkind 2024-04-08T20:36:46Z PMID:35566725 ABCB5+ MSC/THP-1 conditioned medium ABCB5+-derived CoCM+ experimental_condition_ontology XCO:0001343 human, skin-derived ABCB5+ MSC/THP-1-conditioned medium This is any condition in which the main influencing factor is a co-culture of human, skin-derived ABCB5+ stromal cells and THP-1-derived macrophage-conditioned medium, which consists of the liquid nutrient medium the cells are grown in plus soluble factors secreted by the cells. PMID:30595826 This is any condition in which the main influencing factor is Streptococcus pneumoniae strain 262, a bacterium isolated from the sputum of a human male. This bacterial culture has applications in respiratory disease research. This strain is serotype 19 (Danish designation 19F). slaulederkind 2024-04-09T14:42:02Z PMID:35784337 Streptococcus Pneumonia Serotype 19F Streptococcus pneumoniae strain 262 Streptococcus pneumoniae strain 262, serotype 19 experimental_condition_ontology XCO:0001344 Streptococcus pneumoniae 262 This is any condition in which the main influencing factor is Streptococcus pneumoniae strain 262, a bacterium isolated from the sputum of a human male. This bacterial culture has applications in respiratory disease research. This strain is serotype 19 (Danish designation 19F). ATCC:49619 This is any condition in which the main influencing factor is splenic stimulation via ultrasound, a method to noninvasively modulate neural signaling in the spleen. slaulederkind 2024-04-09T15:10:22Z PMID:30862827 splenic U/S neuromodulation splenic U/S stimulation splenic ultrasound stimulation ultrasound-induced neuromodulation of spleen experimental_condition_ontology XCO:0001345 splenic ultrasound neuromodulation This is any condition in which the main influencing factor is splenic stimulation via ultrasound, a method to noninvasively modulate neural signaling in the spleen. PMID:35784337 This is any condition in which the main influencing factor is enalaprilat, the active metabolite of the orally available pro-drug enalapril. Used in the treatment of hypertension, heart failure, and nephropathies, enalapril is an ACE inhibitor that prevents Angiotensin Converting Enzyme (ACE) from transforming angiotensin I into angiotensin II. Enalaprilat is enalapril in which the ethyl ester group has been hydrolysed to the corresponding carboxylic acid. slaulederkind 2024-04-12T12:43:11Z CHEBI:4786 CHEBI:59877 N-[(1S)-1-carboxy-3-phenylpropyl]-L-alanyl-L-proline experimental_condition_ontology enalaprilat (anhydrous) enalaprilat dihydrate XCO:0001346 enalaprilat This is any condition in which the main influencing factor is enalaprilat, the active metabolite of the orally available pro-drug enalapril. Used in the treatment of hypertension, heart failure, and nephropathies, enalapril is an ACE inhibitor that prevents Angiotensin Converting Enzyme (ACE) from transforming angiotensin I into angiotensin II. Enalaprilat is enalapril in which the ethyl ester group has been hydrolysed to the corresponding carboxylic acid. CID:5462501 This is any condition in which the main influencing factor is Compound 1, a bicyclic molecule (patented by Merck & Co., Inc.) that can have various substituents and is a soluble guanylate cyclase activator. slaulederkind 2024-04-12T13:02:34Z PMID:35085251 experimental_condition_ontology XCO:0001347 Compound 1 This is any condition in which the main influencing factor is Compound 1, a bicyclic molecule (patented by Merck & Co., Inc.) that can have various substituents and is a soluble guanylate cyclase activator. PatentNo:_US_9,365,574_B2 This is any condition in which the main influencing factor is a controlled Compound 1 content diet, a regimen of solid food in which the amount of Compound 1 consumed is controlled. Coumpound 1 is a soluble guanylate cyclase activator. slaulederkind 2024-04-12T13:13:10Z PMID:35085251 experimental_condition_ontology XCO:0001348 controlled Compound 1 content diet This is any condition in which the main influencing factor is a controlled Compound 1 content diet, a regimen of solid food in which the amount of Compound 1 consumed is controlled. Coumpound 1 is a soluble guanylate cyclase activator. PatentNo:_US_9,365,574_B2 https://www.merriam-webster.com This is any condition in which the main influencing factor is a controlled enalapril content diet, a regimen of solid food in which the amount of enalapril consumed is controlled. Enalapril is a prodrug that is rapidly metabolized in the liver to enalaprilat, a potent, competitive inhibitor of angiotensin-converting enzyme (ACE). slaulederkind 2024-04-12T13:28:02Z CHEBI:4784 PMID:35085251 experimental_condition_ontology XCO:0001349 controlled enalapril content diet This is any condition in which the main influencing factor is a controlled enalapril content diet, a regimen of solid food in which the amount of enalapril consumed is controlled. Enalapril is a prodrug that is rapidly metabolized in the liver to enalaprilat, a potent, competitive inhibitor of angiotensin-converting enzyme (ACE). https://en.wikipedia.org/wiki/Enalapril https://www.merriam-webster.com This is any condition in which the main influencing factor is diallyl trisulfide, an organic trisulfide that is trisulfane in which both of the hydrogens are replaced by allyl groups. Diallyl trisulfide is a component of the essential oil of garlic and a major component of the traditional Chinese medicine allitridium. Diallyl trisulfide has multiple medicinal effects. slaulederkind 2024-04-12T13:54:25Z CID:16315 MESH:C042577 PMID:35419300 DATS diallyltrisulfane experimental_condition_ontology XCO:0001350 diallyl trisulfide This is any condition in which the main influencing factor is diallyl trisulfide, an organic trisulfide that is trisulfane in which both of the hydrogens are replaced by allyl groups. Diallyl trisulfide is a component of the essential oil of garlic and a major component of the traditional Chinese medicine allitridium. Diallyl trisulfide has multiple medicinal effects. CHEBI:78492 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of neomycin sulfate, the sulfate salt form of neomycin, a broad spectrum aminoglycoside antibiotic derived from Streptomyces fradiae with antibacterial activity. Neomycin is an antibiotic complex consisting of 3 components: the two isomeric components B and C are the active components, and neomycin A is the minor component. Neomycin is a protein synthesis inhibitor and bacteriacidal agent. slaulederkind 2024-04-15T11:11:20Z CHEBI:31635 PMID:32119089 SID:483925982 experimental_condition_ontology XCO:0001352 controlled neomycin sulfate content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of neomycin sulfate, the sulfate salt form of neomycin, a broad spectrum aminoglycoside antibiotic derived from Streptomyces fradiae with antibacterial activity. Neomycin is an antibiotic complex consisting of 3 components: the two isomeric components B and C are the active components, and neomycin A is the minor component. Neomycin is a protein synthesis inhibitor and bacteriacidal agent. CID:62403 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of metronidazole, a commonly used antibiotic, belonging to the nitroimidazole class of antibiotics. Metronidazole is frequently used to treat gastrointestinal infections and parasitic infections such as trichomoniasis, giardiasis, and amebiasis. The antiparasitic of properties of metronidazole set it apart from many other antibacterial drugs, allowing it to treat a wider variety of infections. slaulederkind 2024-04-15T11:23:39Z CHEBI:6909 MESH:D008795 controlled 2-(2-methyl-5-nitro-1H-imidazol-1-yl)ethanol content drinking water experimental_condition_ontology XCO:0001353 controlled metronidazole content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of metronidazole, a commonly used antibiotic, belonging to the nitroimidazole class of antibiotics. Metronidazole is frequently used to treat gastrointestinal infections and parasitic infections such as trichomoniasis, giardiasis, and amebiasis. The antiparasitic of properties of metronidazole set it apart from many other antibacterial drugs, allowing it to treat a wider variety of infections. CID:4173 This is any condition in which the main influencing factor is vancomycin hydrochloride, the hydrochloride salt of vancomycin, a branched tricyclic glycosylated peptide used for the treatment of certain bacterial infections, such as infections caused by Clostridium difficile and Staphylococcus aureus. slaulederkind 2024-04-15T12:34:59Z CHEBI:28001 MESH:D014640 experimental_condition_ontology XCO:0001354 vancomycin hydrochloride This is any condition in which the main influencing factor is vancomycin hydrochloride, the hydrochloride salt of vancomycin, a branched tricyclic glycosylated peptide used for the treatment of certain bacterial infections, such as infections caused by Clostridium difficile and Staphylococcus aureus. CID:6420023 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of vancomycin hydrochloride, the hydrochloride salt of vancomycin, a branched tricyclic glycosylated peptide used for the treatment of certain bacterial infections, such as infections caused by Clostridium difficile and Staphylococcus aureus. slaulederkind 2024-04-15T12:41:18Z CHEBI:28001 MESH:D014640 experimental_condition_ontology XCO:0001355 controlled vancomycin hydrochloride content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of vancomycin hydrochloride, the hydrochloride salt of vancomycin, a branched tricyclic glycosylated peptide used for the treatment of certain bacterial infections, such as infections caused by Clostridium difficile and Staphylococcus aureus. CID:6420023 This is any condition in which the main influencing factor is ampicillin sodium, the sodium salt form of ampicillin, a broad-spectrum semisynthetic derivative of aminopenicillin. Ampicillin sodium inhibits bacterial cell wall synthesis by binding to penicillin binding proteins, thereby inhibiting peptidoglycan synthesis, a critical component of the bacterial cell wall. slaulederkind 2024-04-15T12:48:57Z CHEBI:34535 PMID:33957990 sodium 6beta-[(2R)-2-amino-2-phenylacetamido]-2,2-dimethylpenam-3alpha-carboxylate experimental_condition_ontology XCO:0001356 ampicillin sodium This is any condition in which the main influencing factor is ampicillin sodium, the sodium salt form of ampicillin, a broad-spectrum semisynthetic derivative of aminopenicillin. Ampicillin sodium inhibits bacterial cell wall synthesis by binding to penicillin binding proteins, thereby inhibiting peptidoglycan synthesis, a critical component of the bacterial cell wall. CID:23663979 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of ampicillin sodium, the sodium salt form of ampicillin, a broad-spectrum semisynthetic derivative of aminopenicillin. Ampicillin sodium inhibits bacterial cell wall synthesis by binding to penicillin binding proteins, thereby inhibiting peptidoglycan synthesis, a critical component of the bacterial cell wall. slaulederkind 2024-04-15T12:52:59Z CHEBI:34535 PMID:33957990 controlled sodium 6beta-[(2R)-2-amino-2-phenylacetamido]-2,2-dimethylpenam-3alpha-carboxylate content drinking water experimental_condition_ontology XCO:0001357 controlled ampicillin sodium content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of ampicillin sodium, the sodium salt form of ampicillin, a broad-spectrum semisynthetic derivative of aminopenicillin. Ampicillin sodium inhibits bacterial cell wall synthesis by binding to penicillin binding proteins, thereby inhibiting peptidoglycan synthesis, a critical component of the bacterial cell wall. CID:23663979 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is fecal transplantation, a clinical or experimental procedure to collect feces from a donor and introduce them into a recipient's gastrointestinal tract. In patients the procedure can be used to control an infection of Clostridium difficile (C. diff). slaulederkind 2024-04-15T13:42:58Z FMT fecal microbial transplantation fecal microbiota transplantation fecal transplant stool transplantation experimental_condition_ontology XCO:0001358 fecal transplantation This is any condition in which the main influencing factor is fecal transplantation, a clinical or experimental procedure to collect feces from a donor and introduce them into a recipient's gastrointestinal tract. In patients the procedure can be used to control an infection of Clostridium difficile (C. diff). https://en.wikipedia.org/wiki/Fecal_microbiota_transplant https://www.hopkinsmedicine.org/health/treatment-tests-and-therapies/fecal-transplant This is any condition in which the main influencing factor is fecal transplantation from a DHEA (dehydroepiandrosterone)-treated donor, an experimental procedure to collect feces from a DHEA-treated donor and introduce them into a recipient's gastrointestinal tract. This procedure is used to investigate gut dysbiosis in various conditions, including cancer and polycystic ovary syndrome. slaulederkind 2024-04-15T14:04:09Z FMT from DHEA-treated donor fecal microbial transplantation from DHEA-treated donor fecal microbiota transplantation from DHEA-treated donor fecal transplant from DHEA-treated donor experimental_condition_ontology XCO:0001359 fecal transplantation from DHEA-treated donor This is any condition in which the main influencing factor is fecal transplantation from a DHEA (dehydroepiandrosterone)-treated donor, an experimental procedure to collect feces from a DHEA-treated donor and introduce them into a recipient's gastrointestinal tract. This procedure is used to investigate gut dysbiosis in various conditions, including cancer and polycystic ovary syndrome. PMID:33957990 https://www.hopkinsmedicine.org/health/treatment-tests-and-therapies/fecal-transplant This is any condition in which the main influencing factor is fecal transplantation from a control donor, an experimental procedure to collect feces from a control donor and introduce them into a recipient's gastrointestinal tract. This procedure is used to investigate gut dysbiosis in various conditions, including cancer and polycystic ovary syndrome. slaulederkind 2024-04-15T14:16:05Z FMT from DHEA-treated donor fecal microbial transplantation from control donor fecal microbiota transplantation from control donor fecal transplant from control donor experimental_condition_ontology XCO:0001360 fecal transplantation from control donor This is any condition in which the main influencing factor is fecal transplantation from a control donor, an experimental procedure to collect feces from a control donor and introduce them into a recipient's gastrointestinal tract. This procedure is used to investigate gut dysbiosis in various conditions, including cancer and polycystic ovary syndrome. PMID:33957990 https://www.hopkinsmedicine.org/health/treatment-tests-and-therapies/fecal-transplant This is any condition in which the main influencing factor is a pulmonary artery occlusion sham procedure, which follows the same surgical process as a pulmonary artery occlusion without blocking the pulmonary artery. slaulederkind 2024-04-16T14:35:03Z (Sham) PAB pulmonary artery sham banding pulmonary artery sham ligation sham PAB experimental_condition_ontology XCO:0001361 pulmonary artery occlusion sham procedure This is any condition in which the main influencing factor is a pulmonary artery occlusion sham procedure, which follows the same surgical process as a pulmonary artery occlusion without blocking the pulmonary artery. PMID:33064565 This is any condition in which the main influencing factor is experimental post-traumatic osteoarthritis (PTOA) of the knee joint. This model of PTOA is initiated in rodents by axial compression overload of the joint to the point of ACL (anterior cruciate ligament) rupture. slaulederkind 2024-04-19T13:27:38Z PMID:32778777 PMID:37425196 experimental PTOA of knee experimental_condition_ontology XCO:0001362 experimental, post-traumatic osteoarthritis of the knee joint This is any condition in which the main influencing factor is experimental post-traumatic osteoarthritis (PTOA) of the knee joint. This model of PTOA is initiated in rodents by axial compression overload of the joint to the point of ACL (anterior cruciate ligament) rupture. ISBN-13:9780781733908 PMID:27235904 This is any condition in which the main influencing factor is CGS 21680-filled liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and containing CGS 21680 hydrochloride. CGS 21680 is an adenosine A2a receptor (Adora2a) agonist. slaulederkind 2024-04-19T16:21:25Z https://www.tocris.com/products/cgs-21680-hydrochloride_1063 CGS 21680 liposomes CGS 21680-containing liposomes CGS21680-filled liposomes Lipo-CGS experimental_condition_ontology XCO:0001363 CGS 21680-filled liposomes This is any condition in which the main influencing factor is CGS 21680-filled liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and containing CGS 21680 hydrochloride. CGS 21680 is an adenosine A2a receptor (Adora2a) agonist. PMID:32778777 This is any condition in which the main influencing factor is isoliensinine, a bisbenzylisoquinoline alkaloid isolated from the lotus plant (Nelumbo nucifera Gaertn). Isoliensinine is claimed to have antitumor, cardioprotective, antioxidant, antidepressant, and anti-HIV properties. slaulederkind 2024-04-19T16:58:30Z CHEBI:185701 MESH:C499779 PMID:37701045 (1R)-1-[[4-hydroxy-3-[[(1R)-6-methoxy-1-[(4-methoxyphenyl)methyl]-2-methyl-3,4-dihydro-1H-isoquinolin-7-yl]oxy]phenyl]methyl]-6-methoxy-2-methyl-3,4-dihydro-1H-isoquinolin-7-ol experimental_condition_ontology XCO:0001364 isoliensinine This is any condition in which the main influencing factor is isoliensinine, a bisbenzylisoquinoline alkaloid isolated from the lotus plant (Nelumbo nucifera Gaertn). Isoliensinine is claimed to have antitumor, cardioprotective, antioxidant, antidepressant, and anti-HIV properties. PMID:33967765 https://en.wikipedia.org/wiki/Nelumbo_nucifera This is any condition in which the main influencing factor is diet-like consumption, the act or process of consuming food, drink, or other substance by way of an oral route into the body. slaulederkind 2024-04-19T18:10:27Z NCIT:C19706 NCIT:C20134 experimental_condition_ontology XCO:0001365 consumption This is any condition in which the main influencing factor is diet-like consumption, the act or process of consuming food, drink, or other substance by way of an oral route into the body. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is DMEM/F-12, a widely used basal medium for supporting the growth of many different mammalian cells. DMEM/F-12 is a 1:1 mixture of DMEM and Ham's F-12. This formulation combines DMEM's high concentrations of glucose, amino acids, and vitamins with F-12's wide variety of components. DMEM/F-12 uses a sodium bicarbonate buffer system and therefore requires a 5?10% CO2 environment to maintain physiological pH. slaulederkind 2024-04-22T16:52:52Z PMID:35030322 DMEM/F12 DMEM/Ham's F-12 Dulbecco's Modified Eagle Medium/Nutrient Mixture F-12 experimental_condition_ontology XCO:0001366 DMEM/F-12 This is any condition in which the main influencing factor is DMEM/F-12, a widely used basal medium for supporting the growth of many different mammalian cells. DMEM/F-12 is a 1:1 mixture of DMEM and Ham's F-12. This formulation combines DMEM's high concentrations of glucose, amino acids, and vitamins with F-12's wide variety of components. DMEM/F-12 uses a sodium bicarbonate buffer system and therefore requires a 5?10% CO2 environment to maintain physiological pH. https://www.merriam-webster.com/ https://www.thermofisher.com/order/catalog/product/11320033?SID=srch-srp-11320033 This is any condition in which the main influencing factor is medial meniscus transection, a model of osteoarthritis (OA) in the laboratory rat. The procedure involves transection of the medial collateral ligament, incision of the synovial membrane, and full transsection of the medial meniscus so as to form anterior and posterior halves of the meniscus. slaulederkind 2024-04-22T18:11:16Z PMID:32963278 MMT medial meniscal transection experimental_condition_ontology XCO:0001367 medial meniscus transection This is any condition in which the main influencing factor is medial meniscus transection, a model of osteoarthritis (OA) in the laboratory rat. The procedure involves transection of the medial collateral ligament, incision of the synovial membrane, and full transsection of the medial meniscus so as to form anterior and posterior halves of the meniscus. PMID:36354073 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a medial meniscus transection sham procedure, which follows the same surgical process as a medial meniscus transection without cutting the medial meniscus. slaulederkind 2024-04-22T18:33:41Z PMID:32963278 MMT sham procedure medial meniscal transection sham procedure experimental_condition_ontology XCO:0001368 medial meniscus transection sham procedure This is any condition in which the main influencing factor is a medial meniscus transection sham procedure, which follows the same surgical process as a medial meniscus transection without cutting the medial meniscus. PMID:36354073 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is exosomes, a subset (~30–150 nm diameter) of extracellular vesicles (EVs) generated by all cells from the endosomal compartment. Exosomes may carry nucleic acids, proteins, lipids, and metabolites. slaulederkind 2024-04-25T13:56:16Z PMID:37478186 EVs of endosomal origin extracellular vesicles of endosomal origin experimental_condition_ontology XCO:0001369 exosomes This is any condition in which the main influencing factor is exosomes, a subset (~30–150 nm diameter) of extracellular vesicles (EVs) generated by all cells from the endosomal compartment. Exosomes may carry nucleic acids, proteins, lipids, and metabolites. PMID:32029601 PMID:40214483 This is any condition in which the main influencing factor is Ancr/E7-modified exosomes, which are exosomes generated from Lamp2b-E7 transfected host cells, collected, and electroporated with lncRNA-ANCR. The experimental purpose of delivery of Ancr/E7-exosomes is blood vessel anticalcification. slaulederkind 2024-04-25T14:35:39Z PMID:32029601 Ancr/E7-EXO Ancr/E7-modified exosomes experimental_condition_ontology XCO:0001370 Ancr/E7-exosomes This is any condition in which the main influencing factor is Ancr/E7-modified exosomes, which are exosomes generated from Lamp2b-E7 transfected host cells, collected, and electroporated with lncRNA-ANCR. The experimental purpose of delivery of Ancr/E7-exosomes is blood vessel anticalcification. PMID:37478186 This is any condition in which the main influencing factor is Ancr/E7 exosome-modified TEBV implantation, which is the replacement of a blood vessel with a tissue-engineered blood vessel incorporating Ancr/E7 exosomes. slaulederkind 2024-04-25T15:01:50Z PMID:23181145 Ancr/E7 exosome-modified tissue-engineered blood vessel implantation PMID:32029601 experimental_condition_ontology XCO:0001371 Ancr/E7 exosome-modified TEBV implantation This is any condition in which the main influencing factor is Ancr/E7 exosome-modified TEBV implantation, which is the replacement of a blood vessel with a tissue-engineered blood vessel incorporating Ancr/E7 exosomes. PMID:37478186 This is any condition in which the main influencing factor is TEBV implantation sham surgery, which follows the same surgical process as a TEBV implantation without the replacement of a blood vessel with a tissue-engineered blood vessel. slaulederkind 2024-04-25T15:15:43Z TEBV implantation sham surgery tissue-engineered blood vessel implantation sham surgery experimental_condition_ontology XCO:0001372 TEBV implantation sham procedure This is any condition in which the main influencing factor is TEBV implantation sham surgery, which follows the same surgical process as a TEBV implantation without the replacement of a blood vessel with a tissue-engineered blood vessel. PMID:37478186 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is transection of some specific nerve, usually performed on a laboratory animal to study peripheral nerve injury. slaulederkind 2024-04-26T13:43:46Z PMID:37660072 PMID:37946211 surgical transection of nerve experimental_condition_ontology XCO:0001373 surgical nerve transection This is any condition in which the main influencing factor is transection of some specific nerve, usually performed on a laboratory animal to study peripheral nerve injury. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is spared nerve injury, a model of neuropathic pain in rodents. The model consists of ligation/transection of the common peroneal and tibial nerves (two of the three branches of the sciatic nerve), while the sural nerve (third branch of the sciatic nerve) is left intact. This allows mechanical allodynia to be measured on the surface of the ipsilateral paw. slaulederkind 2024-04-26T14:06:48Z PMID:37660072 SNI SNI model spared nerve injury model experimental_condition_ontology XCO:0001374 spared nerve injury This is any condition in which the main influencing factor is spared nerve injury, a model of neuropathic pain in rodents. The model consists of ligation/transection of the common peroneal and tibial nerves (two of the three branches of the sciatic nerve), while the sural nerve (third branch of the sciatic nerve) is left intact. This allows mechanical allodynia to be measured on the surface of the ipsilateral paw. PMID:21876524 This is any condition in which the main influencing factor is spared nerve injury sham surgery, which follows the same surgical process as a spared nerve injury without the ligation/transection of the common peroneal and tibial nerves. slaulederkind 2024-04-26T14:23:02Z PMID:37660072 SNI sham surgery spared nerve injury sham surgery experimental_condition_ontology XCO:0001375 spared nerve injury sham procedure This is any condition in which the main influencing factor is spared nerve injury sham surgery, which follows the same surgical process as a spared nerve injury without the ligation/transection of the common peroneal and tibial nerves. PMID:21876524 This is any condition in which the main influencing factor is an experimental transection of the rat spinal cord at the vertebral level of thoracic 10/11 (T10/11). This procedure involves laminectomy of the tenth vertebra and complete transection of the isolated section of spinal cord. slaulederkind 2024-04-29T15:57:35Z experimental SSCI experimental suprasacral spinal cord injury experimental_condition_ontology XCO:0001376 experimental spinal cord transection at T10/T11 This is any condition in which the main influencing factor is an experimental transection of the rat spinal cord at the vertebral level of thoracic 10/11 (T10/11). This procedure involves laminectomy of the tenth vertebra and complete transection of the isolated section of spinal cord. ISBN-13:9780781733908 PMID:37744239 This is any condition in which the main influencing factor is an experimental spinal cord transection sham procedure at T10/T11, which follows the same surgical process through laminectomy, but no spinal cord transection occurs. slaulederkind 2024-04-29T16:09:31Z experimental spinal cord transection at T10/T11 sham surgery sham SSCI sham suprasacral spinal cord injury experimental_condition_ontology XCO:0001377 experimental spinal cord transection at T10/T11 sham procedure This is any condition in which the main influencing factor is an experimental spinal cord transection sham procedure at T10/T11, which follows the same surgical process through laminectomy, but no spinal cord transection occurs. ISBN-13:9780781733908 PMID:37744239 This is any condition in which the main influencing factor is a silicon dioxide nanoparticle with a size between 1 and 100 nanometers composed of silicon dioxide. Silicon dioxide is a silicon oxide made up of linear triatomic molecules in which a silicon atom is covalently bonded to two oxygens. slaulederkind 2024-05-23T17:06:47Z CID:24261 MESH:D012822 SiNP silica nanoparticle experimental_condition_ontology XCO:0001378 silicon dioxide nanoparticle This is any condition in which the main influencing factor is a silicon dioxide nanoparticle with a size between 1 and 100 nanometers composed of silicon dioxide. Silicon dioxide is a silicon oxide made up of linear triatomic molecules in which a silicon atom is covalently bonded to two oxygens. CHEBI:30563 CHEBI:50828 This is any condition in which the main influencing factor is 4,4'-diaminodiphenylmethane, an aromatic amine that is diphenylmethane substituted at the 4-position of each benzene ring by an amino group. slaulederkind 2024-05-24T13:40:14Z CAS:101-77-9 MESH:C009505 4,4'-methylene dianiline 4,4'-methylenebisbenzenamine 4,4'-methylenedianiline experimental_condition_ontology XCO:0001379 4,4'-diaminodiphenylmethane This is any condition in which the main influencing factor is metyrapone, an aromatic ketone that is 3,3-dimethylbutan-2-one in which the methyl groups at positions 1 and 4 are replaced by pyridin-3-yl groups. It is a steroid 11beta-monooxygenase (Cyp11b1) inhibitor used in a test of the feedback hypothalamic-pituitary mechanism for the diagnosis of adrenal insufficiency. slaulederkind 2024-05-24T14:12:37Z CAS:54-36-4 CID:4174 1-Propanone, 2-methyl-1,2-di-3-pyridinyl- MET methbipyranone methopyrapone metopirone experimental_condition_ontology XCO:0001380 metyrapone This is any condition in which the main influencing factor is metyrapone, an aromatic ketone that is 3,3-dimethylbutan-2-one in which the methyl groups at positions 1 and 4 are replaced by pyridin-3-yl groups. It is a steroid 11beta-monooxygenase (Cyp11b1) inhibitor used in a test of the feedback hypothalamic-pituitary mechanism for the diagnosis of adrenal insufficiency. CHEBI:44241 MESH:D008797 This is any condition in which the main influencing factor is any maternal exposure to metyrapone that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) metyrapone use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2024-05-24T14:25:03Z CHEBI:44241 PMID:38007547 multigenerational maternal exposure to MET multigenerational maternal exposure to methbipyranone multigenerational maternal exposure to methopyrapone multigenerational maternal exposure to metopirone experimental_condition_ontology XCO:0001381 multigenerational maternal exposure to metyrapone This is any condition in which the main influencing factor is any maternal exposure to metyrapone that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) metyrapone use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to metyrapone. This is a condition typically studied to determine the effect of maternal (F0) metyrapone use/exposure on the F1 offspring. slaulederkind 2024-05-24T14:40:41Z CHEBI:44241 PMID:25839742 PMID:38007547 gestational maternal exposure to MET maternal exposure to MET during pregnancy maternal exposure to metyrapone during pregnancy experimental_condition_ontology XCO:0001382 gestational maternal exposure to metyrapone This is any condition in which the main influencing factor is any gestational maternal exposure to metyrapone. This is a condition typically studied to determine the effect of maternal (F0) metyrapone use/exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to lipopolysaccharide that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) lipopolysaccharide use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2024-05-24T14:51:07Z CHEBI:16412 PMID:38007547 multigenerational maternal exposure to LPS experimental_condition_ontology XCO:0001383 multigenerational maternal exposure to lipopolysaccharide This is any condition in which the main influencing factor is any maternal exposure to lipopolysaccharide that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) lipopolysaccharide use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to lipopolysaccharide. This is a condition typically studied to determine the effect of maternal (F0) lipopolysaccharide use/exposure on the F1 offspring. slaulederkind 2024-05-24T15:10:20Z CHEBI:16412 PMID:38007547 gestational maternal exposure to LPS maternal exposure to LPS during pregnancy maternal exposure to lipopolysaccharide during pregnancy experimental_condition_ontology XCO:0001384 gestational maternal exposure to lipopolysaccharide This is any condition in which the main influencing factor is any gestational maternal exposure to lipopolysaccharide. This is a condition typically studied to determine the effect of maternal (F0) lipopolysaccharide use/exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to saline that has multigenerational effects. This is a vehicle control condition typically studied to control for any effect of maternal (F0) saline (vehicle) use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2024-05-28T15:18:30Z PMID:38007547 multigenerational maternal exposure to 0.9% sodium chloride solution multigenerational maternal exposure to normal saline experimental_condition_ontology XCO:0001385 multigenerational maternal exposure to saline This is any condition in which the main influencing factor is any maternal exposure to saline that has multigenerational effects. This is a vehicle control condition typically studied to control for any effect of maternal (F0) saline (vehicle) use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to saline. This is a vehicle control condition typically studied to determine any effect of maternal (F0) saline (vehicle) use/exposure on the F1 offspring. slaulederkind 2024-05-28T15:26:32Z PMID:38007547 gestational maternal exposure to 0.9% sodium chloride solution gestational maternal exposure to normal saline maternal exposure to saline during pregnancy experimental_condition_ontology XCO:0001386 gestational maternal exposure to saline This is any condition in which the main influencing factor is any gestational maternal exposure to saline. This is a vehicle control condition typically studied to determine any effect of maternal (F0) saline (vehicle) use/exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is testosterone propionate, a testosterone ester and a relatively short-acting prodrug of testosterone in the human body. Testosterone propionate is a synthetic androstane steroid derivative of testosterone in the form of 17beta propionate ester of testosterone. slaulederkind 2024-05-28T16:28:21Z PMID:38273331 TP propionyltestosterone testosterone 17beta-propanoate testosterone propanoate experimental_condition_ontology XCO:0001387 testosterone propionate This is any condition in which the main influencing factor is testosterone propionate, a testosterone ester and a relatively short-acting prodrug of testosterone in the human body. Testosterone propionate is a synthetic androstane steroid derivative of testosterone in the form of 17beta propionate ester of testosterone. CID:5995 https://en.wikipedia.org/wiki/Testosterone_propionate This is any condition in which the major influencing factor is an IFA-CII emulsion, a combination of the oil-based incomplete Freund's adjuvant and acetic acid-soluble type II collagen (usually bovine). IFA induces a predominantly Th2-biased inflammatory response through the formation of a depot at the injection site and the stimulation of antibody producing plasma cells. slaulederkind 2024-05-28T17:12:55Z incomplete Freud's adjuvant -type II collagen emulsion experimental_condition_ontology XCO:0001388 IFA-CII emulsion This is any condition in which the major influencing factor is an IFA-CII emulsion, a combination of the oil-based incomplete Freund's adjuvant and acetic acid-soluble type II collagen (usually bovine). IFA induces a predominantly Th2-biased inflammatory response through the formation of a depot at the injection site and the stimulation of antibody producing plasma cells. https://www.invivogen.com/ifa https://www.merriam-webster.com/ This is any condition in which the main influencing factor is methylcellulose 400, an aqueous solution of methylcellulose with a dynamic viscosity of 400 centipoise (cP). Methylcellulose is a methylester of cellulose used as an emulsifying and suspending agent in cosmetics, pharmaceuticals and the chemical industry. It is used therapeutically as a bulk laxative. slaulederkind 2024-05-31T18:55:30Z methyl cellulose 400 methylcellulose 400 solution experimental_condition_ontology XCO:0001389 methylcellulose 400 This is any condition in which the main influencing factor is methylcellulose 400, an aqueous solution of methylcellulose with a dynamic viscosity of 400 centipoise (cP). Methylcellulose is a methylester of cellulose used as an emulsifying and suspending agent in cosmetics, pharmaceuticals and the chemical industry. It is used therapeutically as a bulk laxative. https://en.wikipedia.org/wiki/Poise_(unit) https://www.rheosense.com/basics/viscosity-units This is any condition in which the main influencing factor is implantation of a CGG hydrogel, a biomimetic hydrogel composed of gelatin and chitosan networks covalently cross-linked by genipin. Additional components added to these gel scaffolds are intended to increase mechanical performance and the migration, proliferation, and osteodifferentiation of endogenous mesenchymal stem cells (MSCs). Hydrogel implants are one of many methods used in bone tissue engineering. slaulederkind 2024-06-03T13:49:46Z PMID:32752105 CGG hydrogel scaffold implantation genipin cross-linked biomimetic hydrogel implantation experimental_condition_ontology XCO:0001390 CGG hydrogel implantation This is any condition in which the main influencing factor is implantation of a CGG hydrogel, a biomimetic hydrogel composed of gelatin and chitosan networks covalently cross-linked by genipin. Additional components added to these gel scaffolds are intended to increase mechanical performance and the migration, proliferation, and osteodifferentiation of endogenous mesenchymal stem cells (MSCs). Hydrogel implants are one of many methods used in bone tissue engineering. PMID:38284176 This is any condition in which the main influencing factor is implantation of a CGG-Cit hydrogel, a citrate (Cit)-coordinated CGG hydrogel composed of gelatin and chitosan networks covalently cross-linked by genipin and coordinated with sodium citrate (Na3Cit). Sodium citrate used in the formation of these gel scaffolds increase mechanical performance and the migration, proliferation, and osteodifferentiation of endogenous mesenchymal stem cells (MSCs). slaulederkind 2024-06-03T14:14:56Z PMID:32752105 CGG-Cit hydrogel scaffold implantation CGG-citrate hydrogel implantation Na3Cit-coordinated CGG hydrogel implantation citrate-based hydrogel implantation experimental_condition_ontology XCO:0001391 CGG-Cit hydrogel implantation This is any condition in which the main influencing factor is implantation of a CGG-Cit hydrogel, a citrate (Cit)-coordinated CGG hydrogel composed of gelatin and chitosan networks covalently cross-linked by genipin and coordinated with sodium citrate (Na3Cit). Sodium citrate used in the formation of these gel scaffolds increase mechanical performance and the migration, proliferation, and osteodifferentiation of endogenous mesenchymal stem cells (MSCs). PMID:38284176 This is any condition in which the main influencing factor is human, placenta-derived mesenchymal stem cells, which are isolated from various parts of the placenta from healthy maternal donors. They are mesenchymal stem cells that can be expanded in culture and are intermediate in characteristics between bone marrow-derived mesenchymal stem cells (BM-MSCs) and embryonic stem cells (ESCs). slaulederkind 2024-06-06T12:41:23Z PMID:35566725 PMSCs human PMSCs human placentalmesenchymal stem/stromal cells experimental_condition_ontology XCO:0001392 human placenta-derived mesenchymal stem cells This is any condition in which the main influencing factor is human, placenta-derived mesenchymal stem cells, which are isolated from various parts of the placenta from healthy maternal donors. They are mesenchymal stem cells that can be expanded in culture and are intermediate in characteristics between bone marrow-derived mesenchymal stem cells (BM-MSCs) and embryonic stem cells (ESCs). DOI:10.1002/adtp.202200054 This is a condition in which the main influencing factor is a human stem cell, an unspecialized cell capable of perpetuating itself through cell division and having the potential to give rise to a variety of differentiated cells with specialized functions. slaulederkind 2024-06-06T12:54:44Z PMID:37722965 experimental_condition_ontology Not4Curation XCO:0001393 human stem cells This is a condition in which the main influencing factor is a human stem cell, an unspecialized cell capable of perpetuating itself through cell division and having the potential to give rise to a variety of differentiated cells with specialized functions. CL:0000034 ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is osteotomy, a surgical cutting of bone. Osteotomy may be used clinically to correct an orthopedic defect or experimentally to study fracture healing. slaulederkind 2024-06-07T15:15:46Z surgical bone-cutting experimental_condition_ontology XCO:0001394 osteotomy This is any condition in which the main influencing factor is osteotomy, a surgical cutting of bone. Osteotomy may be used clinically to correct an orthopedic defect or experimentally to study fracture healing. PMID:35882120 https://my.clevelandclinic.org/health/articles/22688-osteotomy This is any condition in which the main influencing factor is a diaphyseal resection, which is the surgical removal of a length of bone from the diaphysis, the section of a long bone between the two epiphyses. slaulederkind 2024-06-07T15:36:01Z diaphysis resection resection of diaphysis experimental_condition_ontology XCO:0001395 diaphyseal resection This is any condition in which the main influencing factor is a diaphyseal resection, which is the surgical removal of a length of bone from the diaphysis, the section of a long bone between the two epiphyses. PMID:35882120 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is circNrxn3 (a circular RNA originating from the neurexin 3 gene) siRNA transfected by jetPEI transfection reagent. JetPEI transfection reagent is a linear polyethylenimine derivative, designed for high throughput screening (HTS) in adherent and suspension cell cultures. slaulederkind 2024-06-10T15:20:19Z transfection of circNrxn3 short interfering RNA using jetPEI transfection reagent transfection of circNrxn3 siRNA using jetPEI transfection reagent transfection of circNrxn3 silencing RNA using jetPEI transfection reagent transfection of circNrxn3 small interfering RNA using jetPEI transfection reagent experimental_condition_ontology XCO:0001396 transfer of circNrxn3 siRNA using jetPEI transfection reagent This is any condition in which the main influencing factor is circNrxn3 (a circular RNA originating from the neurexin 3 gene) siRNA transfected by jetPEI transfection reagent. JetPEI transfection reagent is a linear polyethylenimine derivative, designed for high throughput screening (HTS) in adherent and suspension cell cultures. PMID:38036039 https://www.polyplus-sartorius.com/products/jetpei This is any condition in which the main influencing factor is negative control siRNA delivered with jetPEI transfection reagent. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences. JetPEI transfection reagent is a linear polyethylenimine derivative, designed for high throughput screening (HTS) in adherent and suspension cell cultures. slaulederkind 2024-06-10T15:30:39Z transfection of negative control short interfering RNA using jetPEI transfection reagent transfection of negative control siRNA using jetPEI transfection reagent transfection of negative control silencing RNA using jetPEI transfection reagent transfection of negative control small interfering RNA using jetPEI transfection reagent experimental_condition_ontology XCO:0001397 transfer of negative control siRNA using jetPEI transfection reagent This is any condition in which the main influencing factor is negative control siRNA delivered with jetPEI transfection reagent. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences. JetPEI transfection reagent is a linear polyethylenimine derivative, designed for high throughput screening (HTS) in adherent and suspension cell cultures. PMID:38036039 https://www.polyplus-sartorius.com/products/jetpei This is any condition in which the main influencing factor is phenylethanoid glycosides (PhGs), a class of natural glycosides containing hydroxy-methoxy-substituted phenylethyl and hydroxy-methoxy-substituted cinnamoyl groups, usually with central glucose as the parent core, and also an ester bond and oxygen glycoside bond. PhGs are obtained from a wide range of sources and show strong biological and pharmacological activities, such as antioxidant, antibacterial and neuroprotective effects. slaulederkind 2024-06-10T16:07:10Z PMID:37439895 PhGs PGC phenylethanoid glycosides of desert-living Cistanche experimental_condition_ontology XCO:0001398 phenylethanoid glycosides This is any condition in which the main influencing factor is phenylethanoid glycosides (PhGs), a class of natural glycosides containing hydroxy-methoxy-substituted phenylethyl and hydroxy-methoxy-substituted cinnamoyl groups, usually with central glucose as the parent core, and also an ester bond and oxygen glycoside bond. PhGs are obtained from a wide range of sources and show strong biological and pharmacological activities, such as antioxidant, antibacterial and neuroprotective effects. PMID:35267401 This is any condition in which the main influencing factor is sevoflurane, an ether compound having fluoromethyl and 1,1,1,3,3,3-hexafluoroisopropyl as the two alkyl groups. Sevoflurane is a non-explosive inhalation anesthetic used in the induction and maintenance of general anesthesia. It does not cause respiratory irritation and may also prevent platelet aggregation. slaulederkind 2024-06-10T17:18:06Z CID:5206 1,1,1,3,3,3-Hexafluoro-2-(fluoromethoxy)propane fluoromethyl hexafluoroisopropyl ether experimental_condition_ontology XCO:0001399 sevoflurane This is any condition in which the main influencing factor is sevoflurane, an ether compound having fluoromethyl and 1,1,1,3,3,3-hexafluoroisopropyl as the two alkyl groups. Sevoflurane is a non-explosive inhalation anesthetic used in the induction and maintenance of general anesthesia. It does not cause respiratory irritation and may also prevent platelet aggregation. MESH:D000077149 XCO:0000088 This is any condition in which the main influencing factor is desflurane, an organofluorine compound that is an inhalation anaesthetic functionally related to methoxyethane. slaulederkind 2024-06-10T17:37:14Z CHEBI:4445 2-(difluoromethoxy)-1,1,1,2-tetrafluoroethane difluoromethyl 1,2,2,2-tetrafluoroethyl ether experimental_condition_ontology XCO:0001400 desflurane This is any condition in which the main influencing factor is desflurane, an organofluorine compound that is an inhalation anaesthetic functionally related to methoxyethane. CID:42113 This is any condition in which the main influencing factor is Xiaogu San, a multi-herbal composition (traditional chinese medicine formula) which contains components commonly prescribed in the treatment of pain and inflammation.. slaulederkind 2024-06-11T15:21:30Z XGS experimental_condition_ontology XCO:0001401 Xiaogu San This is any condition in which the main influencing factor is Xiaogu San, a multi-herbal composition (traditional chinese medicine formula) which contains components commonly prescribed in the treatment of pain and inflammation.. PMID:34629040 This is a condition in which the level of oxygen (21%) and nitrogen (79%) in the air surrounding the organism or breathed by the organism is controlled as part of the experiment. slaulederkind 2024-06-11T16:27:54Z PMID:33230951 normoxia experimental_condition_ontology XCO:0001402 21% O2, 79% N2 This is a condition in which the level of oxygen (21%) and nitrogen (79%) in the air surrounding the organism or breathed by the organism is controlled as part of the experiment. PMID:33230951 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is controlled air nitrogen content surrounding an organism or breathed by the organism as part of the experiment. slaulederkind 2024-06-11T16:33:00Z PMID:33230951 experimental_condition_ontology XCO:0001403 controlled air nitrogen content This is any condition in which the main influencing factor is controlled air nitrogen content surrounding an organism or breathed by the organism as part of the experiment. PMID:33230951 https://www.merriam-webster.com/ This is a condition in which the level of oxygen (42%) and nitrogen (58%) in the air surrounding the organism or breathed by the organism is controlled as part of the experiment. slaulederkind 2024-06-11T16:39:06Z PMID:33230951 experimental_condition_ontology XCO:0001404 42% O2, 58% N2 This is a condition in which the level of oxygen (42%) and nitrogen (58%) in the air surrounding the organism or breathed by the organism is controlled as part of the experiment. PMID:33230951 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is controlled atmospheric pressure, which involves controlling volume of the air, temperature of the air, and humidity of the air breathed. Controlled atmospheric pressure may be achieved by the use of a hypobaric or hyperbaric chamber. slaulederkind 2024-06-11T17:07:49Z PMID:33230951 experimental_condition_ontology XCO:0001405 controlled atmospheric pressure This is any condition in which the main influencing factor is controlled atmospheric pressure, which involves controlling volume of the air, temperature of the air, and humidity of the air breathed. Controlled atmospheric pressure may be achieved by the use of a hypobaric or hyperbaric chamber. https://www.dellamarca.it/en/what-and-how-the-pressure-chamber-works/# https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a hypobaric chamber, which lowers atmospheric pressure to simulate high altitude. slaulederkind 2024-06-11T17:23:50Z altitude chamber pressure chamber experimental_condition_ontology XCO:0001406 hypobaric chamber This is any condition in which the main influencing factor is a hypobaric chamber, which lowers atmospheric pressure to simulate high altitude. https://fdm-makers.com/en/what-are-the-things-and-how-does-the-pressure-chamber-work-/ https://www.merriam-webster.com/ This is any condition in which the main influencing factor is dextran sulfate sodium, a synthetic sulfated polysaccharide with anticoagulant activity used in immunological research to induce colitis. Dextran polymer molecules with a molecular weight of 36-50 kDa are frequently used to produce colitis in rodents. slaulederkind 2024-06-13T17:25:50Z CHEBI:191875 DSS dextran sodium sulfate experimental_condition_ontology XCO:0001407 dextran sulfate sodium This is any condition in which the main influencing factor is dextran sulfate sodium, a synthetic sulfated polysaccharide with anticoagulant activity used in immunological research to induce colitis. Dextran polymer molecules with a molecular weight of 36-50 kDa are frequently used to produce colitis in rodents. https://en.wikipedia.org/wiki/Dextran_sulphate_sodium This is any condition in which the main influencing factor is a drink made up of water and a specified amount of dextran sulfate sodium, a synthetic, sulfated polysaccharide with anticoagulant activity used in immunological research to induce colitis. slaulederkind 2024-06-13T17:33:05Z controlled DSS content drinking water controlled dextran sodium sulfate content drinking water experimental_condition_ontology XCO:0001408 controlled dextran sulfate sodium content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of dextran sulfate sodium, a synthetic, sulfated polysaccharide with anticoagulant activity used in immunological research to induce colitis. https://en.wikipedia.org/wiki/Dextran_sulphate_sodium https://www.merriam-webster.com/ This is any condition in which the main influencing factor is implantation of an engineered tissue scaffold, an artificial construct which mimics the extracellular matrix of the host tissue. The scaffold may be made of natural or synthetic polymers, metal, or ceramic. slaulederkind 2024-06-14T15:41:14Z PMID:38654018 experimental_condition_ontology Not4Curation XCO:0001409 tissue engineering scaffold implantation This is any condition in which the main influencing factor is implantation of an engineered tissue scaffold, an artificial construct which mimics the extracellular matrix of the host tissue. The scaffold may be made of natural or synthetic polymers, metal, or ceramic. https://www.sciencedirect.com/science/article/pii/S2590238522002983 https://www.sciencedirect.com/topics/materials-science/scaffold-for-tissue-engineering This is any condition in which the main influencing factor is implantation of a gelatin-methacryloyl (GelMA) scaffold, a tissue scaffold made of methacrylated gelatin (collagen). GelMA has been widely utilized for diverse tissue engineering applications. slaulederkind 2024-06-14T16:08:19Z GelMA scaffold implant gelatin-methacryloyl scaffold implant experimental_condition_ontology XCO:0001410 GelMA scaffold implantation This is any condition in which the main influencing factor is implantation of a gelatin-methacryloyl (GelMA) scaffold, a tissue scaffold made of methacrylated gelatin (collagen). GelMA has been widely utilized for diverse tissue engineering applications. PMID:38654018 https://www.sciencedirect.com/science/article/pii/S2590238522002983 This is any condition in which the main influencing factor is implantation of a porous chitosan (CTS) scaffold, a tissue scaffold made of macroporous chitosan hydrogel. Chitosan is a linear polysaccharide composed of randomly distributed β-(1→4)-linked D-glucosamine (deacetylated unit) and N-acetyl-D-glucosamine. Chitosan is attractive as a bone scaffold material because it supports the attachment and proliferation of osteoblasts as well as formation of mineralized bone matrix. slaulederkind 2024-06-14T16:51:04Z PMID:38654018 CTS scaffold implant chitosan scaffold implant experimental_condition_ontology XCO:0001411 CTS scaffold implantation This is any condition in which the main influencing factor is implantation of a porous chitosan (CTS) scaffold, a tissue scaffold made of macroporous chitosan hydrogel. Chitosan is a linear polysaccharide composed of randomly distributed β-(1→4)-linked D-glucosamine (deacetylated unit) and N-acetyl-D-glucosamine. Chitosan is attractive as a bone scaffold material because it supports the attachment and proliferation of osteoblasts as well as formation of mineralized bone matrix. PMID:24999429 https://en.wikipedia.org/wiki/Chitosan This is any condition in which the main influencing factor is implantation of a polylactic acid (PLA) scaffold, a tissue scaffold made of Poly(L-Lactic acid) in the form of a nanofiber membrane made by electrospinning. Electrospinning leads to membranes with relatively uniform pore size distribution with high interconnectivity of pores and significantly higher porosity, typically around 80%. slaulederkind 2024-06-14T17:25:28Z L-Lactide polymer scaffold implant PLA scaffold implant poly(L-Lactic acid) scaffold implant polylactic acid scaffold implant experimental_condition_ontology XCO:0001412 PLA scaffold implantation This is any condition in which the main influencing factor is implantation of a polylactic acid (PLA) scaffold, a tissue scaffold made of Poly(L-Lactic acid) in the form of a nanofiber membrane made by electrospinning. Electrospinning leads to membranes with relatively uniform pore size distribution with high interconnectivity of pores and significantly higher porosity, typically around 80%. PMID:35582285 https://www.sciencedirect.com/science/article/pii/S0011916414005190 This is any condition in which the main influencing factor is allisartan, an orally potent, selective, non-peptide inhibitor of Angiotensin II Type 1 receptors. Allisartan is an antihypertensive agent that protects various organs from damage of high blood pressure. slaulederkind 2024-06-17T15:57:36Z CAS:947331-05-7 PMID:38590561 allisartan isoproxil experimental_condition_ontology XCO:0001413 allisartan This is any condition in which the main influencing factor is allisartan, an orally potent, selective, non-peptide inhibitor of Angiotensin II Type 1 receptors. Allisartan is an antihypertensive agent that protects various organs from damage of high blood pressure. https://www.medchemexpress.com/allisartan-isoproxil.html This is a condition in which the main influencing factor is Ramulus Mori alkaloids, a group of polyhydroxy alkaloids extracted and isolated from mulberry twig (Morus alba L.). Mulberry twig extract is used in traditional Chinese medicine (TCM) and is used against hyperglycemia and obesity. slaulederkind 2024-06-17T16:51:06Z SZ-A Sangzhi alkaloids experimental_condition_ontology XCO:0001414 Ramulus Mori alkaloids This is a condition in which the main influencing factor is Ramulus Mori alkaloids, a group of polyhydroxy alkaloids extracted and isolated from mulberry twig (Morus alba L.). Mulberry twig extract is used in traditional Chinese medicine (TCM) and is used against hyperglycemia and obesity. PMID:37063280 This is any condition in which the main influencing factor is double distilled water, the secondary distillation of the water vapor of a prior distillation procedure. Double-distilled water (ddH2O) is traditionally considered the ‘most pure’ type of laboratory-grade water. slaulederkind 2024-06-18T16:39:23Z PMID:30479497 ddH2O doubly distilled water experimental_condition_ontology XCO:0001415 double-distilled water This is any condition in which the main influencing factor is double distilled water, the secondary distillation of the water vapor of a prior distillation procedure. Double-distilled water (ddH2O) is traditionally considered the ‘most pure’ type of laboratory-grade water. https://www.aatbio.com/resources/faq-frequently-asked-questions/What-are-the-differences-between-diH2O-dH2O-and-ddH2O This is any condition in which the main influencing factor is distilled, deionized water, a type of purified water that is sequentially distilled and deionized. slaulederkind 2024-06-18T17:07:08Z PMID:31919777 DDI H2O Milli-Q system water distilled deionized H2O experimental_condition_ontology XCO:0001416 distilled deionized water This is any condition in which the main influencing factor is distilled, deionized water, a type of purified water that is sequentially distilled and deionized. PMID:20549630 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to folic acid that has transgenerational effects. This is a condition typically studied to determine the effect of maternal (F0) folic acid use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation. slaulederkind 2024-06-21T16:15:05Z CHEBI:7852 PMID:31919777 experimental_condition_ontology XCO:0001417 transgenerational maternal exposure to folic acid This is any condition in which the main influencing factor is any maternal exposure to folic acid that has transgenerational effects. This is a condition typically studied to determine the effect of maternal (F0) folic acid use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any paternal exposure to folic acid that has transgenerational effects. This is a condition typically studied to determine the effect of paternal (F0) folic acid use/exposure on the F2/F3 offspring by direct effects on the F1 generation via germ cell exposure. The paternal exposure may be any time after sexual maturity up to the time of copulation. slaulederkind 2024-06-21T16:54:45Z CHEBI:7852 PMID:31919777 experimental_condition_ontology XCO:0001418 transgenerational paternal exposure to folic acid This is any condition in which the main influencing factor is any paternal exposure to folic acid that has transgenerational effects. This is a condition typically studied to determine the effect of paternal (F0) folic acid use/exposure on the F2/F3 offspring by direct effects on the F1 generation via germ cell exposure. The paternal exposure may be any time after sexual maturity up to the time of copulation. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to distilled, deionized water used as a vehicle control for transgenerational effects of some chemical. This is a condition typically studied to control for the effect of maternal (F0) chemical use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation. slaulederkind 2024-06-21T17:15:02Z CHEBI:7852 PMID:31919777 transgenerational maternal exposure to distilled, deionized water experimental_condition_ontology XCO:0001419 transgenerational maternal exposure to distilled deionized water This is any condition in which the main influencing factor is any maternal exposure to distilled, deionized water used as a vehicle control for transgenerational effects of some chemical. This is a condition typically studied to control for the effect of maternal (F0) chemical use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any paternal exposure to distilled, deionized water used as a vehicle control for transgenerational effects of some chemical. This is a condition typically studied to determine the effect of paternal (F0) distilled, deionized water use/exposure on the F2/F3 offspring by direct effects on the F1 generation via germ cell exposure. The paternal exposure may be any time after sexual maturity up to the time of copulation. slaulederkind 2024-06-21T17:21:50Z CHEBI:7852 PMID:31919777 transgenerational paternal exposure to distilled, deionized water experimental_condition_ontology XCO:0001420 transgenerational paternal exposure to distilled deionized water This is any condition in which the main influencing factor is any paternal exposure to distilled, deionized water used as a vehicle control for transgenerational effects of some chemical. This is a condition typically studied to determine the effect of paternal (F0) distilled, deionized water use/exposure on the F2/F3 offspring by direct effects on the F1 generation via germ cell exposure. The paternal exposure may be any time after sexual maturity up to the time of copulation. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a liver transplant, a surgical procedure in which a whole or partial liver from a donor organism is implanted into a recipient organism for the clinical purpose of replacing a diseased liver or for the experimental purpose of studying organ transplantation. slaulederkind 2024-06-24T16:12:38Z liver transplantion liver graft experimental_condition_ontology XCO:0001421 liver transplant This is any condition in which the main influencing factor is a liver transplant, a surgical procedure in which a whole or partial liver from a donor organism is implanted into a recipient organism for the clinical purpose of replacing a diseased liver or for the experimental purpose of studying organ transplantation. PMID:36426354 https://www.mayoclinic.org/tests-procedures/liver-transplant/about/pac-20384842 This is any condition in which the main influencing factor is an allogeneic liver transplant, a surgical procedure in which a whole or partial liver from a donor organism is implanted into a genetically non-identical recipient organism of the same species for the clinical purpose of replacing a diseased liver or for the experimental purpose of studying organ transplantation. slaulederkind 2024-06-24T16:35:16Z allogeneic liver transplantion liver allograft liver homograft allogeneic liver graft experimental_condition_ontology XCO:0001422 allogeneic liver transplant This is any condition in which the main influencing factor is an allogeneic liver transplant, a surgical procedure in which a whole or partial liver from a donor organism is implanted into a genetically non-identical recipient organism of the same species for the clinical purpose of replacing a diseased liver or for the experimental purpose of studying organ transplantation. PMID:36426354 https://en.wikipedia.org/wiki/Allotransplantation This is any condition in which the main influencing factor is a syngeneic liver transplant, a surgical procedure in which a whole or partial liver from a donor organism is implanted into a genetically identical/nearly identical recipient organism of the same species for the clinical purpose of replacing a diseased liver or for the experimental purpose of studying organ transplantation. slaulederkind 2024-06-24T16:43:24Z homogeneic liver transplant syngeneic liver graft syngeneic liver transplantion experimental_condition_ontology XCO:0001423 syngeneic liver transplant This is any condition in which the main influencing factor is a syngeneic liver transplant, a surgical procedure in which a whole or partial liver from a donor organism is implanted into a genetically identical/nearly identical recipient organism of the same species for the clinical purpose of replacing a diseased liver or for the experimental purpose of studying organ transplantation. PMID:36426354 https://www.merriam-webster.com This is any condition in which the main influencing factor is corneal de-epithelialization, an experimental removal of the corneal epithelium of the eye for the purpose of studying the healing process related to clinical procedures like photorefractive keratectomy (PRK) and laser in situ keratomileusis (LASIK). The experimental corneal de-epithelialization may be achieved by mechanical means, or a combination of chemical and mechanical means. slaulederkind 2024-06-27T14:03:53Z PMID:23595375 cornea de-epithelialization experimental_condition_ontology XCO:0001424 corneal de-epithelialization This is any condition in which the main influencing factor is corneal de-epithelialization, an experimental removal of the corneal epithelium of the eye for the purpose of studying the healing process related to clinical procedures like photorefractive keratectomy (PRK) and laser in situ keratomileusis (LASIK). The experimental corneal de-epithelialization may be achieved by mechanical means, or a combination of chemical and mechanical means. PMID:26086898 https://corzaeye.com/catalogsearch/result/?q=+Sclerotome+Knife This is any condition in which the main influencing factor is limbal resection, an experimental procedure which surgically removes the border between cornea and sclera of the eye. Limbal resection causes limbal stem cell deficiency (LSCD), which leads to failure of corneal repair, followed by neovascularization, and other pathologic sequelae. slaulederkind 2024-06-27T14:45:22Z GEO:GSE245468 PMID:11900318 limbus resection experimental_condition_ontology XCO:0001425 limbal resection This is any condition in which the main influencing factor is limbal resection, an experimental procedure which surgically removes the border between cornea and sclera of the eye. Limbal resection causes limbal stem cell deficiency (LSCD), which leads to failure of corneal repair, followed by neovascularization, and other pathologic sequelae. https://en.wikipedia.org/wiki/Limbal_stem_cell https://eyewiki.aao.org/Limbal_Stem_Cell_Deficiency This is any condition in which the main influencing factor is albiflorin, a monoterpene glycoside with formula C23H28O11. Albiflorin is a plant metabolite found in various types of Peonies. slaulederkind 2024-06-27T15:17:12Z PMID:34601221 [(1R,3R,4R,6S,9S)-1-(beta-D-glucopyranosyloxy)-4-hydroxy-6-methyl-8-oxo-7-oxatricyclo[4.3.0.0(3,9)]nonan-9-yl]methyl benzoate experimental_condition_ontology XCO:0001426 albiflorin This is any condition in which the main influencing factor is albiflorin, a monoterpene glycoside with formula C23H28O11. Albiflorin is a plant metabolite found in various types of Peonies. CHEBI:132793 CID:24868421 This is a condition in which the main influencing factor is Schwann cells, glial cells that myelinate or ensheath axons in the peripheral nervous system. Some Schwann cells, repair (Bungner) Schwann cells, are only activated upon nerve injury. slaulederkind 2024-06-28T16:23:06Z PMID:35091563 experimental_condition_ontology XCO:0001427 Schwann cells This is a condition in which the main influencing factor is Schwann cells, glial cells that myelinate or ensheath axons in the peripheral nervous system. Some Schwann cells, repair (Bungner) Schwann cells, are only activated upon nerve injury. CL:0002573 PMID:25957303 This is a condition in which the main influencing factor is rat Schwann cell precursors, glioblasts that develop from migratory neural crest cells about embryonic day 12-14 (E12-E14) in the rat. The Schwann cell precursors are embedded among neurons (axons) with minimal extracellular space separating them from nerve cell membranes and have no basal lamina. slaulederkind 2024-06-28T17:04:46Z PMID:35091563 rat SCPs experimental_condition_ontology XCO:0001428 rat Schwann cell precursors This is a condition in which the main influencing factor is rat Schwann cell precursors, glioblasts that develop from migratory neural crest cells about embryonic day 12-14 (E12-E14) in the rat. The Schwann cell precursors are embedded among neurons (axons) with minimal extracellular space separating them from nerve cell membranes and have no basal lamina. CL:0002375 PMID:25957303 This is a condition in which the main influencing factor is rat repair Schwann cells, myelin cells that previously formed flattened sheaths around axons, then adopt an elongated bipolar morphology after nerve injury, allowing them to align to form a Schwann cell column named a Bungner band, which delineates the space in which the nerve regenerates. slaulederkind 2024-06-28T17:32:28Z PMID:35091563 rat Bungner band cells rat RSCs experimental_condition_ontology XCO:0001429 rat repair Schwann cells This is a condition in which the main influencing factor is rat repair Schwann cells, myelin cells that previously formed flattened sheaths around axons, then adopt an elongated bipolar morphology after nerve injury, allowing them to align to form a Schwann cell column named a Bungner band, which delineates the space in which the nerve regenerates. PMID:25957303 UBERON:0001031 This is any condition in which the main influencing factor is an experimentally controlled sciatic nerve crush and decellularization, which can be achieved by mechanical nerve crush followed by multiple freeze/thaw cycles using controlled application of liquid nitrogen and ambient thawing. This system is used as a model of sciatic neuropathy, Wallerian degeneration, and axonal regeneration. slaulederkind 2024-06-28T17:52:14Z PMID:35768768 ischiadic nerve crush with decellularization experimental_condition_ontology XCO:0001430 sciatic nerve crush with decellularization This is any condition in which the main influencing factor is an experimentally controlled sciatic nerve crush and decellularization, which can be achieved by mechanical nerve crush followed by multiple freeze/thaw cycles using controlled application of liquid nitrogen and ambient thawing. This system is used as a model of sciatic neuropathy, Wallerian degeneration, and axonal regeneration. PMID:35091563 https://en.wikipedia.org/wiki/Decellularization This is any condition in which the main influencing factor is implantation of a CN-Patch hydrogel, an injectable hydrogel designed for controlled release of CO (carbon monoxide) and NO (nitric oxide) into host soft tissue. Catechol-modified chitosan (Chi-C) and aldehyde dextran (Odex) are used as the basis of the hydrogel for viscosity and hemostatic effects. Gelatin nanoparticles, GSNO (S-Nitrosoglutathione), and CORM-3 (Ru(CO)3Cl(glycinate) ) are suspended/dissolved in the hydrogel to accomplish the release of CO and NO. slaulederkind 2024-07-01T15:26:53Z PMID:32118241 CN-Patch CN-Patch implant experimental_condition_ontology XCO:0001431 CN-Patch implantation This is any condition in which the main influencing factor is implantation of a CN-Patch hydrogel, an injectable hydrogel designed for controlled release of CO (carbon monoxide) and NO (nitric oxide) into host soft tissue. Catechol-modified chitosan (Chi-C) and aldehyde dextran (Odex) are used as the basis of the hydrogel for viscosity and hemostatic effects. Gelatin nanoparticles, GSNO (S-Nitrosoglutathione), and CORM-3 (Ru(CO)3Cl(glycinate) ) are suspended/dissolved in the hydrogel to accomplish the release of CO and NO. PMID:37105981 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is an autologous, single pedicled skin flap, skin flap in which the flap is still attached to the original blood supply by a single blood vessel. This type of skin flap is relevant in specific clinical situations and in experimental situations for the purpose of studying various factors affecting the success of skin grafts. slaulederkind 2024-07-01T16:51:16Z PMID:37105981 https://www.ncbi.nlm.nih.gov/books/NBK532874/ autologous pedicle flap autologous, single pedicled skin flap experimental_condition_ontology XCO:0001432 single-pedicled skin flap This is any condition in which the main influencing factor is an autologous, single pedicled skin flap, skin flap in which the flap is still attached to the original blood supply by a single blood vessel. This type of skin flap is relevant in specific clinical situations and in experimental situations for the purpose of studying various factors affecting the success of skin grafts. https://www.merriam-webster.com/ https://www.sciencedirect.com/topics/medicine-and-dentistry/pedicled-skin-flap This is any condition in which the main influencing factor is canagliflozin, a glucoside-derived sodium/glucose cotransporter (Slc5a2) inhibitor used clinically to treat type 2 diabetes mellitus. slaulederkind 2024-07-08T16:47:06Z CHEBI:73274 CID:24812758 (1S)-1,5-anhydro-1-(3-{[5-(4-fluorophenyl)-2-thienyl]methyl}-4-methylphenyl)-D-glucitol canagliflozin anhydrous experimental_condition_ontology XCO:0001433 canagliflozin This is any condition in which the main influencing factor is canagliflozin, a glucoside-derived sodium/glucose cotransporter (Slc5a2) inhibitor used clinically to treat type 2 diabetes mellitus. MESH:D000068896 This is any condition in which the main influencing factor is acting as a parasite in a group feeding/reward paradigm in a customized Skinner box, an experimental setup to designed to create parasite-worker social relationships between subjects. The parasite subjects eat most of the rewarded food, while the worker subject performs most of the required lever presses to earn the reward. slaulederkind 2024-07-18T16:15:18Z parasite behavior in an operant conditioning chamber within a worker/parasite group feeding/reward paradigm parasitic behavior in a Skinner box within a worker/parasite group feeding/reward paradigm parasitic behavior in an operant conditioning chamber within a worker/parasite group feeding/reward paradigm experimental_condition_ontology XCO:0001434 parasite behavior in a Skinner box within a worker/parasite group feeding/reward paradigm This is any condition in which the main influencing factor is acting as a parasite in a group feeding/reward paradigm in a customized Skinner box, an experimental setup to designed to create parasite-worker social relationships between subjects. The parasite subjects eat most of the rewarded food, while the worker subject performs most of the required lever presses to earn the reward. PMID:34815341 https://www.merriam-webster.com This is any condition in which the main influencing factor is acting as a servant (worker) in a group feeding/reward paradigm in a customized Skinner box, an experimental setup to designed to create parasite-worker social relationships between subjects. The worker subject performs most of the required lever presses to earn a reward (food), while the parasite subjects eat most of the rewarded food. slaulederkind 2024-07-18T16:35:53Z servant behavior in a Skinner box within a worker/parasite group feeding/reward paradigm servant behavior in an operant conditioning chamber within a worker/parasite group feeding/reward paradigm worker behavior in an operant conditioning chamber within a worker/parasite group feeding/reward paradigm experimental_condition_ontology XCO:0001435 worker behavior in a Skinner box within a worker/parasite group feeding/reward paradigm This is any condition in which the main influencing factor is acting as a servant (worker) in a group feeding/reward paradigm in a customized Skinner box, an experimental setup to designed to create parasite-worker social relationships between subjects. The worker subject performs most of the required lever presses to earn a reward (food), while the parasite subjects eat most of the rewarded food. PMID:34815341 https://www.merriam-webster.com This is any condition in which the main influencing factor is gastrointestinal bypass, a type of surgery that either bypasses the stomach or part of the small intestine as a weight loss strategy. Gastrointestinal bypass is also an experimental procedure to study the surgery in model organisms like rats. slaulederkind 2024-07-23T16:41:03Z bariatric surgery metabolic surgery experimental_condition_ontology Not4Curation XCO:0001436 gastrointestinal bypass This is any condition in which the main influencing factor is gastrointestinal bypass, a type of surgery that either bypasses the stomach or part of the small intestine as a weight loss strategy. Gastrointestinal bypass is also an experimental procedure to study the surgery in model organisms like rats. https://www.mayoclinic.org/tests-procedures/bariatric-surgery/about/pac-20394258 This is any condition in which the main influencing factor is a duodenal-jejunal bypass, a surgical procedure which involves transection of the duodenum proximally and transection of the jejunum distal to the ligament of Treitz. The distal end of the jejunum is anastomosed to the proximal end of the duodenum (duodenojejunal anastomosis), which creates the bypass of the duodenum and most of the jejunum. The biliopancreatic limb is anastomosed to the alimentary limb distal to the duodenojejunal anastomosis in a Roux-en-Y fashion to divert biliopancreatic juice to the ileum. slaulederkind 2024-07-30T17:25:20Z DJB experimental_condition_ontology XCO:0001437 duodenal-jejunal bypass This is any condition in which the main influencing factor is a duodenal-jejunal bypass, a surgical procedure which involves transection of the duodenum proximally and transection of the jejunum distal to the ligament of Treitz. The distal end of the jejunum is anastomosed to the proximal end of the duodenum (duodenojejunal anastomosis), which creates the bypass of the duodenum and most of the jejunum. The biliopancreatic limb is anastomosed to the alimentary limb distal to the duodenojejunal anastomosis in a Roux-en-Y fashion to divert biliopancreatic juice to the ileum. PMID:36726038 PMID:38983805 This is any condition in which the main influencing factor is duodenal-jejunal bypass sham surgery, a surgical procedure which follows the same surgical process as duodenal-jejunal bypass surgery, but all intestinal transections are reanastomosed without any tissue repositioning. slaulederkind 2024-08-05T12:42:55Z experimental_condition_ontology XCO:0001438 duodenal-jejunal bypass sham surgery This is any condition in which the main influencing factor is implantation of an engineered bone tissue scaffold, an artificial construct which mimics the extracellular matrix of the host tissue. Support of the attachment and proliferation of osteoblasts, formation of mineralized bone matrix, and osteodifferentiation of endogenous mesenchymal stem cells (MSCs) are some desired characteristics of these implants. Both synthetic and natural polymers may be a part of bone scaffolds. slaulederkind 2024-08-06T16:37:23Z PMID:36526019 experimental_condition_ontology XCO:0001439 bone tissue engineering scaffold implantation This is any condition in which the main influencing factor is implantation of an engineered bone tissue scaffold, an artificial construct which mimics the extracellular matrix of the host tissue. Support of the attachment and proliferation of osteoblasts, formation of mineralized bone matrix, and osteodifferentiation of endogenous mesenchymal stem cells (MSCs) are some desired characteristics of these implants. Both synthetic and natural polymers may be a part of bone scaffolds. PMID:24999429 https://www.sciencedirect.com/topics/materials-science/scaffold-for-tissue-engineering This is any condition in which the main influencing factor is implantation of a peptide hydrogel, a hydrogel containing a self-assembling metal ion-chelating peptide (HPGIAQFF) . This peptide hydrogel serves as a control for the peptide hydrogel that contains chelated metal ions. Hydrogel implants are one of many methods used in bone tissue engineering. slaulederkind 2024-08-13T14:38:15Z PH implant implantation of self-assembling metal ion-chelating peptide hydrogel without metal ions experimental_condition_ontology XCO:0001440 peptide hydrogel implantation This is any condition in which the main influencing factor is implantation of a peptide hydrogel, a hydrogel containing a self-assembling metal ion-chelating peptide (HPGIAQFF) . This peptide hydrogel serves as a control for the peptide hydrogel that contains chelated metal ions. Hydrogel implants are one of many methods used in bone tissue engineering. PMID:36526019 https://www.sciencedirect.com/topics/materials-science/scaffold-for-tissue-engineering This is any condition in which the main influencing factor is implantation of a metal ion-chelating peptide hydrogel, a hydrogel containing a self-assembling metal ion-chelating peptide (HPGIAQFF) with chelated metal ions (Fe2+, Cu2+, Zn2+, Mn2+, Mg2+, and Ca2) . The metal ions are derived from processed pyritum, a Chinese medicine derived from pyritum disulfide. Hydrogel implants are one of many methods used in bone tissue engineering. slaulederkind 2024-08-13T14:55:37Z PPH implant implantation of self-assembling metal ion-chelating peptide hydrogel with metal ions experimental_condition_ontology XCO:0001441 processed pyritum hydrogel implantation This is any condition in which the main influencing factor is implantation of a metal ion-chelating peptide hydrogel, a hydrogel containing a self-assembling metal ion-chelating peptide (HPGIAQFF) with chelated metal ions (Fe2+, Cu2+, Zn2+, Mn2+, Mg2+, and Ca2) . The metal ions are derived from processed pyritum, a Chinese medicine derived from pyritum disulfide. Hydrogel implants are one of many methods used in bone tissue engineering. PMID:36526019 https://www.sciencedirect.com/topics/materials-science/scaffold-for-tissue-engineering This is any condition in which the main influencing factor is an experimental drill-hole bone defect sham procedure, which follows the same surgical process through full tissue thickness incision, but no bone defect is made. slaulederkind 2024-08-13T15:09:14Z PMID:35849443 sham burr holing procedure sham trepanation sham trepanning sham trephination experimental_condition_ontology XCO:0001442 experimental drill-hole bone defect sham procedure This is any condition in which the main influencing factor is an experimental drill-hole bone defect sham procedure, which follows the same surgical process through full tissue thickness incision, but no bone defect is made. PMID:36526019 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is medial collateral ligament transection, a process involving a surgical technique for complete transection of the medial collateral ligament to investigate ligament healing in an experimental animal model. slaulederkind 2024-09-05T15:06:23Z MCL transection experimental_condition_ontology complete MCL tear XCO:0001443 medial collateral ligament transection This is any condition in which the main influencing factor is medial collateral ligament transection, a process involving a surgical technique for complete transection of the medial collateral ligament to investigate ligament healing in an experimental animal model. PMID:38597671 This is any condition in which the main influencing factor is an artificial pouch created by a surgical technique to cover a ligament wound with the adjacent muscle layer. The pouch may be used for delivery of drugs or other agents. slaulederkind 2024-09-05T15:54:18Z surgical pouch artificial muscle layer pouch experimental_condition_ontology XCO:0001444 muscle layer pouch This is any condition in which the main influencing factor is an artificial pouch created by a surgical technique to cover a ligament wound with the adjacent muscle layer. The pouch may be used for delivery of drugs or other agents. PMID:38597671 This is any condition in which the main influencing factor is exosomes from human, bone marrow-derived, mesenchymal stromal cells which have been primed with cytokine TNF-alpha. slaulederkind 2024-09-06T11:29:42Z TNFA-primed human BM-MSC exosomes tumor necrosis factor alpha-primed human BM-MSC exosomes tumor necrosis factor-primed human BM-MSC exosomes experimental_condition_ontology XCO:0001445 TNF-primed human BM-MSC exosomes This is any condition in which the main influencing factor is exosomes from human, bone marrow-derived, mesenchymal stromal cells which have been primed with cytokine TNF-alpha. PMID:38597671 This is any condition in which the main influencing factor is exosomes from human, bone marrow-derived, mesenchymal stromal cells which have been primed with the synthetic lipid A analog CRX-527. CRX-527 is a Toll-like receptor 4 (TLR4) agonist. slaulederkind 2024-09-06T11:44:43Z CRX-527-primed human BM-MSC exosomes CRX527-primed human bone marrow-derived mesenchymal stromal cell exosomes experimental_condition_ontology XCO:0001446 CRX527-primed human BM-MSC exosomes This is any condition in which the main influencing factor is exosomes from human, bone marrow-derived, mesenchymal stromal cells which have been primed with the synthetic lipid A analog CRX-527. CRX-527 is a Toll-like receptor 4 (TLR4) agonist. PMID:38597671 https://www.invivogen.com/crx527 This is any condition in which the main influencing factor is a T9 spinal cord contusion sham procedure, which follows the same surgical process as a T9 spinal cord contusion procedure, but no contusion is generated. The sham procedure includes laminectomy of the ninth thoracic vertebra and exposure of the spinal cord. slaulederkind 2024-09-06T13:30:46Z T9 spinal cord contusion sham surgery experimental_condition_ontology XCO:0001447 T9 spinal cord contusion sham procedure This is any condition in which the main influencing factor is a T9 spinal cord contusion sham procedure, which follows the same surgical process as a T9 spinal cord contusion procedure, but no contusion is generated. The sham procedure includes laminectomy of the ninth thoracic vertebra and exposure of the spinal cord. PMID:38647358 This is a condition in which the main influencing factor is fractional CO2 laser ablation of liver, an experimental procedure involving the creation of microinjuries in a restricted surface area of liver. This use of fractional ablation is an adaptation of a technique of dermal scar treatment. Access to liver surface requires laparotomy. slaulederkind 2024-09-09T17:42:47Z fractional CO2 laser ablation of hepatic surface fractional CO2 laser ablative treatment of liver fractional ablative CO2 laser treatment of liver experimental_condition_ontology XCO:0001448 fractional CO2 laser ablation of liver This is a condition in which the main influencing factor is fractional CO2 laser ablation of liver, an experimental procedure involving the creation of microinjuries in a restricted surface area of liver. This use of fractional ablation is an adaptation of a technique of dermal scar treatment. Access to liver surface requires laparotomy. PMID:38661043 https://lumenis.com/aesthetics/products/ultrapulse/ This is any condition in which the main influencing factor is a hepatotoxic chemical, a chemical that causes injury to or disease of the liver. slaulederkind 2024-09-10T11:20:09Z PMID:38661043 hepatotoxic agent hepatotoxicity-inducing chemical liver toxicity-inducing chemical experimental_condition_ontology XCO:0001449 hepatotoxic chemical This is any condition in which the main influencing factor is a hepatotoxic chemical, a chemical that causes injury to or disease of the liver. ISBN-13:9780781733908 https://www.merriam-webster.com This is any condition in which the main influencing factor is thioacetamide, a thiocarboxamide consiting of acetamide having the oxygen replaced by sulfur. Thioacetamide is used to replicate the initiation and progression of human liver disease in laboratory rats. slaulederkind 2024-09-10T11:26:58Z MESH:D013853 CID:2723949 acetothioamide ethanethioamide thiacetamide experimental_condition_ontology XCO:0001450 thioacetamide This is any condition in which the main influencing factor is thioacetamide, a thiocarboxamide consiting of acetamide having the oxygen replaced by sulfur. Thioacetamide is used to replicate the initiation and progression of human liver disease in laboratory rats. CHEBI:32497 https://en.wikipedia.org/wiki/Thioacetamide This is any condition in which the main influencing factor is a diagnostic imaging agent, a substance administered to enhance contrast in images of the inside of the body obtained using X-rays, gamma-rays, sound waves, radio waves (MRI), or radioactive particles. slaulederkind 2024-09-10T16:53:48Z PMID:38704728 experimental_condition_ontology XCO:0001451 diagnostic imaging agent This is any condition in which the main influencing factor is a diagnostic imaging agent, a substance administered to enhance contrast in images of the inside of the body obtained using X-rays, gamma-rays, sound waves, radio waves (MRI), or radioactive particles. CHEBI:37334 This is any condition in which the main influencing factor is gadodiamide, a gadolinium-based MRI contrast agent (GBCA), used in magnetic resonance imaging (MRI) procedures to assist in the visualization of blood vessels. slaulederkind 2024-09-10T17:17:56Z CAS:131410-48-5 CID:24847884 Omniscan experimental_condition_ontology XCO:0001452 gadodiamide This is any condition in which the main influencing factor is gadodiamide, a gadolinium-based MRI contrast agent (GBCA), used in magnetic resonance imaging (MRI) procedures to assist in the visualization of blood vessels. https://en.wikipedia.org/wiki/Gadodiamide This is any condition in which the main influencing factor is the vascular endothelial growth factor C gene (VEGFC) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulederkind 2024-09-10T17:34:42Z gene transfer of the VEGFC gene using an adenoviral vector gene transfer of the vascular endothelial growth factor C gene using an adenoviral vector transduction of VEGFC using an adenoviral vector transduction of VEGFC using an adenovirus vector gene transfer of AAV2/9‐CMV‐rVEGF‐C experimental_condition_ontology XCO:0001453 gene transfer of the VEGFC gene using an adenovirus vector This is any condition in which the main influencing factor is the vascular endothelial growth factor C gene (VEGFC) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:38704728 This is any condition in which the main influencing factor is the mNeonGreen gene (mNG) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. This gene codes for a green/yellow fluorescent protein and is used as a control for studying the effects of some other gene. slaulederkind 2024-09-10T17:48:16Z PMID:38704728 gene transfer of the mNG gene using an adenoviral vector gene transfer of the mNeonGreen gene using an adenoviral vector transduction of mNG using an adenoviral vector transduction of mNG using an adenovirus vector gene transfer of AAV2/9‐CMV‐mNeonGreen experimental_condition_ontology XCO:0001454 gene transfer of the mNeonGreen gene using an adenovirus vector This is any condition in which the main influencing factor is the mNeonGreen gene (mNG) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. This gene codes for a green/yellow fluorescent protein and is used as a control for studying the effects of some other gene. https://www.fpbase.org/protein/mneongreen/ This is any condition in which the main influencing factor is heroin, a morphinane alkaloid that is morphine bearing two acetyl substituents on the O-3 and O-6 positions. Heroin has a role as an opioid analgesic, a mu-opioid receptor agonist and a prodrug. slaulederkind 2024-09-12T14:02:42Z MESH:D003932 17-methyl-7,8-didehydro-4,5alpha-epoxymorphinan-3,6alpha-diyl diacetate Diacetylmorphine Diamorphine experimental_condition_ontology XCO:0001455 heroin This is any condition in which the main influencing factor is heroin, a morphinane alkaloid that is morphine bearing two acetyl substituents on the O-3 and O-6 positions. Heroin has a role as an opioid analgesic, a mu-opioid receptor agonist and a prodrug. CHEBI:27808 CID:5462328 This is any condition in which the main influencing factor is psilocybin, a naturally occurring psychedelic prodrug compound produced by more than 200 species of fungi. Psilocybin is quickly converted by the body to psilocin, a hallucinogen. slaulederkind 2024-09-12T14:26:48Z CHEBI:8614 CID:10624 3-[2-(dimethylamino)ethyl]-1H-indol-4-yl dihydrogen phosphate 4-PO-DMT 4-phosphoryloxy-N,N-dimethyltryptamine psilocybine experimental_condition_ontology XCO:0001456 psilocybin This is any condition in which the main influencing factor is psilocybin, a naturally occurring psychedelic prodrug compound produced by more than 200 species of fungi. Psilocybin is quickly converted by the body to psilocin, a hallucinogen. https://en.wikipedia.org/wiki/Psilocybin This is any condition in which the main influencing factor is ketanserin, a selective serotonin receptor antagonist with weak adrenergic receptor blocking properties. Ketanserin is effective in lowering blood pressure in essential hypertension and it also inhibits platelet aggregation. slaulederkind 2024-09-12T14:49:25Z CHEBI:6123 CID:3822 3-{2-[4-(4-fluorobenzoyl)piperidin-1-yl]ethyl}quinazoline-2,4(1H,3H)-dione experimental_condition_ontology XCO:0001457 ketanserin This is any condition in which the main influencing factor is ketanserin, a selective serotonin receptor antagonist with weak adrenergic receptor blocking properties. Ketanserin is effective in lowering blood pressure in essential hypertension and it also inhibits platelet aggregation. MESH:D007650 This is any condition in which the main influencing factor is experimental intracerebral hemorrhage induced by collagenase injection into the cerebrum, a method used to model intracerebral hemorrhage in laboratory animals. Severity of hemorrhage can be controlled by the amount of collagenase injected. For example 0.23 U of bacterial collagenase VII-S injected into rat striatum causes a moderate intracerebral hemorrhage, and 0.6 U of bacterial collagenase VII-S injected into rat striatum causes severe intracerebral hemorrhage. slaulederkind 2024-09-16T14:35:52Z experimental ICH induced by collagenase injection experimental_condition_ontology XCO:0001458 intracerebral hemorrhage induced by collagenase injection This is any condition in which the main influencing factor is experimental intracerebral hemorrhage induced by collagenase injection into the cerebrum, a method used to model intracerebral hemorrhage in laboratory animals. Severity of hemorrhage can be controlled by the amount of collagenase injected. For example 0.23 U of bacterial collagenase VII-S injected into rat striatum causes a moderate intracerebral hemorrhage, and 0.6 U of bacterial collagenase VII-S injected into rat striatum causes severe intracerebral hemorrhage. PMID:38927081 https://www.merriam-webster.com This is any condition in which the main influencing factor is ethoxysanguinarine, an activator of AMP-Activated Protein Kinase (AMPK). It possesses antibacterial and antiviral activities and offers therapeutic benefits for the treatment of respiratory syndrome virus-induced cytopathic effects. slaulederkind 2024-09-26T16:00:40Z CAS:28342-31-6 CID:5317235 MESH:C000729450 14-ethoxy-13-methyl-13,14-dihydro-(1,3)dioxolo(4',5':4,5)benzo(1,2-c)(1,3)dioxolo(4,5-i)phenanthridine ETH experimental_condition_ontology XCO:0001459 ethoxysanguinarine This is any condition in which the main influencing factor is ethoxysanguinarine, an activator of AMP-Activated Protein Kinase (AMPK). It possesses antibacterial and antiviral activities and offers therapeutic benefits for the treatment of respiratory syndrome virus-induced cytopathic effects. PMID:31969821 This is any condition in which the main influencing factor is glycerol, a trihydroxy sugar alcohol that is an intermediate in carbohydrate and lipid metabolism. Glycerol is used as a solvent, emollient, pharmaceutical agent, and sweetening agent. slaulederkind 2024-09-30T11:58:19Z CHEBI:17754 CID:753 glycerin glycerine experimental_condition_ontology XCO:0001460 glycerol This is any condition in which the main influencing factor is glycerol, a trihydroxy sugar alcohol that is an intermediate in carbohydrate and lipid metabolism. Glycerol is used as a solvent, emollient, pharmaceutical agent, and sweetening agent. MESH:D005990 This is any condition in which the main influencing factor is a specific amount of glycerol dissolved in saline (0.9% sodium chloride solution). Glycerol is a trihydroxy sugar alcohol that is used as a solvent, emollient, pharmaceutical agent, and sweetening agent. slaulederkind 2024-09-30T12:20:53Z CHEBI:17754 CID:753 controlled glycerin content saline controlled glycerine content saline experimental_condition_ontology XCO:0001461 controlled glycerol content saline This is any condition in which the main influencing factor is a specific amount of glycerol dissolved in saline (0.9% sodium chloride solution). Glycerol is a trihydroxy sugar alcohol that is used as a solvent, emollient, pharmaceutical agent, and sweetening agent. MESH:D005990 This is any condition in which the main influencing factor is a thoracic aortic constriction sham procedure, which follows the same surgical process as a thoracic aortic constriction without blocking the aorta. slaulederkind 2024-09-30T14:22:47Z aorta sham banding sham AOB thoracic aorta sham banding thoracic aorta sham ligation thoracic aortic constriction sham procedure experimental_condition_ontology XCO:0001462 thoracic aorta constriction sham procedure This is any condition in which the main influencing factor is a thoracic aortic constriction sham procedure, which follows the same surgical process as a thoracic aortic constriction without blocking the aorta. PMID:39196177 This is any condition in which the main influencing factor is a hyperbaric chamber, which raises atmospheric pressure to simulate atmospheric conditions below sea level or underwater. A hyperbaric chamber may use ambient air at high pressure (hyperbaric air) or air with high oxygen content at high pressure (hyperbaric oxygen therapy). slaulederkind 2024-09-30T15:19:05Z experimental_condition_ontology XCO:0001463 hyperbaric chamber This is any condition in which the main influencing factor is a hyperbaric chamber, which raises atmospheric pressure to simulate atmospheric conditions below sea level or underwater. A hyperbaric chamber may use ambient air at high pressure (hyperbaric air) or air with high oxygen content at high pressure (hyperbaric oxygen therapy). PMID:39156650 https://en.wikipedia.org/wiki/Hyperbaric_medicine This is any condition in which the main influencing factor is citrate buffer, a combination of sodium citrate dihydrate and citric acid in water to form a solution with a pH range of 3.0 to 6.2. slaulederkind 2024-10-01T15:59:01Z CHEBI:53258 CID:6224 https://en.wikipedia.org/wiki/Trisodium_citrate sodium citrate buffer experimental_condition_ontology XCO:0001464 citrate buffer This is any condition in which the main influencing factor is citrate buffer, a combination of sodium citrate dihydrate and citric acid in water to form a solution with a pH range of 3.0 to 6.2. https://www.aatbio.com/resources/buffer-preparations-and-recipes/citrate-buffer-ph-3-to-6-2 This is any condition in which the main influencing factor is ochratoxin A, a phenylalanine derivative that is a nephrotoxic, carcinogenic mycotoxin. Ochratoxin A is among the most widely occurring food-contaminating mycotoxins, produced by Aspergillus ochraceus, Aspergillus carbonarius and Penicillium verrucosum. slaulederkind 2024-10-11T10:36:42Z CAS:303-47-9 CID:442530 MESH:C025589 PMID:37162024 N-{[(3R)-5-chloro-8-hydroxy-3-methyl-1-oxo-3,4-dihydro-1H-2-benzopyran-7-yl]carbonyl}-L-phenylalanine OTA experimental_condition_ontology XCO:0001465 ochratoxin A This is any condition in which the main influencing factor is ochratoxin A, a phenylalanine derivative that is a nephrotoxic, carcinogenic mycotoxin. Ochratoxin A is among the most widely occurring food-contaminating mycotoxins, produced by Aspergillus ochraceus, Aspergillus carbonarius and Penicillium verrucosum. CHEBI:7719 This is any condition in which the main influencing factor is 3-chloro-1,2-propanediol, a chlorinated propanediol with antifertility activity in males used as a chemosterilant in rodents. slaulederkind 2024-10-11T11:04:52Z CAS:96-24-2 CHEBI:18721 CID:7290 PMID:37162024 3-Chloropropanediol 3-MCPD 3-Monochloropropane-1,2-diol 3-chloropropane-1,2-diol alpha-Chlorohydrin experimental_condition_ontology XCO:0001466 3-chloro-1,2-propanediol This is any condition in which the main influencing factor is 3-chloro-1,2-propanediol, a chlorinated propanediol with antifertility activity in males used as a chemosterilant in rodents. MESH:D000517 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of 3-chloro-1,2-propanediol, a chlorinated propanediol with antifertility activity in males used as a chemosterilant in rodents. slaulederkind 2024-10-11T11:13:45Z CHEBI:18721 PMID:37162024 controlled 3-Chloropropanediol content drinking water controlled 3-MCPD content drinking water controlled 3-chloropropane-1,2-diol content drinking water experimental_condition_ontology XCO:0001467 controlled 3-chloro-1,2-propanediol content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of 3-chloro-1,2-propanediol, a chlorinated propanediol with antifertility activity in males used as a chemosterilant in rodents. MESH:D000517 https://www.merriam-webster.com This is any condition in which the main influencing factor is minocycline, a semi-synthetic second-generation tetracycline and a broad-spectrum antibiotic. Minocycline has a dimethylamino group at position 7 and lacks the methyl and hydroxy groups at position 5, which makes it effective against tetracycline-resistant staphylococcus infections. slaulederkind 2024-10-11T14:41:45Z CHEBI:50694 GEO:GSE261833 MESH:D008911 minomycin experimental_condition_ontology XCO:0001468 minocycline This is any condition in which the main influencing factor is minocycline, a semi-synthetic second-generation tetracycline and a broad-spectrum antibiotic. Minocycline has a dimethylamino group at position 7 and lacks the methyl and hydroxy groups at position 5, which makes it effective against tetracycline-resistant staphylococcus infections. CID:54675783 NBK:554519 This is any condition in which the main influencing factor is iron trichloride, a iron coordination entity that has the formula FeCl3(H2O)x. slaulederkind 2024-11-04T14:12:23Z CID:24380 MESH:C024555 ferric chloride iron(3+) chloride iron(III) chloride trichloroiron experimental_condition_ontology XCO:0001469 iron trichloride This is any condition in which the main influencing factor is iron trichloride, a iron coordination entity that has the formula FeCl3(H2O)x. CHEBI:30808 https://en.wikipedia.org/wiki/Iron(III)_chloride This is any condition in which the main influencing factor is hmSi-CREKA-RB-PFH nanoparticles, nanoparticles based on hollow mesoporous silica (hmSi), coated with CREKA (the fibrin-targeting peptide Cys-Arg-Glu-Lys-Ala), and filled with sonosensitizer RB (Rose Bengal) and phase transition molecular PFH (perfluorohexane). These particles are combined with the action of ultrasound in sonodynamic therapy (SDT) of thrombus. slaulederkind 2024-11-04T15:22:22Z GEO:GSE254810 PMID:33987928 hmSi-CREKA-RB-PFH hmSi-CREKA-RB-PFH nanoparticles experimental_condition_ontology XCO:0001470 hmSi-CREKA-RB-PFH nanoparticle This is any condition in which the main influencing factor is hmSi-CREKA-RB-PFH nanoparticles, nanoparticles based on hollow mesoporous silica (hmSi), coated with CREKA (the fibrin-targeting peptide Cys-Arg-Glu-Lys-Ala), and filled with sonosensitizer RB (Rose Bengal) and phase transition molecular PFH (perfluorohexane). These particles are combined with the action of ultrasound in sonodynamic therapy (SDT) of thrombus. PMID:39098904 This is any condition in which the main influencing factor is ultrasound, a technique used in both medical diagnostics and therapeutics. As a therapeutic method, it allows non-invasive means to treat tumors, thrombi, various neurodegenerative diseases, and other medical issues. slaulederkind 2024-11-04T17:00:39Z PMID:39098904 sonography ultrasonography experimental_condition_ontology XCO:0001471 ultrasound This is any condition in which the main influencing factor is ultrasound, a technique used in both medical diagnostics and therapeutics. As a therapeutic method, it allows non-invasive means to treat tumors, thrombi, various neurodegenerative diseases, and other medical issues. ISBN-13:9780781733908 https://www.merriam-webster.com This is any condition in which the main influencing factor is alectinib, an organic heterotetracyclic compound, a member of morpholines, a member of piperidines, a nitrile and an aromatic ketone. Alectinib is an antineoplastic inhibitor of the receptor tyrosine kinase ALK (anaplastic lymphoma kinase). It is used to treat ALK-positive NSCLC (non-small cell lung cancer). slaulederkind 2024-11-07T10:17:30Z CHEBI:90936 MESH:C582670 9-ethyl-6,6-dimethyl-8-[4-(morpholin-4-yl)piperidin-1-yl]-11-oxo-6,11-dihydro-5H-benzo[b]carbazole-3-carbonitrile Alecensa alectinib hydrochloride experimental_condition_ontology XCO:0001472 alectinib This is any condition in which the main influencing factor is cerebral artery perforation, a controlled surgical procedure which perforates the cerebral artery near the junction of the anterior and middle cerebral arteries with a blunt, nylon monofilament passed through the internal carotid artery. The resultant bleeding is a model of subarachnoid hemorrhage (SAH). slaulederkind 2024-12-02T15:59:50Z iatrogenic arterial perforation experimental_condition_ontology cerebral artery rupture XCO:0001473 cerebral artery perforation This is any condition in which the main influencing factor is cerebral artery perforation, a controlled surgical procedure which perforates the cerebral artery near the junction of the anterior and middle cerebral arteries with a blunt, nylon monofilament passed through the internal carotid artery. The resultant bleeding is a model of subarachnoid hemorrhage (SAH). PMID:39233827 This is any condition in which the main influencing factor is a cerebral artery perforation sham procedure, which follows the same surgical process as a cerebral artery perforation procedure, but no perforation is generated. The sham procedure includes surgical exposure of the carotid artery and passage of a blunt, nylon monofilament through the internal carotid artery to the junction of the anterior and middle cerebral arteries. slaulederkind 2024-12-02T16:13:49Z cerebral artery sham perforation experimental_condition_ontology XCO:0001474 cerebral artery perforation sham procedure This is any condition in which the main influencing factor is a cerebral artery perforation sham procedure, which follows the same surgical process as a cerebral artery perforation procedure, but no perforation is generated. The sham procedure includes surgical exposure of the carotid artery and passage of a blunt, nylon monofilament through the internal carotid artery to the junction of the anterior and middle cerebral arteries. PMID:39233827 This is any condition in which the main influencing factor is Banxia Xiexin decoction, an anti-inflammatory, anticancer, and antioxidative drug of traditional Chinese medicine (TCM). Banxia Xiexin decoction has been used to treat stress-induced gastric ulceration (SIGU) and many other gastrointestinal diseases. Banxia Xiexin decoction is a combination of seven different herbal medicines. slaulederkind 2024-12-03T14:37:20Z BXD experimental_condition_ontology XCO:0001475 Banxia Xiexin decoction This is any condition in which the main influencing factor is Banxia Xiexin decoction, an anti-inflammatory, anticancer, and antioxidative drug of traditional Chinese medicine (TCM). Banxia Xiexin decoction has been used to treat stress-induced gastric ulceration (SIGU) and many other gastrointestinal diseases. Banxia Xiexin decoction is a combination of seven different herbal medicines. PMID:38499261 https://www.google.com This is any condition in which the main influencing factor is 8-aminoguanine, a naturally occurring purine that is produced from precursors containing 8-nitroguanine. 8-aminoguanine has effects on urine volume, sodium excretion, glucose excretion, and the metabolome influencing inflammation in the context of metabolic syndrome. slaulederkind 2024-12-05T16:27:20Z CAS:28128-41-8 CID:135421887 MESH:C033495 PMID:38765984 6H-Purin-6-one, 2,8-diamino-1,7-dihydro- 8-AG experimental_condition_ontology XCO:0001476 8-aminoguanine This is any condition in which the main influencing factor is 8-aminoguanine, a naturally occurring purine that is produced from precursors containing 8-nitroguanine. 8-aminoguanine has effects on urine volume, sodium excretion, glucose excretion, and the metabolome influencing inflammation in the context of metabolic syndrome. PMID:39349636 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of 8-aminoguanine, a naturally occurring purine that is produced from precursors containing 8-nitroguanine, consumed by a subject. slaulederkind 2024-12-05T16:41:34Z CAS:28128-41-8 CID:135421887 MESH:C033495 PMID:38765984 controlled 6H-Purin-6-one, 2,8-diamino-1,7-dihydro- content drinking water controlled 8-AG content drinking water experimental_condition_ontology XCO:0001477 controlled 8-aminoguanine content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of 8-aminoguanine, a naturally occurring purine that is produced from precursors containing 8-nitroguanine, consumed by a subject. PMID:39349636 https://www.merriam-webster.com/ This is an experimental condition in which the internal or external environment of a liver is manipulated or regulated, for example through perfusion, increased or decreased blood flow, temperature, etc. after removal from the body. slaulederkind 2024-12-05T17:49:12Z PMID:36982476 controlled isolated liver condition experimental_condition_ontology XCO:0001478 controlled ex vivo liver condition This is an experimental condition in which the internal or external environment of a liver is manipulated or regulated, for example through perfusion, increased or decreased blood flow, temperature, etc. after removal from the body. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is an experimental condition consisting of perfusion (recirculated or single pass) of the isolated liver with some physiological buffer (consisting of controlled solute composition and specific flow rate) through the liver portal vein and/or hepatic artery.. slaulederkind 2024-12-05T17:59:35Z PMID:36982476 controlled isolated liver perfusion HMP of liver hypothermic machine perfusion of ex vivo liver experimental_condition_ontology XCO:0001479 controlled ex vivo liver perfusion This is an experimental condition consisting of perfusion (recirculated or single pass) of the isolated liver with some physiological buffer (consisting of controlled solute composition and specific flow rate) through the liver portal vein and/or hepatic artery.. ISBN-13:9780781733908 PMID:36982476 This is any condition in which the main influencing factor is histidine-tryptophan-ketoglutarate (HTK) solution, a cardioplegic solution used in open heart surgery that is increasingly being used as a preservation solution for kidneys. in HTK tryptophan serves as a membrane stabilizer and antioxidant, ketoglutarate acts as a substrate for anaerobic metabolism during preservation and histidine serves as a pH-buffering component. slaulederkind 2024-12-09T16:25:11Z PMID:36982476 HTK Histidine-tryptophan-ketoglutarate Custodiol HTK experimental_condition_ontology XCO:0001480 histidine-tryptophan-ketoglutarate solution This is any condition in which the main influencing factor is histidine-tryptophan-ketoglutarate (HTK) solution, a cardioplegic solution used in open heart surgery that is increasingly being used as a preservation solution for kidneys. in HTK tryptophan serves as a membrane stabilizer and antioxidant, ketoglutarate acts as a substrate for anaerobic metabolism during preservation and histidine serves as a pH-buffering component. https://www.sciencedirect.com/topics/medicine-and-dentistry/histidine-tryptophan-ketoglutarate This is any condition in which the main influencing factor is ischemia of an ex vivo liver, a liver that has been removed from an organism, but not oxygenated by perfusion or other means. slaulederkind 2024-12-09T16:54:14Z ex vivo ischemia condition experimental_condition_ontology XCO:0001481 ex vivo ischemic liver condition This is any condition in which the main influencing factor is ischemia of an ex vivo liver, a liver that has been removed from an organism, but not oxygenated by perfusion or other means. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is perfusion (recirculated or single pass) of isolated liver with some oxygenated, physiological buffer (consisting of controlled solute composition and specific flow rate) through the hepatic portal vein. slaulederkind 2024-12-09T17:16:29Z HOPE hypothermic, oxygenated ex vivo liver perfusion experimental_condition_ontology XCO:0001482 controlled, oxygenated ex vivo liver perfusion This is any condition in which the main influencing factor is perfusion (recirculated or single pass) of isolated liver with some oxygenated, physiological buffer (consisting of controlled solute composition and specific flow rate) through the hepatic portal vein. ISBN-13:978-1455756438 PMID:36982476 This is any condition in which the main influencing factor is the experimental manipulation of the internal or external environment of the liver, for example through perfusion, increased or decreased blood flow, etc. without removal from the body. slaulederkind 2024-12-10T17:01:47Z PMID:36982476 experimental_condition_ontology XCO:0001483 controlled in situ liver condition This is any condition in which the main influencing factor is the experimental manipulation of the internal or external environment of the liver, for example through perfusion, increased or decreased blood flow, etc. without removal from the body. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is ischemia of an in situ liver, a liver that remains in the organism at normal body temperature, but not oxygenated by natural circulation, perfusion, or other means. slaulederkind 2024-12-10T17:15:02Z experimental_condition_ontology XCO:0001484 in situ ischemic liver condition This is any condition in which the main influencing factor is ischemia of an in situ liver, a liver that remains in the organism at normal body temperature, but not oxygenated by natural circulation, perfusion, or other means. ISBN-13:978-1455756438 PMID:36982476 This is any condition in which the main influencing factor is L4/L5 spinous process resection, an experimental procedure done to induce lumbar spine mechanical instability (LSI) in laboratory animals. The process involves removing the spinous processes along with the supraspinous and interspinous ligaments from lumbar vertebrae L4 and L5. slaulederkind 2024-12-12T14:31:41Z surgical removal of L4/L5 spinous processes experimental_condition_ontology XCO:0001485 L4/L5 spinous process resection This is any condition in which the main influencing factor is L4/L5 spinous process resection, an experimental procedure done to induce lumbar spine mechanical instability (LSI) in laboratory animals. The process involves removing the spinous processes along with the supraspinous and interspinous ligaments from lumbar vertebrae L4 and L5. PMID:38982049 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is L4/L5 spinous process sham resection, which follows the same surgical process through the posterior paravertebral muscle and other soft tissue detachment from the L4-L5 vertebrae, but no spinous process resection occurs. slaulederkind 2024-12-12T14:50:06Z L4/L5 spinous process resection sham surgery experimental_condition_ontology XCO:0001486 L4/L5 spinous process resection sham procedure This is any condition in which the main influencing factor is L4/L5 spinous process sham resection, which follows the same surgical process through the posterior paravertebral muscle and other soft tissue detachment from the L4-L5 vertebrae, but no spinous process resection occurs. PMID:38982049 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is kainic acid, a dicarboxylic acid, a pyrrolidinecarboxylic acid, a L-proline derivative and a non-proteinogenic L-alpha-amino acid. It has a role as an antinematodal drug and an excitatory amino acid agonist. Like many excitatory amino acid agonists it can cause neurotoxicity. Kainic acid is used to cause neurotoxicity and seizures in laboratory animals. slaulederkind 2024-12-16T12:09:47Z CHEBI:31746 MESH:D007608 (3S,4R)-3-(carboxymethyl)-4-(prop-1-en-2-yl)-L-proline Digenic acid kainate experimental_condition_ontology digenin XCO:0001487 kainic acid This is any condition in which the main influencing factor is kainic acid, a dicarboxylic acid, a pyrrolidinecarboxylic acid, a L-proline derivative and a non-proteinogenic L-alpha-amino acid. It has a role as an antinematodal drug and an excitatory amino acid agonist. Like many excitatory amino acid agonists it can cause neurotoxicity. Kainic acid is used to cause neurotoxicity and seizures in laboratory animals. CID:10255 This is any condition in which the main influencing factor is myclobutanil, a widely-used agricultural triazole fungicide. Myclobutanil may cause developmental toxicity and male reproductive toxicity. slaulederkind 2024-12-16T13:27:39Z CHEBI:75281 rac-2-(4-chlorophenyl)-2-(1H-1,2,4-triazol-1-ylmethyl)hexanenitrile experimental_condition_ontology XCO:0001488 myclobutanil This is any condition in which the main influencing factor is myclobutanil, a widely-used agricultural triazole fungicide. Myclobutanil may cause developmental toxicity and male reproductive toxicity. CID:6336 PMID:32268158 This is any condition in which the main influencing factor is an antifungal agent, a substance or other entity that kills or slows the growth of fungi. slaulederkind 2024-12-16T13:34:36Z antifungal fungicidal agent fungistatic agent experimental_condition_ontology XCO:0001489 antifungal agent This is any condition in which the main influencing factor is an antifungal agent, a substance or other entity that kills or slows the growth of fungi. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is lysergic acid diethylamide, a semisynthetic derivative of ergot (Claviceps purpurea) that has complex effects on both peripheral and central nervous system serotonergic receptors. Lysergic acid diethylamide is a potent hallucinogen. slaulederkind 2024-12-16T14:01:14Z CHEBI:6605 CID:5761 (8R)-9,10-didehydro-N,N-diethyl-6-methylergoline-8-carboxamide D-Lsd D-Lysergic acid diethylamide LAD LSD LSD-25 Lysergide Delysid LSD tartrate experimental_condition_ontology XCO:0001490 lysergic acid diethylamide This is any condition in which the main influencing factor is lysergic acid diethylamide, a semisynthetic derivative of ergot (Claviceps purpurea) that has complex effects on both peripheral and central nervous system serotonergic receptors. Lysergic acid diethylamide is a potent hallucinogen. MESH:D008238 This is any condition in which the main influencing factor is calycosin, a 7-hydroxyisoflavone that functions as an antioxidant. slaulederkind 2024-12-16T14:24:34Z CHEBI:17793 MESH:C121707 3',7-dihydroxy-4'-methoxyisoflavone 7,3'-dihydroxy-4'-methoxyisoflavone 7-hydroxy-3-(3-hydroxy-4-methoxyphenyl)-4H-chromen-4-one experimental_condition_ontology XCO:0001491 calycosin This is any condition in which the main influencing factor is calycosin, a 7-hydroxyisoflavone that functions as an antioxidant. CID:5280448 This is any condition in which the main influencing factor is 17alpha-ethynylestradiol, a semisynthetic alkylated estradiol with a 17-alpha-ethinyl substitution. It has high estrogenic potency when administered orally, and is often used as the estrogenic component in combination with progestogen in oral contraceptives. slaulederkind 2024-12-17T14:47:20Z CHEBI:4903 17alpha-ethynylestra-1,3,5(10)-triene-3,17beta-diol ethinyl estradiol ethynylestradiol experimental_condition_ontology XCO:0001492 17alpha-ethynylestradiol This is any condition in which the main influencing factor is 17alpha-ethynylestradiol, a semisynthetic alkylated estradiol with a 17-alpha-ethinyl substitution. It has high estrogenic potency when administered orally, and is often used as the estrogenic component in combination with progestogen in oral contraceptives. CID:5991 MESH:D004997 This is any condition in which the main influencing factor is any maternal exposure to 17alpha-ethynylestradiol that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) 17alpha-ethynylestradiol use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2024-12-17T16:05:28Z PMID:33296240 multigenerational maternal exposure to 17alpha-ethynylestra-1,3,5(10)-triene-3,17beta-diol multigenerational maternal exposure to ethinyl estradiol multigenerational maternal exposure to ethynylestradiol experimental_condition_ontology XCO:0001493 multigenerational maternal exposure to 17alpha-ethynylestradiol This is any condition in which the main influencing factor is any maternal exposure to 17alpha-ethynylestradiol that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) 17alpha-ethynylestradiol use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any maternal exposure to bisphenol A that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) bisphenol A use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2024-12-17T16:05:44Z PMID:33296240 multigenerational maternal exposure to BPA experimental_condition_ontology XCO:0001494 multigenerational maternal exposure to bisphenol A This is any condition in which the main influencing factor is any maternal exposure to bisphenol A that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) bisphenol A use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to sodium carboxymethylcellulose that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) sodium carboxymethylcellulose use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2024-12-17T16:05:51Z CHEBI:85146 CID:6328154 MESH:D002266 multigenerational maternal exposure to CMC-Na multigenerational maternal exposure to carboxymethylcellulose sodium multigenerational maternal exposure to carboxymethylcellulose sodium salt multigenerational maternal exposure to carmellose sodium experimental_condition_ontology XCO:0001495 multigenerational maternal exposure to sodium carboxymethylcellulose This is any condition in which the main influencing factor is any maternal exposure to sodium carboxymethylcellulose that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) sodium carboxymethylcellulose use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to 17alpha-ethynylestradiol. This is a condition typically studied to determine the effect of maternal (F0) 17alpha-ethynylestradiol use/exposure on the F1 offspring slaulederkind 2024-12-17T16:20:57Z PMID:33296240 gestational maternal exposure to 17alpha-ethynylestra-1,3,5(10)-triene-3,17beta-diol gestational maternal exposure to ethinyl estradiol gestational maternal exposure to ethynylestradiol maternal exposure to 17alpha-ethynylestradiol during pregnancy experimental_condition_ontology XCO:0001496 gestational maternal exposure to 17alpha-ethynylestradiol This is any condition in which the main influencing factor is any gestational maternal exposure to 17alpha-ethynylestradiol. This is a condition typically studied to determine the effect of maternal (F0) 17alpha-ethynylestradiol use/exposure on the F1 offspring ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to bisphenol A. This is a condition typically studied to determine the effect of maternal (F0) bisphenol A use/exposure on the F1 offspring. slaulederkind 2024-12-17T16:21:42Z PMID:33296240 gestational maternal exposure to BPA maternal exposure to bisphenol A during pregnancy experimental_condition_ontology XCO:0001497 gestational maternal exposure to bisphenol A This is any condition in which the main influencing factor is any gestational maternal exposure to bisphenol A. This is a condition typically studied to determine the effect of maternal (F0) bisphenol A use/exposure on the F1 offspring. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to sodium carboxymethylcellulose. This is a condition typically studied to determine the effect of maternal (F0) sodium carboxymethylcellulose use/exposure on the F1 offspring. slaulederkind 2024-12-17T16:22:14Z CHEBI:85146 CID:6328154 MESH:D002266 gestational maternal exposure to CMC-Na gestational maternal exposure to carboxymethylcellulose sodium gestational maternal exposure to carboxymethylcellulose sodium salt gestational maternal exposure to carmellose sodium maternal exposure to sodium carboxymethylcellulose during pregnancy experimental_condition_ontology XCO:0001498 gestational maternal exposure to sodium carboxymethylcellulose This is any condition in which the main influencing factor is any gestational maternal exposure to sodium carboxymethylcellulose. This is a condition typically studied to determine the effect of maternal (F0) sodium carboxymethylcellulose use/exposure on the F1 offspring. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is surgical narrowing of the lumen of the inferior vena cava by suture ligation, typically done caudal of the renal veins for establishing a model of deep vein thrombosis (DVT). Typically, side branches of the IVC caudal to the renal veins are fully ligated in this DVT model. slaulederkind 2024-12-19T14:01:43Z IVC ligation experimental_condition_ontology XCO:0001499 inferior vena cava ligation This is any condition in which the main influencing factor is surgical narrowing of the lumen of the inferior vena cava by suture ligation, typically done caudal of the renal veins for establishing a model of deep vein thrombosis (DVT). Typically, side branches of the IVC caudal to the renal veins are fully ligated in this DVT model. PMID:37664678 This is any condition in which the main influencing factor is an inferior vena cava ligation sham procedure, which follows the same surgical process as an inferior vena cava ligation without blocking the inferior vena cava or any other veins. slaulederkind 2024-12-19T14:33:27Z IVC ligation sham procedure experimental_condition_ontology XCO:0001500 inferior vena cava ligation sham procedure This is any condition in which the main influencing factor is an inferior vena cava ligation sham procedure, which follows the same surgical process as an inferior vena cava ligation without blocking the inferior vena cava or any other veins. PMID:37664678 This is any condition in which the main influencing factor is phosphate ion ([PO4]3−), a molecular species derived from phosphoric acid by the removal of three protons. slaulederkind 2024-12-19T15:23:32Z PMID:26739890 [PO 4]3− orthophosphate ion experimental_condition_ontology XCO:0001501 phosphate ion This is any condition in which the main influencing factor is phosphate ion ([PO4]3−), a molecular species derived from phosphoric acid by the removal of three protons. https://en.wikipedia.org/wiki/Phosphate#:~:text=The%20phosphate%20ion%20has%20a,4. This is any condition in which the main influencing factor is a controlled phosphate content diet, which is a regimen of solid food in which the amount of phosphate consumed is controlled. slaulederkind 2024-12-19T16:26:39Z PMID:26739890 controlled [PO 4]3− content diet controlled orthophosphate content diet experimental_condition_ontology XCO:0001502 controlled phosphate content diet This is any condition in which the main influencing factor is a controlled phosphate content diet, which is a regimen of solid food in which the amount of phosphate consumed is controlled. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is alfacalcidol, a member of the class of D3 vitamins that is calciol in which the hydrogen at the 1alpha position is replaced by a hydroxy group. It is an active metabolite of cholecalciferol, which performs important functions in regulation of the calcium balance and the bone metabolism. slaulederkind 2024-12-19T16:43:49Z CID:5282181 MESH:C008088 (1S,3R,5Z,7E)-9,10-secocholesta-5,7,10-triene-1,3-diol 1-Hydroxycholecalciferol 1alpha-hydroxy-vitamin D3 1alpha-hydroxycholecalciferol 1alpha-hydroxyvitamin D3 alphacalcidol experimental_condition_ontology XCO:0001503 alfacalcidol This is any condition in which the main influencing factor is the surgical implantation of some type of metal pellet in muscle. This procedure is used to study the effect of various metals in laboratory models of shrapnel wounds. slaulederkind 2024-12-20T10:38:24Z experimental_condition_ontology metal fragment implantation in muscle XCO:0001504 metal pellet implantation in muscle This is any condition in which the main influencing factor is the surgical implantation of some type of metal pellet in muscle. This procedure is used to study the effect of various metals in laboratory models of shrapnel wounds. PMID:33017228 This is any condition in which the main influencing factor is the surgical implantation of tantalum pellet(s) in muscle. Tantalum implantation serves as a control for other metal implantation because tantalum has great biocompatibility in implants, devices, and stents, and is largely thought to be inert both in vitro and in vivo. slaulederkind 2024-12-20T11:01:28Z control metal pellet implantation in muscle CHEBI:37222 Ta pellet implantation in muscle experimental_condition_ontology XCO:0001505 tantalum pellet implantation in muscle This is any condition in which the main influencing factor is the surgical implantation of tantalum pellet(s) in muscle. Tantalum implantation serves as a control for other metal implantation because tantalum has great biocompatibility in implants, devices, and stents, and is largely thought to be inert both in vitro and in vivo. PMID:33017228 This is any condition in which the main influencing factor is the surgical implantation of nickel pellet(s) in muscle. Nickel is a hard and ductile transition metal that is used in various metal alloys. slaulederkind 2024-12-20T11:21:49Z CHEBI:33748 PMID:33017228 Ni pellet implantation in muscle experimental_condition_ontology XCO:0001506 nickel pellet implantation in muscle This is any condition in which the main influencing factor is the surgical implantation of nickel pellet(s) in muscle. Nickel is a hard and ductile transition metal that is used in various metal alloys. https://en.wikipedia.org/wiki/Nickel This is any condition in which the main influencing factor is the surgical implantation of cobalt pellet(s) in muscle. Cobalt is a hard, brittle transition metal used in metal alloys, batteries, and in colorants. slaulederkind 2024-12-20T12:12:11Z CHEBI:33888 PMID:33017228 Co pellet implantation in muscle experimental_condition_ontology XCO:0001507 cobalt pellet implantation in muscle This is any condition in which the main influencing factor is the surgical implantation of cobalt pellet(s) in muscle. Cobalt is a hard, brittle transition metal used in metal alloys, batteries, and in colorants. https://en.wikipedia.org/wiki/Cobalt This is any condition in which the main influencing factor is the surgical implantation of lead pellet(s) in muscle. Lead is a soft, malleable, dense post-transition metal that has been used in many different man-made products. slaulederkind 2024-12-20T12:28:37Z CHEBI:33585 PMID:33017228 Pb pellet implantation in muscle experimental_condition_ontology XCO:0001508 lead pellet implantation in muscle This is any condition in which the main influencing factor is the surgical implantation of lead pellet(s) in muscle. Lead is a soft, malleable, dense post-transition metal that has been used in many different man-made products. https://en.wikipedia.org/wiki/Lead This is any condition in which the main influencing factor is the surgical implantation of depleted uranium pellet(s) in muscle. Depleted uranium is uranium with a lower content of the fissile isotope 235U than natural uranium. Both depleted uranium and uranium are extremely dense metals. slaulederkind 2024-12-20T12:38:09Z CHEBI:33499 PMID:33017228 DU pellet implantation in muscle experimental_condition_ontology XCO:0001509 depleted uranium pellet implantation in muscle This is any condition in which the main influencing factor is the surgical implantation of depleted uranium pellet(s) in muscle. Depleted uranium is uranium with a lower content of the fissile isotope 235U than natural uranium. Both depleted uranium and uranium are extremely dense metals. https://en.wikipedia.org/wiki/Depleted_uranium This is any condition in which the main influencing factor is transfer of negative control siRNA (small interfering RNA) delivered by transfection or transduction (transfer by virus). Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences. Transfection may be accomplished with chemical, physical, or nonviral biological methods. slaulederkind 2024-12-30T13:38:49Z PMID:33976969 experimental_condition_ontology Not4Curation XCO:0001510 transfer of negative control siRNA This is any condition in which the main influencing factor is transfer of negative control siRNA (small interfering RNA) delivered by transfection or transduction (transfer by virus). Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences. Transfection may be accomplished with chemical, physical, or nonviral biological methods. ISBN-13:978-1455756438 This is any condition in which the main influencing factor is transfer of rat Oprm-1 (opioid receptor, mu 1) shRNA. Oprm-1 is the mu opioid receptor (MOR). The mu opioid receptor is the principal target of endogenous opioid peptides and opioid analgesic agents such as beta-endorphin and enkephalins. slaulederkind 2024-12-30T13:55:56Z transduction of rat Oprm-1 shRNA using an adenoviral vector transduction of rat Oprm-1 shRNA using an adenovirus vector transfer of rat MOR shRNA using an adeno-associated viral (AAV) vector transfer of rat MOR shRNA using an adenovirus vector transfer of rat Oprm-1 shRNA using an adeno-associated viral (AAV) vector transfer of rat Oprm-1 short hairpin RNA using an adenovirus vector transfer of rat mu opioid receptor shRNA using an adenoviral vector transfer of rat mu opioid receptor shRNA using an adenovirus vector experimental_condition_ontology XCO:0001511 transfer of rat Oprm-1 shRNA using an adenovirus vector This is any condition in which the main influencing factor is transfer of rat Oprm-1 (opioid receptor, mu 1) shRNA. Oprm-1 is the mu opioid receptor (MOR). The mu opioid receptor is the principal target of endogenous opioid peptides and opioid analgesic agents such as beta-endorphin and enkephalins. ISBN-13:978-1455756438 RGD:737513 This is any condition in which the main influencing factor is transfer of negative control shRNA (short hairpin RNA) delivered with an adenovirus vector. Negative control shRNA is an shRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental shRNA used. slaulederkind 2024-12-30T14:19:40Z transduction of negative control shRNA using an adenoviral vector transduction of negative control shRNA using an adenovirus vector transfer of negative control shRNA using an adeno-associated viral (AAV) vector transfer of negative control shRNA using an adenoviral vector transfer of negative control shRNA using an adenovirus vector transfer of negative control short hairpin RNA using an adenovirus vector experimental_condition_ontology XCO:0001512 transfer of negative control shRNA using an adenovirus vector This is any condition in which the main influencing factor is transfer of negative control shRNA (short hairpin RNA) delivered with an adenovirus vector. Negative control shRNA is an shRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental shRNA used. ISBN-13:978-1455756438 PMID:32388931 This is any condition in which the main influencing factor is methylazoxymethanol acetate, a neurotoxin which reduces DNA synthesis. Methylazoxymethanol acetate is used in making animal models of neurological diseases including schizophrenia and epilepsy. It may also be carcinogenic. slaulederkind 2024-12-30T14:52:28Z CID:5363199 MESH:D008746 MAM [(Z)-methyl-ONN-azoxy]methyl acetate experimental_condition_ontology XCO:0001513 methylazoxymethanol acetate This is any condition in which the main influencing factor is methylazoxymethanol acetate, a neurotoxin which reduces DNA synthesis. Methylazoxymethanol acetate is used in making animal models of neurological diseases including schizophrenia and epilepsy. It may also be carcinogenic. https://en.wikipedia.org/wiki/Methylazoxymethanol_acetate This is any condition in which the main influencing factor is any maternal exposure to methylazoxymethanol acetate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) methylazoxymethanol acetate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2024-12-31T12:16:49Z PMID:32497066 multigenerational maternal exposure to MAM multigenerational maternal exposure to [(Z)-methyl-ONN-azoxy]methyl acetate experimental_condition_ontology XCO:0001514 multigenerational maternal exposure to methylazoxymethanol acetate This is any condition in which the main influencing factor is any maternal exposure to methylazoxymethanol acetate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) methylazoxymethanol acetate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to methylazoxymethanol acetate. This is a condition typically studied to determine the effect of maternal (F0) methylazoxymethanol acetate use/exposure on the F1 offspring. slaulederkind 2024-12-31T12:20:59Z PMID:32497066 gestational maternal exposure to MAM gestational maternal exposure to [(Z)-methyl-ONN-azoxy]methyl acetate maternal exposure to methylazoxymethanol acetate during pregnancy experimental_condition_ontology XCO:0001515 gestational maternal exposure to methylazoxymethanol acetate This is any condition in which the main influencing factor is any gestational maternal exposure to methylazoxymethanol acetate. This is a condition typically studied to determine the effect of maternal (F0) methylazoxymethanol acetate use/exposure on the F1 offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to poly I:C that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) poly I:C use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2024-12-31T12:35:05Z PMID:32497066 multigenerational maternal exposure to Poly(I:C) dsRNA multigenerational maternal exposure to dsRNA poly(I:C) multigenerational maternal exposure to poly(I:C) multigenerational maternal exposure to polyinosinic-polycytidylic acid experimental_condition_ontology XCO:0001516 multigenerational maternal exposure to poly I:C This is any condition in which the main influencing factor is any maternal exposure to poly I:C that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) poly I:C use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to poly I:C. This is a condition typically studied to determine the effect of maternal (F0) poly I:C use/exposure on the F1 offspring. slaulederkind 2024-12-31T12:50:37Z PMID:32497066 gestational maternal exposure dsRNA poly(I:C) gestational maternal exposure poly(I:C) gestational maternal exposure polyinosinic-polycytidylic acid gestational maternal exposure to Poly(I:C) dsRNA maternal exposure to poly I:C during pregnancy experimental_condition_ontology XCO:0001517 gestational maternal exposure to poly I:C This is any condition in which the main influencing factor is any gestational maternal exposure to poly I:C. This is a condition typically studied to determine the effect of maternal (F0) poly I:C use/exposure on the F1 offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is maternal exposure to a controlled protein content diet that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) controlled protein content diet on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2024-12-31T13:04:46Z PMID:32497066 multigenerational maternal exposure to controlled protein content diet experimental_condition_ontology XCO:0001518 multigenerational maternal exposure to a controlled protein content diet This is any condition in which the main influencing factor is maternal exposure to a controlled protein content diet that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) controlled protein content diet on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is gestational maternal exposure to a controlled protein content diet. This is a condition typically studied to determine the effect of a maternal (F0) controlled protein content diet on the F1 offspring. slaulederkind 2024-12-31T13:10:28Z PMID:32497066 gestational maternal exposure to controlled protein content diet maternal exposure to a controlled protein content diet during pregnancy experimental_condition_ontology XCO:0001519 gestational maternal exposure to a controlled protein content diet This is any condition in which the main influencing factor is gestational maternal exposure to a controlled protein content diet. This is a condition typically studied to determine the effect of a maternal (F0) controlled protein content diet on the F1 offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any maternal exposure to controlled air oxygen content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-01-03T15:02:26Z PMID:32639867 multigenerational maternal exposure to measured air O2 content multigenerational maternal exposure to measured air oxygen content experimental_condition_ontology XCO:0001520 multigenerational maternal exposure to controlled air oxygen content This is any condition in which the main influencing factor is any maternal exposure to controlled air oxygen content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any pregestational maternal exposure to controlled air oxygen content. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure on the F1 offspring. slaulederkind 2025-01-03T15:08:23Z PMID:32639867 maternal exposure to controlled air oxygen content prior to a pregnancy maternal exposure to measured air oxygen content prior to a pregnancy pregestational maternal exposure to controlled air O2 content experimental_condition_ontology XCO:0001521 pregestational maternal exposure to controlled air oxygen content This is any condition in which the main influencing factor is any pregestational maternal exposure to controlled air oxygen content. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure on the F1 offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to controlled air oxygen content. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure on the F1 offspring. slaulederkind 2025-01-03T15:14:51Z PMID:32639867 maternal exposure to controlled air O2 content during pregnancy maternal exposure to controlled air oxygen content during pregnancy experimental_condition_ontology XCO:0001522 gestational maternal exposure to controlled air oxygen content This is any condition in which the main influencing factor is any gestational maternal exposure to controlled air oxygen content. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure on the F1 offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any maternal exposure to controlled air oxygen content during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure during the postnatal, preweaning period on the F1 offspring . slaulederkind 2025-01-03T15:27:49Z PMID:32639867 maternal exposure to controlled air O2 content during nursing of offspring maternal exposure to controlled air oxygen content during nursing of offspring experimental_condition_ontology XCO:0001523 maternal exposure to controlled air oxygen content during nursing This is any condition in which the main influencing factor is any maternal exposure to controlled air oxygen content during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure during the postnatal, preweaning period on the F1 offspring . PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any paternal exposure to controlled air oxygen content that has multigenerational effects. This is a condition typically studied to determine the effect of paternal (F0) controlled air oxygen content exposure on the F1 offspring. The paternal exposure may be any time before conception of offspring. slaulederkind 2025-01-03T15:40:17Z PMID:32639867 multigenerational paternal exposure to measured air O2 content multigenerational paternal exposure to measured air oxygen content pre-copulatory paternal exposure to controlled air oxygen content precopulatory paternal exposure to controlled air oxygen content experimental_condition_ontology XCO:0001524 multigenerational paternal exposure to controlled air oxygen content This is any condition in which the main influencing factor is any paternal exposure to controlled air oxygen content that has multigenerational effects. This is a condition typically studied to determine the effect of paternal (F0) controlled air oxygen content exposure on the F1 offspring. The paternal exposure may be any time before conception of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any parental exposure to controlled air oxygen content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal/paternal (F0) controlled air oxygen content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. Paternal exposure to controlled air oxygen content may occur anytime before successful copulation. slaulederkind 2025-01-03T15:52:55Z PMID:32639867 multigenerational parental exposure to controlled air O2 content multigenerational paternal exposure to measured air O2 content multigenerational paternal exposure to measured air oxygen content experimental_condition_ontology Not4Curation XCO:0001525 multigenerational parental exposure to controlled air oxygen content This is any condition in which the main influencing factor is any parental exposure to controlled air oxygen content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal/paternal (F0) controlled air oxygen content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. Paternal exposure to controlled air oxygen content may occur anytime before successful copulation. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any maternal exposure to streptozotocin that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) streptozotocin exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-01-06T12:10:27Z PMID:32595139 multigenerational maternal exposure to STZ multigenerational maternal exposure to streptozocin experimental_condition_ontology XCO:0001526 multigenerational maternal exposure to streptozotocin This is any condition in which the main influencing factor is any maternal exposure to streptozotocin that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) streptozotocin exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to streptozotocin. This is a condition typically studied to determine the effect of maternal (F0) streptozotocin exposure on the F1 offspring. slaulederkind 2025-01-06T12:26:31Z PMID:32595139 gestational maternal exposure to STZ gestational maternal exposure to streptozocin maternal exposure to streptozotocin during pregnancy experimental_condition_ontology XCO:0001527 gestational maternal exposure to streptozotocin This is any condition in which the main influencing factor is any gestational maternal exposure to streptozotocin. This is a condition typically studied to determine the effect of maternal (F0) streptozotocin exposure on the F1 offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to citrate buffer that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) citrate buffer exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. Citrate buffer is a combination of sodium citrate dihydrate and citric acid in water to form a solution with a pH range of 3.0 to 6.2. slaulederkind 2025-01-06T12:42:24Z PMID:32595139 multigenerational maternal exposure to sodium citrate buffer experimental_condition_ontology XCO:0001528 multigenerational maternal exposure to citrate buffer This is any condition in which the main influencing factor is any maternal exposure to citrate buffer that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) citrate buffer exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. Citrate buffer is a combination of sodium citrate dihydrate and citric acid in water to form a solution with a pH range of 3.0 to 6.2. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to citrate buffer. This is a condition typically studied to determine the effect of maternal (F0) citrate buffer exposure on the F1 offspring. This is typically a control condition for gestational maternal exposure to some chemical agent. slaulederkind 2025-01-06T12:57:18Z PMID:32595139 gestational maternal exposure to sodium citrate buffer maternal exposure to citrate buffer during pregnancy experimental_condition_ontology XCO:0001529 gestational maternal exposure to citrate buffer This is any condition in which the main influencing factor is any gestational maternal exposure to citrate buffer. This is a condition typically studied to determine the effect of maternal (F0) citrate buffer exposure on the F1 offspring. This is typically a control condition for gestational maternal exposure to some chemical agent. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any maternal exposure to hyperglycemia (blood glucose level > 180 mg/dl) that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) hyperglycemia exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-01-06T13:15:35Z PMID:32595139 multigenerational maternal exposure to high blood glucose multigenerational maternal exposure to high blood sugar experimental_condition_ontology XCO:0001530 multigenerational maternal exposure to hyperglycemia This is any condition in which the main influencing factor is any maternal exposure to hyperglycemia (blood glucose level > 180 mg/dl) that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) hyperglycemia exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to hyperglycemia (blood glucose level > 180 mg/dl). This is a condition typically studied to determine the effect of maternal (F0) hyperglycemia exposure on the F1 offspring. slaulederkind 2025-01-06T13:36:01Z PMID:32595139 gestational maternal exposure to high blood glucose gestational maternal exposure to high blood sugar maternal exposure to hyperglycemia during pregnancy experimental_condition_ontology XCO:0001531 gestational maternal exposure to hyperglycemia This is any condition in which the main influencing factor is any gestational maternal exposure to hyperglycemia (blood glucose level > 180 mg/dl). This is a condition typically studied to determine the effect of maternal (F0) hyperglycemia exposure on the F1 offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is use of the Masquelet surgical technique, a surgical procedure used to reconstruct bone defects, particularly those that are large or infected. This technique involves placement of a polymethyl methacrylate (PMMA) cement spacer in a bone defect to allow growth of a vascularized membrane that promotes bone regeneration. A second stage in the method involves removing the spacer after membrane growth and replacing it with bone graft. slaulederkind 2025-01-31T12:58:10Z Masquelet induced-membrane technique Masquelet technique Masquelet treatment experimental_condition_ontology XCO:0001532 Masquelet surgery This is any condition in which the main influencing factor is use of the Masquelet surgical technique, a surgical procedure used to reconstruct bone defects, particularly those that are large or infected. This technique involves placement of a polymethyl methacrylate (PMMA) cement spacer in a bone defect to allow growth of a vascularized membrane that promotes bone regeneration. A second stage in the method involves removing the spacer after membrane growth and replacing it with bone graft. PMID:_21543068 This is any condition in which the main influencing factor is sciatic nerve ablation, surgical removal of some part of the sciatic nerve. slaulederkind 2025-02-04T13:32:24Z PMID:33008419 surgical removal of part of the sciatic nerve experimental_condition_ontology XCO:0001533 sciatic nerve ablation This is any condition in which the main influencing factor is sciatic nerve ablation, surgical removal of some part of the sciatic nerve. https://www.merriam-webster.com This is any condition in which the main influencing factor is a peripheral nerve allograft, a non-self peripheral nerve transplantation, typically without histocompatibility matching between donor and host. Commonly, a portion of a donor nerve replaces the damaged portion of the host nerve and involves neurorrhaphy (re-apposing the cut ends with epineurial microsutures). slaulederkind 2025-02-04T14:44:35Z PMID:33008419 peripheral nerve transplant experimental_condition_ontology XCO:0001534 peripheral nerve allograft This is any condition in which the main influencing factor is a peripheral nerve allograft, a non-self peripheral nerve transplantation, typically without histocompatibility matching between donor and host. Commonly, a portion of a donor nerve replaces the damaged portion of the host nerve and involves neurorrhaphy (re-apposing the cut ends with epineurial microsutures). PMID:35227261 This is any condition in which the main influencing factor is the PEG-fusion protocol, a peripheral nerve allograft procedure involving sequential administration of four pharmaceutical agents and neurorrhaphy (microsutures through the epi- or perineurium). slaulederkind 2025-02-04T15:22:05Z PMID:30586569 PEG-fusion PEG-fusion allograft protocol experimental_condition_ontology XCO:0001535 PEG-fusion protocol This is any condition in which the main influencing factor is the PEG-fusion protocol, a peripheral nerve allograft procedure involving sequential administration of four pharmaceutical agents and neurorrhaphy (microsutures through the epi- or perineurium). PMID:_33008419 This is a condition in which the mouse Vdr (vitamin D receptor) gene has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of Vdr in the recipient cell or organism. slaulederkind 2025-02-07T11:08:43Z RGD:11484 gene transfer of mouse Vdr using a lentivirus vector gene transfer of the mouse Vdr gene using a lentiviral vector gene transfer of the mouse vitamin D receptor gene using a lentivirus vector transduction of the mouse Vdr gene using a lentiviral vector transduction of the mouse Vdr gene using a lentivirus vector transduction of the mouse vitamin D receptor gene using a lentivirus vector experimental_condition_ontology XCO:0001536 gene transfer of the mouse Vdr gene using a lentivirus vector This is a condition in which the mouse Vdr (vitamin D receptor) gene has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of Vdr in the recipient cell or organism. PMID:32771696 https://www.merriam-webster.com This is any condition in which the main influencing factor is shRNA (short hairpin ribonucleic acid). shRNA is a synthetic RNA molecule that can silence genes in cells. It's a key technology for targeted gene silencing. shRNA is delivered to cells using plasmids, viral vectors, or bacterial vectors slaulederkind 2025-02-07T12:13:40Z PMID:22365779 transfer of shRNA using a lentiviral vector transfer of short hairpin RNA using a lentivirus vector transfer of short hairpin ribonucleic acid using a lentivirus vector transfer of small hairpin RNA using a lentivirus vector experimental_condition_ontology Not4Curation XCO:0001537 transfer of shRNA using a lentivirus vector This is any condition in which the main influencing factor is shRNA (short hairpin ribonucleic acid). shRNA is a synthetic RNA molecule that can silence genes in cells. It's a key technology for targeted gene silencing. shRNA is delivered to cells using plasmids, viral vectors, or bacterial vectors PMID:23027054 https://en.wikipedia.org/wiki/Short_hairpin_RNA This is a condition in which rat Vdr shRNA (vitamin D (1,25-dihydroxyvitamin D3) receptor-specific short hairpin RNA) has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to reduce synthesis of Vdr in the recipient cell or organism. slaulederkind 2025-02-07T13:25:10Z PMID:23027054 ransfer of rat vitamin D (1,25-dihydroxyvitamin D3) receptor shRNA using a lentivirus vector transduction of rat Vdr shRNA using a lentiviral vector transduction of rat Vdr shRNA using a lentivirus vector transfer of rat Vdr shRNA using a lentiviral vector experimental_condition_ontology XCO:0001538 transfer of rat Vdr shRNA using a lentivirus vector This is a condition in which rat Vdr shRNA (vitamin D (1,25-dihydroxyvitamin D3) receptor-specific short hairpin RNA) has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to reduce synthesis of Vdr in the recipient cell or organism. PMID:33258480 https://en.wikipedia.org/wiki/Short_hairpin_RNA This is any condition in which the major influencing factor is an empty lentivirus vector that has been transferred into a cell or organism. This condition is used as a control for a lentivirus transfer of a specific gene. slaulederkind 2025-02-07T13:46:11Z PMID:32771696 sham gene transfer using an empty lentiviral vector sham transduction using an empty lentiviral vector sham transduction using an empty lentivirus vector experimental_condition_ontology XCO:0001539 sham gene transfer using an empty lentivirus vector This is any condition in which the major influencing factor is an empty lentivirus vector that has been transferred into a cell or organism. This condition is used as a control for a lentivirus transfer of a specific gene. PMID:28927539 https://en.wikipedia.org/wiki/Transduction_(genetics) This is any condition in which the main influencing factor is skeletal muscle ablation, which is surgical removal of all or part of one or more skeletal muscles. It is an experimental procedure used in laboratory animals to observe and determine what compensation measures are brought to bear in the remaining musculature. slaulederkind 2025-02-10T17:06:28Z PMID:33486778 surgical removal of skeletal muscle experimental_condition_ontology XCO:0001540 skeletal muscle ablation This is any condition in which the main influencing factor is skeletal muscle ablation, which is surgical removal of all or part of one or more skeletal muscles. It is an experimental procedure used in laboratory animals to observe and determine what compensation measures are brought to bear in the remaining musculature. PMID:39069823 https://www.merriam-webster.com This is any condition in which the main influencing factor is unilateral, surgical removal of the gastrocnemius (distal two-thirds) and soleus muscles. This synergist ablation is performed in experimental animals to cause functional overload in the plantaris muscle. slaulederkind 2025-02-10T17:22:57Z PMID:33486778 synergist ablation model unilateral, surgical removal of the gastrocnemius and soleus muscles experimental_condition_ontology XCO:0001541 unilateral ablation of the gastrocnemius and soleus muscles This is any condition in which the main influencing factor is unilateral, surgical removal of the gastrocnemius (distal two-thirds) and soleus muscles. This synergist ablation is performed in experimental animals to cause functional overload in the plantaris muscle. PMID:39069823 https://www.merriam-webster.com This is any condition in which the main influencing factor is oxytocin, a peptide hormone (CYIQNCPLG) that is released from the posterior pituitary gland as a uterine-contracting and milk-ejecting hormone acting on smooth muscle cells. Oxytocin is also a neurotransmitter in the brain. slaulederkind 2025-02-11T10:44:06Z PMID:38327784 Pitocin experimental_condition_ontology XCO:0001542 oxytocin This is any condition in which the main influencing factor is oxytocin, a peptide hormone (CYIQNCPLG) that is released from the posterior pituitary gland as a uterine-contracting and milk-ejecting hormone acting on smooth muscle cells. Oxytocin is also a neurotransmitter in the brain. CHEBI:7872 MESH:D010121 This is any condition in which the main influencing factor is any maternal exposure to oxytocin that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxytocin use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-02-11T14:06:50Z PMID:38327784 experimental_condition_ontology XCO:0001543 multigenerational maternal exposure to oxytocin This is any condition in which the main influencing factor is any maternal exposure to oxytocin that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxytocin use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any maternal exposure to oxytocin that has transgenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxytocin use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation. slaulederkind 2025-02-11T14:13:59Z PMID:38327784 experimental_condition_ontology XCO:0001544 transgenerational maternal exposure to oxytocin This is any condition in which the main influencing factor is any maternal exposure to oxytocin that has transgenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxytocin use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to oxytocin. This is a condition typically studied to determine the effect of maternal (F0) oxytocin use/exposure on the F1 offspring. slaulederkind 2025-02-11T14:18:41Z PMID:38327784 maternal exposure to oxytocin during pregnancy experimental_condition_ontology XCO:0001545 gestational maternal exposure to oxytocin This is any condition in which the main influencing factor is any gestational maternal exposure to oxytocin. This is a condition typically studied to determine the effect of maternal (F0) oxytocin use/exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is tramadol hydrochloride, a racemate consisting of equal amounts of (R,R)- and (S,S)-tramadol hydrochloride. Tramadol hydrochloride is a centrally acting synthetic opioid analgesic, used to treat moderately severe pain. Tramadol hydrochloride has a role as a delta-opioid receptor agonist, a kappa-opioid receptor agonist, a mu-opioid receptor agonist, an adrenergic uptake inhibitor, an antitussive, a capsaicin receptor antagonist, a muscarinic antagonist, a nicotinic antagonist, a NMDA receptor antagonist, a serotonergic antagonist and a serotonin uptake inhibitor. slaulederkind 2025-02-11T14:44:47Z CAS:36282-47-0 PMID:33486778 rac-(1R,2R)-2-[(dimethylamino)methyl]-1-(3-methoxyphenyl)cyclohexanol hydrochloride racemic tramadol hydrochloride tramadol HCl experimental_condition_ontology XCO:0001546 tramadol hydrochloride This is any condition in which the main influencing factor is tramadol hydrochloride, a racemate consisting of equal amounts of (R,R)- and (S,S)-tramadol hydrochloride. Tramadol hydrochloride is a centrally acting synthetic opioid analgesic, used to treat moderately severe pain. Tramadol hydrochloride has a role as a delta-opioid receptor agonist, a kappa-opioid receptor agonist, a mu-opioid receptor agonist, an adrenergic uptake inhibitor, an antitussive, a capsaicin receptor antagonist, a muscarinic antagonist, a nicotinic antagonist, a NMDA receptor antagonist, a serotonergic antagonist and a serotonin uptake inhibitor. CHEBI:32250 CID:63013 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of tramadol hydrochloride, a synthetic opioid analgesic, consumed by a subject. slaulederkind 2025-02-11T15:05:33Z PMID:33486778 controlled racemic tramadol hydrochloride content drinking water controlled tramadol HCl content drinking water experimental_condition_ontology XCO:0001547 controlled tramadol hydrochloride content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of tramadol hydrochloride, a synthetic opioid analgesic, consumed by a subject. CHEBI:32250 https://www.merriam-webster.com This is any condition in which the main influencing factor is manganese(II) chloride tetrahydrate, the tetrahydrate form of manganese(II) chloride. Manganese(II) chloride tetrahydrate has a role as a nutraceutical and a MRI contrast agent. Upon administration, manganese may act as an adjuvant and induce both humoral and cellular immune responses. slaulederkind 2025-02-25T14:03:32Z CAS:13446-34-9 CHEBI:86368 PMID:33666854 Cl2H8MnO4 dichloromanganese--water (1/4) manganese chloride manganese dichloride tetrahydrate manganese(2+) chloride tetrahydrate experimental_condition_ontology XCO:0001548 manganese(II) chloride tetrahydrate This is any condition in which the main influencing factor is manganese(II) chloride tetrahydrate, the tetrahydrate form of manganese(II) chloride. Manganese(II) chloride tetrahydrate has a role as a nutraceutical and a MRI contrast agent. Upon administration, manganese may act as an adjuvant and induce both humoral and cellular immune responses. CID:643989 This is any condition in which the main influencing factor is inorganic chloride. Chlorine anion (Cl−) is an essential electrolyte located in all body fluids and responsible for maintaining acid/base balance, transmitting nerve impulses, and regulating liquid flow in and out of cells. Chloride compounds contain chlorine atoms bonded to metals like sodium (NaCl), calcium (CaCl2), or magnesium (MgCl2). slaulederkind 2025-02-25T14:19:38Z CHEBI:36093 inorganic chloride salt inorganic chloride salts inorganic chlorides experimental_condition_ontology XCO:0001549 inorganic chloride This is any condition in which the main influencing factor is inorganic chloride. Chlorine anion (Cl−) is an essential electrolyte located in all body fluids and responsible for maintaining acid/base balance, transmitting nerve impulses, and regulating liquid flow in and out of cells. Chloride compounds contain chlorine atoms bonded to metals like sodium (NaCl), calcium (CaCl2), or magnesium (MgCl2). https://chemicaltankerknowledgebase.com/chloride https://en.wikipedia.org/wiki/Chloride This is any condition whose main influencing factor is cellulose, a polysaccharide consisting of a linear chain of several hundred to many thousands of β(1→4) linked D-glucose units, occurs naturally in such fibrous products as cotton and kapok, and is the raw material of many manufactured goods (such as paper, rayon, and cellophane). slaulederkind 2025-02-25T15:03:01Z MESH:D002482 PMID:33602020 (C6H10O5)n experimental_condition_ontology XCO:0001550 cellulose This is any condition whose main influencing factor is cellulose, a polysaccharide consisting of a linear chain of several hundred to many thousands of β(1→4) linked D-glucose units, occurs naturally in such fibrous products as cotton and kapok, and is the raw material of many manufactured goods (such as paper, rayon, and cellophane). https://en.wikipedia.org/wiki/Cellulose https://www.merriam-webster.com/dictionary/cellulose This is any condition in which the main influencing factor is cellulose nanocrystals, formed by acid hydrolysis of cellulose. The family of nanocellulosic materials include microfibrilated cellulose, cellulose nanofibers, and cellulose nanocrystals. Cellulose nanocrystals are rod-shaped particles of 100 to 1000 nanometers in length. slaulederkind 2025-02-25T16:04:23Z CNC NCC nanocrystalline cellulose experimental_condition_ontology XCO:0001551 cellulose nanocrystal This is any condition in which the main influencing factor is cellulose nanocrystals, formed by acid hydrolysis of cellulose. The family of nanocellulosic materials include microfibrilated cellulose, cellulose nanofibers, and cellulose nanocrystals. Cellulose nanocrystals are rod-shaped particles of 100 to 1000 nanometers in length. PMID:33602020 https://en.wikipedia.org/wiki/Nanocellulose This is any condition in which the main influencing factor is a liquid diet, a diet consisting of only liquids to provide essential nutrients and hydration. A liquid diet may include any food type able to be delivered easily through a drinking straw. slaulederkind 2025-03-06T13:26:18Z PMID:37537282 non-solid diet experimental_condition_ontology XCO:0001552 liquid diet This is any condition in which the main influencing factor is a liquid diet, a diet consisting of only liquids to provide essential nutrients and hydration. A liquid diet may include any food type able to be delivered easily through a drinking straw. https://www.merriam-webster.com https://www.webmd.com/diet/liquid-diets This is any condition in which the main influencing factor is Lieber-DeCarli control liquid diet, a liquid diet whose calories are 50% carbohydrate, 35% fat, and 15% protein. slaulederkind 2025-03-06T13:39:33Z PMID:37537282 Bio-Serv F1259 Lieber-DeCarli '82 control liquid diet experimental_condition_ontology XCO:0001553 Lieber-DeCarli control liquid diet This is any condition in which the main influencing factor is Lieber-DeCarli control liquid diet, a liquid diet whose calories are 50% carbohydrate, 35% fat, and 15% protein. https://www.bio-serv.com/pdf/F1259.pdf https://www.merriam-webster.com This is any condition in which the main influencing factor is Lieber-DeCarli ethanol liquid diet, a liquid diet whose calories are 35% ethanol, 35% non-alcoholic carbohydrate, 35% fat, and 15% protein. The basic formula makes the ethanol content to be about 8% by volume. slaulederkind 2025-03-06T14:25:45Z PMID:37537282 Bio-Serv F1258 Lieber-DeCarli '82 ethanol liquid diet experimental_condition_ontology XCO:0001554 Lieber-DeCarli ethanol liquid diet This is any condition in which the main influencing factor is Lieber-DeCarli ethanol liquid diet, a liquid diet whose calories are 35% ethanol, 35% non-alcoholic carbohydrate, 35% fat, and 15% protein. The basic formula makes the ethanol content to be about 8% by volume. https://www.bio-serv.com/pdf/F1258.pdf https://www.merriam-webster.com This is any condition in which the main influencing factor is controlled air ethanol content surrounding an organism or breathed by the organism as part of the experiment. slaulederkind 2025-03-20T12:36:33Z GEO:GSE159136 PMID:28363981 controlled air ethanol vapor content chronic intermittent ethanol vapor exposure chronic intermittent ethanol vapor inhalation experimental_condition_ontology CIE chronic intermittent ethanol XCO:0001555 controlled air ethanol content This is any condition in which the main influencing factor is controlled air ethanol content surrounding an organism or breathed by the organism as part of the experiment. PMID:34573170 This is any condition in which the main influencing factor is acadesine, a purine nucleoside analogue and activator of AMP-activated protein kinase. Acadesine is used for the treatment of acute lymphoblastic leukemia and is reported to have cardioprotective effects. slaulederkind 2025-03-20T13:31:59Z CID:46780289 MESH:C011651 5-Amino-1-beta-D-ribofuranosyl-1H-imidazole-4-carboxamide 5-Aminoimidazole-4-carboxamide 1-beta-D-ribofuranoside AICA ribofuranoside AICA-riboside AICAR experimental_condition_ontology XCO:0001556 acadesine This is any condition in which the main influencing factor is acadesine, a purine nucleoside analogue and activator of AMP-activated protein kinase. Acadesine is used for the treatment of acute lymphoblastic leukemia and is reported to have cardioprotective effects. CHEBI:28498 This is any condition in which the main influencing factor is direct electrical stimulation of the ventral trunk of the subdiaphragmatic vagus nerve. The electrical stimulation is delivered by some sort of bioelectronic implant. The vagus nerve (the tenth cranial nerve), is a mixed nerve that carries both sensory and motor information. The vagus nerve is the longest nerve in the human body as it originates in the brainstem and travels down the neck and into the thorax and abdomen. slaulederkind 2025-03-20T18:27:29Z tenth cranial nerve direct electrical stimulation vagal nerve direct electrical stimulation vagus nerve direct electrical stimulation GEO:GSE189615 PMID:37746712 sdVNS subdiaphragmatic vagus nerve stimulation experimental_condition_ontology XCO:0001557 ventral trunk of subdiaphragmatic vagus nerve direct electrical stimulation This is any condition in which the main influencing factor is direct electrical stimulation of the ventral trunk of the subdiaphragmatic vagus nerve. The electrical stimulation is delivered by some sort of bioelectronic implant. The vagus nerve (the tenth cranial nerve), is a mixed nerve that carries both sensory and motor information. The vagus nerve is the longest nerve in the human body as it originates in the brainstem and travels down the neck and into the thorax and abdomen. PMID:30725856 This is any condition in which the main influencing factor is ventral trunk of subdiaphragmatic vagus nerve direct electrical stimulation sham procedure. This procedure involves all the surgical maneuvers and implantations minus the electrode leads. slaulederkind 2025-03-21T11:51:23Z PMID:30725856 sdVNS sham subdiaphragmatic vagus nerve stimulation sham tenth cranial nerve direct electrical stimulation sham vagal nerve direct electrical stimulation sham vagus nerve direct electrical stimulation sham experimental_condition_ontology XCO:0001558 ventral trunk of subdiaphragmatic vagus nerve direct electrical stimulation sham procedure This is any condition in which the main influencing factor is ventral trunk of subdiaphragmatic vagus nerve direct electrical stimulation sham procedure. This procedure involves all the surgical maneuvers and implantations minus the electrode leads. PMID:37746712 This is any condition in which the main influencing factor is a per- or polyfluoroalkyl substance. These are organofluorine compounds that have multiple fluorine atoms attached to an alkyl chain (perfluoroalkyl compounds have carbon chain atoms that are completely fluorinated and polyfluoroalkyl compounds have at least one of the carbon atoms in the alkyl chain not fully fluorinated). slaulederkind 2025-03-21T14:08:22Z GEO:GSE262750 PMID:38963985 PFAS PFASs forever chemicals experimental_condition_ontology XCO:0001559 per- and polyfluoroalkyl substances This is any condition in which the main influencing factor is a per- or polyfluoroalkyl substance. These are organofluorine compounds that have multiple fluorine atoms attached to an alkyl chain (perfluoroalkyl compounds have carbon chain atoms that are completely fluorinated and polyfluoroalkyl compounds have at least one of the carbon atoms in the alkyl chain not fully fluorinated). CHEBI:172397 CHEBI:172406 This is any condition in which the main influencing factor is perfluorohexane sulfonate, the conjugate base of perfluorohexanesulfonic acid. slaulederkind 2025-03-21T14:35:38Z CID:23678874 perfluorohexanesulfonate potassium perfluorohexanesulfonate experimental_condition_ontology PFHxS XCO:0001560 perfluorohexane sulfonate This is any condition in which the main influencing factor is perfluorohexane sulfonate, the conjugate base of perfluorohexanesulfonic acid. https://en.wikipedia.org/wiki/Conjugate_(acid-base_theory) https://en.wikipedia.org/wiki/Perfluorohexanesulfonic_acid This is any condition in which the main influencing factor is 6-propyl-2-thiouracil (propylthiouracil), a drug used to treat Graves' disease and hyperthyroidism. Propylthiouracil is a thyroid hormone antagonist, a nitric oxide synthase inhibitor, an antioxidant, and an antidote to paracetamol poisoning. slaulederkind 2025-03-21T14:53:57Z CHEBI:8502 MESH:D011441 6-n-propylthiouracil 6-propyl-2-sulfanylidene-2,3-dihydropyrimidin-4(1H)-one PTU propylthiouracil experimental_condition_ontology XCO:0001561 6-propyl-2-thiouracil This is any condition in which the main influencing factor is 6-propyl-2-thiouracil (propylthiouracil), a drug used to treat Graves' disease and hyperthyroidism. Propylthiouracil is a thyroid hormone antagonist, a nitric oxide synthase inhibitor, an antioxidant, and an antidote to paracetamol poisoning. CID:657298 https://www.mayoclinic.org/drugs-supplements/propylthiouracil-oral-route/description/drg-20072978 This is any condition in which the main influencing factor is protamine sulfate, an anti-heparin drug used to reverse the anti-coagulant effects of heparin. Protamine sulfate effects the reversal heparin activity predominantly via the formation of an inactive complex between the anionic heparin and its own cationic state. slaulederkind 2025-03-24T15:37:04Z CAS:9009-65-8 CID:76429668 PMID:39252992 1-[3-(Hydroxymethyl)-1,4-dioxo-2,3,6,7,8,8a-hexahydropyrrolo[1,2-a]pyrazin-7-yl]-3-(1-phenylethyl)urea experimental_condition_ontology XCO:0001562 protamine sulfate This is any condition in which the main influencing factor is protamine sulfate, an anti-heparin drug used to reverse the anti-coagulant effects of heparin. Protamine sulfate effects the reversal heparin activity predominantly via the formation of an inactive complex between the anionic heparin and its own cationic state. https://en.wikipedia.org/wiki/Protamine_sulfate https://go.drugbank.com/drugs/DB09141 This is any condition in which the main influencing factor is zymosan, a protein-carbohydrate complex derived from yeast cell walls. Zymosan induces experimental sterile inflammation and activates macrophages by binding to TLR2 and Dectin-1 receptors. Joint injection of zymosan induces arthritis in experimental animals to create a model of chronic proliferative arthritis. slaulederkind 2025-03-24T16:24:53Z MESH:D015054 PMID:39252992 experimental_condition_ontology XCO:0001563 zymosan This is any condition in which the main influencing factor is zymosan, a protein-carbohydrate complex derived from yeast cell walls. Zymosan induces experimental sterile inflammation and activates macrophages by binding to TLR2 and Dectin-1 receptors. Joint injection of zymosan induces arthritis in experimental animals to create a model of chronic proliferative arthritis. PMID:911357 https://en.wikipedia.org/wiki/Zymosan This is any condition in which the main influencing factor is any maternal exposure to perfluorohexane sulfonate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) perfluorohexane sulfonate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-03-25T11:21:44Z CID:23678874 GEO:GSE262750 PMID:38963985 multigenerational maternal exposure to perfluorohexanesulfonate multigenerational maternal exposure to potassium perfluorohexanesulfonate experimental_condition_ontology XCO:0001564 multigenerational maternal exposure to perfluorohexane sulfonate This is any condition in which the main influencing factor is any maternal exposure to perfluorohexane sulfonate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) perfluorohexane sulfonate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to perfluorohexane sulfonate. This is a condition typically studied to determine the effect of maternal (F0) perfluorohexane sulfonate use/exposure on the F1 offspring. slaulederkind 2025-03-25T11:27:51Z CID:23678874 GEO:GSE262750 PMID:38963985 gestational maternal exposure to perfluorohexanesulfonate maternal exposure to perfluorohexane sulfonate during pregnancy gestational maternal exposure to potassium perfluorohexanesulfonate experimental_condition_ontology XCO:0001565 gestational maternal exposure to perfluorohexane sulfonate This is any condition in which the main influencing factor is any gestational maternal exposure to perfluorohexane sulfonate. This is a condition typically studied to determine the effect of maternal (F0) perfluorohexane sulfonate use/exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to perfluorohexane sulfonate during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) perfluorohexane sulfonate use/exposure during the postnatal, preweaning period on the F1 offspring. slaulederkind 2025-03-25T12:49:32Z CID:23678874 GEO:GSE262750 PMID:38963985 maternal exposure to perfluorohexanesulfonate maternal exposure to potassium perfluorohexanesulfonate experimental_condition_ontology XCO:0001566 maternal exposure to perfluorohexane sulfonate during nursing This is any condition in which the main influencing factor is any maternal exposure to perfluorohexane sulfonate during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) perfluorohexane sulfonate use/exposure during the postnatal, preweaning period on the F1 offspring. https://www.merriam-webster.com This is any condition in which the main influencing factor is any maternal exposure to 6-propyl-2-thiouracil that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) 6-propyl-2-thiouracil use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-03-25T13:05:17Z CHEBI:8502 CID:657298 GEO:GSE262750 MESH:D011441 PMID:38963985 multigenerational maternal exposure to PTU multigenerational maternal exposure to propylthiouracil experimental_condition_ontology XCO:0001567 multigenerational maternal exposure to 6-propyl-2-thiouracil This is any condition in which the main influencing factor is any maternal exposure to 6-propyl-2-thiouracil that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) 6-propyl-2-thiouracil use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to 6-propyl-2-thiouracil. This is a condition typically studied to determine the effect of maternal (F0) 6-propyl-2-thiouracil use/exposure on the F1 offspring. slaulederkind 2025-03-25T13:11:27Z CHEBI:8502 GEO:GSE262750 MESH:D011441 PMID:38963985 gestational maternal exposure to PTU gestational maternal exposure to propylthiouracil maternal exposure to 6-propyl-2-thiouracil during pregnancy experimental_condition_ontology XCO:0001568 gestational maternal exposure to 6-propyl-2-thiouracil This is any condition in which the main influencing factor is any gestational maternal exposure to 6-propyl-2-thiouracil. This is a condition typically studied to determine the effect of maternal (F0) 6-propyl-2-thiouracil use/exposure on the F1 offspring. CID:657298 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to 6-propyl-2-thiouracil during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) 6-propyl-2-thiouracil use/exposure during the postnatal, preweaning period on the F1 offspring. slaulederkind 2025-03-25T13:26:20Z CHEBI:8502 GEO:GSE262750 MESH:D011441 PMID:38963985 maternal exposure to PTU during nursing maternal exposure to propylthiouracil during nursing experimental_condition_ontology XCO:0001569 maternal exposure to 6-propyl-2-thiouracil during nursing This is any condition in which the main influencing factor is any maternal exposure to 6-propyl-2-thiouracil during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) 6-propyl-2-thiouracil use/exposure during the postnatal, preweaning period on the F1 offspring. CID:657298 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to controlled air E-cigarette/nicotine aerosol content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) controlled air E-cigarette/nicotine (~2.4%) aerosol content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-03-27T11:27:19Z GEO:GSE278792 PMID:39414906 multigenerational maternal CIEC exposure multigenerational maternal chronic intermittent e-cigarette exposure multigenerational maternal exposure to controlled air E-cigarette nicotine aerosol content multigenerational maternal exposure to controlled air e-cig aerosol content multigenerational maternal exposure to controlled air BluPlus e-cig aerosol content experimental_condition_ontology XCO:0001570 multigenerational maternal exposure to controlled air E-cigarette aerosol content This is any condition in which the main influencing factor is any maternal exposure to controlled air E-cigarette/nicotine aerosol content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) controlled air E-cigarette/nicotine (~2.4%) aerosol content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to controlled air E-cigarette/nicotine aerosol content. This is a condition typically studied to determine the effect of maternal (F0) controlled air E-cigarette/nicotine (~2.4%) content exposure on the F1 offspring. slaulederkind 2025-03-27T12:19:09Z gestational maternal CIEC exposure gestational maternal chronic intermittent e-cigarette exposure gestational maternal exposure to controlled air E-cigarette nicotine aerosol content maternal exposure to controlled air E-cigarette aerosol content during pregnancy gestational maternal exposure to controlled air BluPlus e-cig aerosol content experimental_condition_ontology XCO:0001571 gestational maternal exposure to controlled air E-cigarette aerosol content This is any condition in which the main influencing factor is any gestational maternal exposure to controlled air E-cigarette/nicotine aerosol content. This is a condition typically studied to determine the effect of maternal (F0) controlled air E-cigarette/nicotine (~2.4%) content exposure on the F1 offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is 2,2',5,5'-tetrachlorobiphenyl, a tetrachlorobiphenyl that is biphenyl in which the hydrogens at the 2 and 5 position of each benzene ring are replaced by chlorines. slaulederkind 2025-03-31T13:04:18Z CID:37248 GEO:GSE246555 MESH:C009407 PMID:39369937 1,1'-Biphenyl, 2,2',5,5'-tetrachloro- 2,2',5,5'-tetrachloro-1,1'-biphenyl PCB-52 PCB52 experimental_condition_ontology XCO:0001572 2,2',5,5'-tetrachlorobiphenyl This is any condition in which the main influencing factor is 2,2',5,5'-tetrachlorobiphenyl, a tetrachlorobiphenyl that is biphenyl in which the hydrogens at the 2 and 5 position of each benzene ring are replaced by chlorines. CHEBI:34206 MESH:C009407 This is any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to the subthalamic nucleus. This is done with implanted electrode(s). slaulederkind 2025-04-03T16:28:04Z brain stimulation via implanted electrode PMID:39481497 STN stimulation via implanted electrode experimental_condition_ontology XCO:0001573 subthalamic nucleus stimulation via implanted electrode This is any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to the subthalamic nucleus. This is done with implanted electrode(s). PMID:28470693 http://braininfo.rprc.washington.edu/Default.aspx This is any condition in which the main influencing factor is an subthalamic nucleus implanted electrode sham procedure, which follows the same surgical process as a subthalamic nucleus implanted electrode procedure, but no electrical stimulus is delivered. slaulederkind 2025-04-03T17:05:06Z PMID:28470693 STN implanted electrode sham procedure experimental_condition_ontology XCO:0001574 subthalamic nucleus implanted electrode sham procedure This is any condition in which the main influencing factor is an subthalamic nucleus implanted electrode sham procedure, which follows the same surgical process as a subthalamic nucleus implanted electrode procedure, but no electrical stimulus is delivered. PMID:39481497 http://braininfo.rprc.washington.edu/Default.aspx This is any condition in which the main influencing factor is a gene transfer performed using an adeno-associated virus as the carrier of the genetic material. An adeno-associated virus is a small, non-enveloped, single-stranded DNA virus that is replication-deficient, i.e. it needs a helper virus to replicate. AAV is a promising vector for gene therapy due to its ability to infect both dividing and non-dividing cells, its low immunogenicity, and its ability to mediate long-term expression without integrating into the host genome. slaulederkind 2025-04-03T17:48:26Z PMID:39481497 gene transduction using AAV vector gene transduction using an adeno-associated virus vector gene transfer using AAV vector experimental_condition_ontology XCO:0001575 gene transfer using an adeno-associated virus vector This is any condition in which the main influencing factor is a gene transfer performed using an adeno-associated virus as the carrier of the genetic material. An adeno-associated virus is a small, non-enveloped, single-stranded DNA virus that is replication-deficient, i.e. it needs a helper virus to replicate. AAV is a promising vector for gene therapy due to its ability to infect both dividing and non-dividing cells, its low immunogenicity, and its ability to mediate long-term expression without integrating into the host genome. https://www.bio-techne.com/resources/blogs/how-adenovirus-and-adeno-associated-virus-work-as-gene-therapy-vectors https://www.vectorbiolabs.com/adenovirus-vs-aav/ This is any condition in which the main influencing factor is gene transfer of the human A53T α-synuclein gene using an AAV1/2 hybrid virus vector. A53T α-synuclein is a mutant form of the human synuclein alpha (SNCA) gene. slaulederkind 2025-04-03T18:08:36Z PMID:39481497 gene transduction of the human A53T α-synuclein gene using an AAV1/2 hybrid virus vector gene transfer of the human A53T SNCA gene using an AAV1/2 hybrid virus vector experimental_condition_ontology XCO:0001576 gene transfer of the human A53T α-synuclein gene using an AAV1/2 hybrid virus vector This is any condition in which the main influencing factor is gene transfer of the human A53T α-synuclein gene using an AAV1/2 hybrid virus vector. A53T α-synuclein is a mutant form of the human synuclein alpha (SNCA) gene. PMID:_28143577 https://www.bio-techne.com/resources/blogs/how-adenovirus-and-adeno-associated-virus-work-as-gene-therapy-vectors This is any condition in which the main influencing factor is an empty AAV1/2 hybrid virus vector that has been transferred into a cell or organism. This condition is used as a control for a AAV1/2 hybrid virus transfer of a specific gene. slaulederkind 2025-04-03T18:26:16Z PMID:39481497 sham gene transfer using an AAV1/2 hybrid virus EV sham gene transfer using an AAV1/2 hybrid virus empty vector experimental_condition_ontology XCO:0001577 sham gene transfer using an empty AAV1/2 hybrid virus vector This is any condition in which the main influencing factor is an empty AAV1/2 hybrid virus vector that has been transferred into a cell or organism. This condition is used as a control for a AAV1/2 hybrid virus transfer of a specific gene. PMID:28143577 https://www.vectorbiolabs.com/adenovirus-vs-aav/ This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet. A CSAA diet is often used as a control diet in studies investigating the effects of choline deficiency on liver health, particularly in models of non-alcoholic fatty liver disease (NAFLD). slaulederkind 2025-04-04T18:03:47Z PMID:39562169 PMID:40029260 CSAA diet experimental_condition_ontology XCO:0001578 choline‐sufficient, amino acid‐defined diet This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet. A CSAA diet is often used as a control diet in studies investigating the effects of choline deficiency on liver health, particularly in models of non-alcoholic fatty liver disease (NAFLD). PMID:36062292 This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet with controlled resveratrol content. slaulederkind 2025-04-04T18:15:53Z PMID:40029260 controlled resveratrol content, choline‐sufficient, amino acid‐defined diet experimental_condition_ontology XCO:0001579 controlled resveratrol content, CSAA diet This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet with controlled resveratrol content. PMID:39562169 https://www.merriam-webster.com This is any condition in which the main influencing factor is pterostilbene, a polyphenol which is an antioxidant, antineoplastic agent, and anti-inflammatory agent. slaulederkind 2025-04-04T18:42:28Z CHEBI:8630 MESH:C107773 PMID:39562169 PMID:40029260 4-[(E)-2-(3,5-dimethoxyphenyl)ethenyl]phenol experimental_condition_ontology XCO:0001580 pterostilbene This is any condition in which the main influencing factor is pterostilbene, a polyphenol which is an antioxidant, antineoplastic agent, and anti-inflammatory agent. CID:5281727 This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet with controlled pterostilbene content. slaulederkind 2025-04-15T17:11:17Z PMID:40029260 controlled pterostilbene content, choline‐sufficient, amino acid‐defined diet experimental_condition_ontology XCO:0001581 controlled pterostilbene content, CSAA diet This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet with controlled pterostilbene content. PMID:39562169 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is chlorogenic acid, a cinnamate ester obtained by formal condensation of the carboxy group of trans-caffeic acid with the 3-hydroxy group of quinic acid. It is an investigational drug for its anti-inflammatory, anti-cancer, anti-diabetic, and other medicinal properties. slaulederkind 2025-04-17T13:06:34Z CHEBI:16112 MESH:D002726 PMID:39562169 (1S,3R,4R,5R)-3-{[(2E)-3-(3,4-Dihydroxyphenyl)prop-2-enoyl]oxy}-1,4,5-trihydroxycyclohexane-1-carboxylic acid 3-CQA CGA experimental_condition_ontology XCO:0001582 chlorogenic acid This is any condition in which the main influencing factor is chlorogenic acid, a cinnamate ester obtained by formal condensation of the carboxy group of trans-caffeic acid with the 3-hydroxy group of quinic acid. It is an investigational drug for its anti-inflammatory, anti-cancer, anti-diabetic, and other medicinal properties. CID:1794427 PMID:29080460 This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet with controlled chlorogenic acid content. slaulederkind 2025-04-17T13:25:39Z CHEBI:16112 MESH:D002726 PMID:39562169 controlled 3-CQA content, CSAA diet controlled CGA content, CSAA diet experimental_condition_ontology XCO:0001583 controlled chlorogenic acid content, CSAA diet This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet with controlled chlorogenic acid content. CID:1794427 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to dimethyl sulfoxide that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) dimethyl sulfoxide use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-04-17T18:43:58Z PMID:39652430 multigenerational maternal exposure to DMSO experimental_condition_ontology XCO:0001584 multigenerational maternal exposure to dimethyl sulfoxide This is any condition in which the main influencing factor is any maternal exposure to dimethyl sulfoxide that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) dimethyl sulfoxide use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to dimethyl sulfoxide. This is a condition typically studied to determine the effect of maternal (F0) dimethyl sulfoxide use/exposure on the F1 offspring. slaulederkind 2025-04-18T10:55:22Z PMID:39652430 gestational maternal exposure to DMSO maternal exposure to dimethyl sulfoxide during pregnancy experimental_condition_ontology XCO:0001585 gestational maternal exposure to dimethyl sulfoxide This is any condition in which the main influencing factor is any gestational maternal exposure to dimethyl sulfoxide. This is a condition typically studied to determine the effect of maternal (F0) dimethyl sulfoxide use/exposure on the F1 offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is 2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester, an indolyl carboxylic acid. slaulederkind 2025-04-18T11:08:38Z CHEBI:93059 2-(1H-Indol-3-ylcarbonyl)-4-thiazolecarboxylic acid methyl ester ITE methyl 2-(1H-indol-3-ylcarbonyl)-1,3-thiazole-4-carboxylate methyl 2-(1H-indole-3-carbonyl)-1,3-thiazole-4-carboxylate experimental_condition_ontology XCO:0001586 2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester This is any condition in which the main influencing factor is 2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester, an indolyl carboxylic acid. CHEBI:93059 This is any condition in which the main influencing factor is any maternal exposure to ITE (2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester) that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) ITE use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-04-18T11:53:22Z PMID:39652430 multigenerational maternal exposure to 2-(1H-Indol-3-ylcarbonyl)-4-thiazolecarboxylic acid methyl ester multigenerational maternal exposure to 2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester multigenerational maternal exposure to methyl 2-(1H-indol-3-ylcarbonyl)-1,3-thiazole-4-carboxylate multigenerational maternal exposure to methyl 2-(1H-indole-3-carbonyl)-1,3-thiazole-4-carboxylate experimental_condition_ontology XCO:0001587 multigenerational maternal exposure to ITE This is any condition in which the main influencing factor is any maternal exposure to ITE (2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester) that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) ITE use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to ITE (2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester). This is a condition typically studied to determine the effect of maternal (F0) ITE use/exposure on the F1 offspring. slaulederkind 2025-04-18T12:15:35Z PMID:39652430 gestational maternal exposure to 2-(1H-Indol-3-ylcarbonyl)-4-thiazolecarboxylic acid methyl ester gestational maternal exposure to 2-(1H-indol-3-ylcarbonyl)-1,3-thiazole-4-carboxylate gestational maternal exposure to 2-(1H-indole-3-carbonyl)-1,3-thiazole-4-carboxylate gestational maternal exposure to 2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester maternal exposure to ITE during pregnancy experimental_condition_ontology XCO:0001588 gestational maternal exposure to ITE This is any condition in which the main influencing factor is any gestational maternal exposure to ITE (2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester). This is a condition typically studied to determine the effect of maternal (F0) ITE use/exposure on the F1 offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is lung ischemia/reperfusion, an experimental surgical procedure which involves clamping/releasing of the pulmonary hilum on one side of the lungs. Blood vessels, nerves, and bronchi pass through the hilum to all the lobes of the lungs. slaulederkind 2025-04-18T13:52:23Z LIRI experimental_condition_ontology I-post-C XCO:0001589 lung ischemia/reperfusion This is any condition in which the main influencing factor is lung ischemia/reperfusion, an experimental surgical procedure which involves clamping/releasing of the pulmonary hilum on one side of the lungs. Blood vessels, nerves, and bronchi pass through the hilum to all the lobes of the lungs. PMID:39655220 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a lung ischemia/reperfusion sham procedure, which follows the same surgical process as an lung ischemia/reperfusion procedure without blocking the pulmonary hilum. slaulederkind 2025-04-18T14:15:30Z LIRI sham procedure experimental_condition_ontology I-post-C sham procedure XCO:0001590 lung ischemia/reperfusion sham procedure This is any condition in which the main influencing factor is a lung ischemia/reperfusion sham procedure, which follows the same surgical process as an lung ischemia/reperfusion procedure without blocking the pulmonary hilum. PMID:39655220 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is scar resection after healing of an experimental transection of the rat spinal cord at the vertebral level of thoracic 10/11 (T10/11). This procedure involves laminectomy of the tenth vertebra and complete transection of the isolated section of spinal cord. This procedure is followed by resection of the center (~1 mm) of the scar tissue formed (by ~ day 42) in the gap created by the transection. slaulederkind 2025-04-24T11:05:37Z experimental SCI scar resection experimental SSCI scar resection experimental spinal cord injury scar resection experimental suprasacral spinal cord injury scar resection experimental_condition_ontology XCO:0001591 experimental T10/T11 spinal cord transection/scar resection This is any condition in which the main influencing factor is scar resection after healing of an experimental transection of the rat spinal cord at the vertebral level of thoracic 10/11 (T10/11). This procedure involves laminectomy of the tenth vertebra and complete transection of the isolated section of spinal cord. This procedure is followed by resection of the center (~1 mm) of the scar tissue formed (by ~ day 42) in the gap created by the transection. PMID:39733145 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is implantation of a porcine, decellularized, extracellular matrix (dECM) hydrogel scaffold, a tissue scaffold made of decellularized, extracellular matrix from porcine kidney. dECM hydrogel has been utilized for experimental nerve regeneration, spinal cord injury repair, and resected kidney defect repair. slaulederkind 2025-04-24T11:35:37Z PMID:39276103 PMID:40878515 pig dECM hydrogel implantation porcine decellularized extracellular matrix hydrogel implantation experimental_condition_ontology XCO:0001592 porcine dECM hydrogel implantation This is any condition in which the main influencing factor is implantation of a porcine, decellularized, extracellular matrix (dECM) hydrogel scaffold, a tissue scaffold made of decellularized, extracellular matrix from porcine kidney. dECM hydrogel has been utilized for experimental nerve regeneration, spinal cord injury repair, and resected kidney defect repair. ISBN-13:978-1455756438 This is any condition in which the main influencing factor is an injection or infusion of human neural stem/progenitor cells (hNS/PCs) derived from human induced pluripotent stem cells. slaulederkind 2025-04-24T12:22:39Z human iPS cell-derived neural stem/progenitor cells human induced pluripotent stem cell-derived hNS/PCs human induced pluripotent stem cell-derived neural stem/progenitor cells experimental_condition_ontology XCO:0001593 neural stem progenitor cell human iPS cell-derived hNS/PCs This is any condition in which the main influencing factor is an injection or infusion of human neural stem/progenitor cells (hNS/PCs) derived from human induced pluripotent stem cells. PMID:39733145 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is aluminium hydroxide, an antacid used for the symptomatic relief of heartburn. Aluminium hydroxide is also used in other applications: as an antiperspirant, as an emulsifier, in dentifrices, as an adjuvant in bacterins and vaccines, in water purification, etc. slaulederkind 2025-04-25T14:00:53Z CHEBI:33130 PMID:34367159 Al(OH)3 aluminium(III) hydroxide trihydroxidoaluminium experimental_condition_ontology XCO:0001594 aluminium hydroxide This is any condition in which the main influencing factor is aluminium hydroxide, an antacid used for the symptomatic relief of heartburn. Aluminium hydroxide is also used in other applications: as an antiperspirant, as an emulsifier, in dentifrices, as an adjuvant in bacterins and vaccines, in water purification, etc. MESH:D000536 https://go.drugbank.com/drugs/DB06723 This is any condition in which the main influencing factor is Mengovirus, a single-stranded RNA virus that belongs to the genus Cardiovirus. The Mengovirus infects vertebrates and is able to suppress the host's immune response by reducing the expression of Nuclear Factor kappa B. slaulederkind 2025-04-25T15:24:02Z PMID:34367159 Columbia SK virus Mengo virus mouse Elberfield virus vMC0 (attenuated) experimental_condition_ontology XCO:0001595 Mengovirus This is any condition in which the main influencing factor is Mengovirus, a single-stranded RNA virus that belongs to the genus Cardiovirus. The Mengovirus infects vertebrates and is able to suppress the host's immune response by reducing the expression of Nuclear Factor kappa B. https://en.wikipedia.org/wiki/Mengovirus This is any condition in which the main influencing factor is OM-85, an immunostimulanting combination of molecules extracted from the walls of bacteria that commonly cause respiratory infections. OM-85 can enhance immunity by promoting the maturation of dendritic cells in the gastrointestinal Peyer's patches, which in turn strengthens immune defenses in the lung. slaulederkind 2025-04-25T15:59:11Z PMID:34367159 OM85 Broncho-Vaxom experimental_condition_ontology XCO:0001596 OM-85 This is any condition in which the main influencing factor is OM-85, an immunostimulanting combination of molecules extracted from the walls of bacteria that commonly cause respiratory infections. OM-85 can enhance immunity by promoting the maturation of dendritic cells in the gastrointestinal Peyer's patches, which in turn strengthens immune defenses in the lung. PMID:35985019 https://en.wikipedia.org/wiki/OM-85# This is any condition in which the main influencing factor is any maternal exposure to valproate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) valproate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-04-25T17:20:59Z CHEBI:60654 PMID:33712455 multigenerational maternal exposure to 2-propylpentanoate multigenerational maternal exposure to VPA experimental_condition_ontology XCO:0001597 multigenerational maternal exposure to valproate This is any condition in which the main influencing factor is any maternal exposure to valproate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) valproate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to valproate. This is a condition typically studied to determine the effect of maternal (F0) valproate use/exposure on the F1 offspring. slaulederkind 2025-04-25T17:24:58Z CHEBI:60654 PMID:33712455 gestational maternal exposure to 2-propylpentanoate gestational maternal exposure to VPA maternal exposure to 2-propylpentanoate during pregnancy maternal exposure to VPA during pregnancy maternal exposure to valproate during pregnancy experimental_condition_ontology XCO:0001598 gestational maternal exposure to valproate This is any condition in which the main influencing factor is any gestational maternal exposure to valproate. This is a condition typically studied to determine the effect of maternal (F0) valproate use/exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is TAK-418, a selective, orally active lysine demethylase 1A (KDM1A) enzyme inhibitor. TAK-418 is used to treat autism symptoms in animal models of neurodevelopmental disorders . slaulederkind 2025-04-25T17:42:11Z CAS:1818252-53-7 CID:118432651 LVM0PK6IHG experimental_condition_ontology XCO:0001599 TAK-418 This is any condition in which the main influencing factor is TAK-418, a selective, orally active lysine demethylase 1A (KDM1A) enzyme inhibitor. TAK-418 is used to treat autism symptoms in animal models of neurodevelopmental disorders . CHEBI:230499 This is any condition in which the main influencing factor is citrate salt, a salt of citric acid. slaulederkind 2025-04-25T18:11:42Z CID:31348 citrate citrate salts citrate(3-) citrates experimental_condition_ontology XCO:0001600 citrate salt This is any condition in which the main influencing factor is citrate salt, a salt of citric acid. CHEBI:50744 This is any condition in which the main influencing factor is JNK-IN-5A, an inhibitor of JNK2 (MAPK9/mitogen-activated protein kinase 9), JNK3 (MAPK10/mitogen-activated protein kinase 10) and other mitogen-activated protein kinases. slaulederkind 2025-04-29T16:57:43Z CHEBI:91453 CID:766949 PMID:39932177 JNK Inhibitor IX N-(3-cyano-4,5,6,7-tetrahydro-1-benzothiophen-2-yl)-1-naphthalenecarboxamide TCS JNK 5a experimental_condition_ontology XCO:0001601 JNK-IN-5A This is any condition in which the main influencing factor is JNK-IN-5A, an inhibitor of JNK2 (MAPK9/mitogen-activated protein kinase 9), JNK3 (MAPK10/mitogen-activated protein kinase 10) and other mitogen-activated protein kinases. https://www.rndsystems.com/products/tcs-jnk-5a_2827 This is any condition in which the main influencing factor is dehydration, which occurs when a subject's body loses more fluids than it takes in, leading to a state where it doesn't have enough water and other fluids to function properly. In experimental animals dehydration may be used as a kidney stressor. slaulederkind 2025-05-01T10:58:22Z MP:0001429 PMID:35910780 lack of hydration experimental_condition_ontology XCO:0001602 dehydration This is any condition in which the main influencing factor is dehydration, which occurs when a subject's body loses more fluids than it takes in, leading to a state where it doesn't have enough water and other fluids to function properly. In experimental animals dehydration may be used as a kidney stressor. https://www.kidney.org/news-stories/can-dehydration-affect-your-kidneys https://www.mayoclinic.org/diseases-conditions/dehydration/symptoms-causes/syc-20354086 This is any condition in which the main influencing factor is icariin, a flavonoid compound found in plants of the genus Epimedium. Icarin is the major flavonoid responsible for the pharmacological actions of Epimedii Herb, used in traditional Chinese medicine. slaulederkind 2025-05-01T11:19:57Z CHEBI:78420 CID:5318997 MESH:C056599 3-[(6-deoxy-alpha-L-mannopyranosyl)oxy]-5-hydroxy-2-(4-methoxyphenyl)-8-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-7-yl beta-D-glucopyranoside 7-(β-D-Glucopyranosyloxy)-5-hydroxy-4′-methoxy-8-(3-methylbut-2-en-1-yl)-3-(α-L-rhamnopyranosyloxy)flavone experimental_condition_ontology XCO:0001603 icariin This is any condition in which the main influencing factor is icariin, a flavonoid compound found in plants of the genus Epimedium. Icarin is the major flavonoid responsible for the pharmacological actions of Epimedii Herb, used in traditional Chinese medicine. PMID:35910780 https://en.wikipedia.org/wiki/Icariin This is any condition in which the main influencing factor is any maternal exposure to controlled fat content diet that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) controlled fat content diet on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-05-01T12:49:21Z experimental_condition_ontology XCO:0001604 multigenerational maternal exposure to controlled fat content diet This is any condition in which the main influencing factor is any maternal exposure to controlled fat content diet that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) controlled fat content diet on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any pregestational maternal exposure to a controlled fat content diet. This is a condition typically studied to determine the effect of a maternal (F0) controlled fat content diet on the F1 offspring. slaulederkind 2025-05-01T13:03:12Z maternal exposure to a controlled fat content diet prior to a pregnancy experimental_condition_ontology XCO:0001605 pregestational maternal exposure to controlled fat content diet This is any condition in which the main influencing factor is any pregestational maternal exposure to a controlled fat content diet. This is a condition typically studied to determine the effect of a maternal (F0) controlled fat content diet on the F1 offspring. PMID:29972240 https://www.merriam-webster.com This is any condition in which the main influencing factor is any maternal exposure to a controlled fat content diet during nursing of offspring. This is a condition typically studied to determine the effect of a maternal (F0) controlled fat content diet exposure during the postnatal, preweaning period on the F1 offspring. slaulederkind 2025-05-01T13:38:20Z PMID:29972240 maternal exposure to a controlled fat content diet during nursing of offspring experimental_condition_ontology XCO:0001606 maternal exposure to controlled fat content diet during nursing This is any condition in which the main influencing factor is any maternal exposure to a controlled fat content diet during nursing of offspring. This is a condition typically studied to determine the effect of a maternal (F0) controlled fat content diet exposure during the postnatal, preweaning period on the F1 offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to a controlled fat content diet. This is a condition typically studied to determine the effect of a maternal (F0) controlled fat content diet on the F1 offspring. slaulederkind 2025-05-01T13:48:42Z PMID:29972240 maternal exposure to a controlled fat content diet during pregnancy experimental_condition_ontology XCO:0001607 gestational maternal exposure to controlled fat content diet This is any condition in which the main influencing factor is any gestational maternal exposure to a controlled fat content diet. This is a condition typically studied to determine the effect of a maternal (F0) controlled fat content diet on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to a standard rat chow diet that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) standard rat chow diet on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-05-01T14:35:31Z multigenerational maternal exposure to control diet PMID:29972240 multigenerational maternal exposure to standard rat diet experimental_condition_ontology XCO:0001608 multigenerational maternal exposure to standard rat chow diet This is any condition in which the main influencing factor is any maternal exposure to a standard rat chow diet that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) standard rat chow diet on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to standard rat chow. This is a condition typically studied to determine the effect of maternal (F0) standard rat chow diet on the F1 offspring. slaulederkind 2025-05-01T14:47:45Z PMID:29972240 maternal exposure to a standard rat chow diet during pregnancy experimental_condition_ontology XCO:0001609 gestational maternal exposure to standard rat chow diet This is any condition in which the main influencing factor is any gestational maternal exposure to standard rat chow. This is a condition typically studied to determine the effect of maternal (F0) standard rat chow diet on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to standard rat chow diet during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) standard rat chow diet exposure during the postnatal, preweaning period on the F1 offspring. slaulederkind 2025-05-01T14:57:58Z PMID:29972240 maternal exposure to a standard rat chow diet during nursing of offspring experimental_condition_ontology XCO:0001610 maternal exposure to standard rat chow diet during nursing This is any condition in which the main influencing factor is any maternal exposure to standard rat chow diet during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) standard rat chow diet exposure during the postnatal, preweaning period on the F1 offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any pregestational maternal exposure to a standard rat chow diet. This is a condition typically studied to determine the effect of a maternal (F0) standard rat chow diet on the F1 offspring. slaulederkind 2025-05-01T15:05:39Z pregestational maternal exposure to control diet PMID:29972240 pregestational maternal exposure to standard rat chow experimental_condition_ontology XCO:0001611 pregestational maternal exposure to standard rat chow diet This is any condition in which the main influencing factor is any pregestational maternal exposure to a standard rat chow diet. This is a condition typically studied to determine the effect of a maternal (F0) standard rat chow diet on the F1 offspring. https://www.merriam-webster.com This is any condition in which the main influencing factor is cinacalcet, a secondary amino compound that is a member of the naphthalenes and the trifluoromethyl)benzenes. Cinacalcet is a calcium sensing receptor (CASR) agonist and a P450 inhibitor. slaulederkind 2025-05-02T12:04:03Z CHEBI:48390 MESH:D000069449 N-[(1R)-1-(1-naphthyl)ethyl]-3-[3-(trifluoromethyl)phenyl]propan-1-amine experimental_condition_ontology XCO:0001612 cinacalcet This is any condition in which the main influencing factor is cinacalcet, a secondary amino compound that is a member of the naphthalenes and the trifluoromethyl)benzenes. Cinacalcet is a calcium sensing receptor (CASR) agonist and a P450 inhibitor. CID:156419 This is any condition in which the main influencing factor is recombinant alteplase, a biosynthetic form of human tissue-type plasminogen activator (t-PA). Alteplase is an anticoagulant which converts plasminogen to plasmin (fibrinolysin). slaulederkind 2025-05-05T13:56:45Z DrugBank:DB00009 recombinant PLAT recombinant plasminogen activator, tissue type recombinant t-PA rt-PA tissue-type plasminogen activator Actilyse Activase experimental_condition_ontology XCO:0001613 recombinant alteplase This is any condition in which the main influencing factor is recombinant alteplase, a biosynthetic form of human tissue-type plasminogen activator (t-PA). Alteplase is an anticoagulant which converts plasminogen to plasmin (fibrinolysin). MESH:D010959 https://en.wikipedia.org/wiki/Alteplase This is any condition in which the main influencing factor is urokinase-loaded nano-patrols, which are mesoporous polydopamine nanoparticles which have been loaded with human urokinase and coated with three different single-stranded DNAs to function as thrombin aptamers, pore sealers, and release biomarkers. These specialized nanoparticles are used for regulating therapeutic urokinase dose based on the in vivo thrombolysis resistance of thrombi. slaulederkind 2025-05-05T16:09:21Z CHEBI:50803 PMID:34078604 uPA-loaded nano-patrols urokinase-loaded mesoporous polydopamine nanoparticles uPA-loaded mesoporous polydopamine nanoparticles uPA-loaded pDA nanoparticles experimental_condition_ontology XCO:0001614 urokinase-loaded nano-patrols This is any condition in which the main influencing factor is urokinase-loaded nano-patrols, which are mesoporous polydopamine nanoparticles which have been loaded with human urokinase and coated with three different single-stranded DNAs to function as thrombin aptamers, pore sealers, and release biomarkers. These specialized nanoparticles are used for regulating therapeutic urokinase dose based on the in vivo thrombolysis resistance of thrombi. PMID:39823346 This is any condition in which the main influencing factor is aluminium hydroxide, an inorganic salt used as an antacid. Aluminium hydroxide is a basic compound that acts by neutralizing hydrochloric acid in gastric secretions. slaulederkind 2025-05-06T14:54:56Z CHEBI:33130 MESH:D000536 Al(OH)3 aluminium hydroxide aluminium(3+) hydroxide aluminium(III) hydroxide aluminum hydrate hydrated alumina trihydroxidoaluminium experimental_condition_ontology XCO:0001615 aluminum hydroxide This is any condition in which the main influencing factor is aluminium hydroxide, an inorganic salt used as an antacid. Aluminium hydroxide is a basic compound that acts by neutralizing hydrochloric acid in gastric secretions. CID:10176082 This is any condition in which the main influencing factor is partial body near-infrared laser irradiation, which is exposure to laser-emitted, electromagnetic radiation with wavelengths ranging from 750 to 2500 nm. Near-infrared electromagnetic radiation may be used analytically or as part of a therapeutic process. slaulederkind 2025-05-08T15:10:09Z PMID:39823346 partial body NIR laser irradiation experimental_condition_ontology XCO:0001616 partial body near-infrared laser irradiation This is any condition in which the main influencing factor is partial body near-infrared laser irradiation, which is exposure to laser-emitted, electromagnetic radiation with wavelengths ranging from 750 to 2500 nm. Near-infrared electromagnetic radiation may be used analytically or as part of a therapeutic process. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is partial body near-infrared II laser irradiation, which is exposure to laser-emitted, electromagnetic radiation with wavelengths ranging from 1000 to 1700 nm. Near-infrared II electromagnetic radiation may be used analytically or as part of a therapeutic process. slaulederkind 2025-05-08T15:19:05Z PMID:39823346 partial body NIR 2 laser irradiation partial body NIR-II laser irradiation experimental_condition_ontology XCO:0001617 partial body near-infrared II laser irradiation This is any condition in which the main influencing factor is partial body near-infrared II laser irradiation, which is exposure to laser-emitted, electromagnetic radiation with wavelengths ranging from 1000 to 1700 nm. Near-infrared II electromagnetic radiation may be used analytically or as part of a therapeutic process. PMID:32083067 PMID:37596326 This is any condition in which the main influencing factor is filtered air, which is air cleared of particulate matter or other pollutants. This is a control condition for the study of various air pollutants. slaulederkind 2025-05-09T17:05:17Z cleaned air cleared air experimental_condition_ontology XCO:0001618 filtered air This is any condition in which the main influencing factor is filtered air, which is air cleared of particulate matter or other pollutants. This is a control condition for the study of various air pollutants. GSE:242155 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is diesel exhaust particles, a component of ambient air pollution. The level of diesel exhaust particles in the air surrounding an organism or breathed by an organism is determined by environmental conditions, work conditions, or controlled as part of an experiment. slaulederkind 2025-05-09T17:22:30Z controlled air DEP content controlled air DPM content controlled air diesel particle content controlled air diesel particulate matter content experimental_condition_ontology XCO:0001619 controlled air diesel exhaust particle content This is any condition in which the main influencing factor is diesel exhaust particles, a component of ambient air pollution. The level of diesel exhaust particles in the air surrounding an organism or breathed by an organism is determined by environmental conditions, work conditions, or controlled as part of an experiment. GSE:242155 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is Yuanhu Zhitong Prescription, a traditional Chinese medicine (TCM) formula used for pain relief. The main ingredients of Yuanhu Zhitong Prescription are Radix angelicae dahuricae (white angelica root) and Rhizoma corydalis (gold thread rhizome). slaulederkind 2025-05-13T16:03:29Z PMID:38729540 YHP YZP Yuan Hu Zhi tong Yuanhuzhitong preparation experimental_condition_ontology XCO:0001620 Yuanhu Zhitong Prescription This is any condition in which the main influencing factor is Yuanhu Zhitong Prescription, a traditional Chinese medicine (TCM) formula used for pain relief. The main ingredients of Yuanhu Zhitong Prescription are Radix angelicae dahuricae (white angelica root) and Rhizoma corydalis (gold thread rhizome). PMID:_23762151 This is any condition in which the main influencing factor is Corydalis yanhusuo, a plant species in the genus Corydalis. The tuber of Corydalis yanhusuo, frequently mislabeled as the root, is an important therapeutic agent for pain relief in traditional Chinese medicine (TCM). slaulederkind 2025-05-13T16:34:00Z PMID:38729540 Asian corydalis CYH Corydalis yanhusuo extract Corydalis yanhusuo, rhizoma YH YHS Yuanhu corydalis experimental_condition_ontology XCO:0001621 Corydalis yanhusuo This is any condition in which the main influencing factor is Corydalis yanhusuo, a plant species in the genus Corydalis. The tuber of Corydalis yanhusuo, frequently mislabeled as the root, is an important therapeutic agent for pain relief in traditional Chinese medicine (TCM). PMID:_34946576 https://en.wikipedia.org/wiki/Corydalis_yanhusuo This is any condition in which the main influencing factor is Angelica dahurica, whose root is a well-known traditional Chinese medicine (TCM). Angelica dahurica and Corydalis yanhusuo are the main ingredients of Yuanhu Zhitong Prescription slaulederkind 2025-05-13T16:56:53Z PMID:38729540 A. dahurica AD Angelica dahurica root BZ Baizhi Chinese angelica Dahurian angelica bai zhi garden angelica root of the Holy Ghost wild angelica experimental_condition_ontology XCO:0001622 Angelica dahurica This is any condition in which the main influencing factor is Angelica dahurica, whose root is a well-known traditional Chinese medicine (TCM). Angelica dahurica and Corydalis yanhusuo are the main ingredients of Yuanhu Zhitong Prescription PMID:35847034 https://en.wikipedia.org/wiki/Angelica_dahurica This is any condition in which the main influencing factor is Traditional Chinese Medicine (TCM), a medical system that has been used for thousands of years to prevent, diagnose, and treat disease. Traditional Chinese medicine includes acupuncture, diet, herbal therapy, meditation, physical exercise, and massage. slaulederkind 2025-05-13T17:11:41Z PMID:38729540 Oriental medicine TCM experimental_condition_ontology Not4Curation XCO:0001623 Traditional Chinese Medicine This is any condition in which the main influencing factor is Traditional Chinese Medicine (TCM), a medical system that has been used for thousands of years to prevent, diagnose, and treat disease. Traditional Chinese medicine includes acupuncture, diet, herbal therapy, meditation, physical exercise, and massage. https://en.wikipedia.org/wiki/Traditional_Chinese_medicine https://www.cancer.gov/publications/dictionaries/cancer-terms This is any condition in which the main influencing factor is RG2833, a brain-penetrant histone deacetylase 1/3 (HDAC1/3) inhibitor. It is being investigated as a potential therapeutic agent for cancer, neurological disorders, and other conditions. slaulederkind 2025-05-22T15:53:06Z CID:56654642 N-(6-(2-Aminophenylamino)-6-oxohexyl)-4-methylbenzamide RG-2833 RGFP 109 experimental_condition_ontology XCO:0001624 RG2833 This is any condition in which the main influencing factor is RG2833, a brain-penetrant histone deacetylase 1/3 (HDAC1/3) inhibitor. It is being investigated as a potential therapeutic agent for cancer, neurological disorders, and other conditions. PMCID:PMC9164640 This is any condition in which the main influencing factor is a diet made up of standard chow and a specified amount of RG2833, a brain-penetrant histone deacetylase 1/3 (HDAC1/3) inhibitor. slaulederkind 2025-05-22T16:15:07Z CID:56654642 controlled N-(6-(2-Aminophenylamino)-6-oxohexyl)-4-methylbenzamide content diet controlled RG-2833 content diet controlled RGFP 109 content diet experimental_condition_ontology XCO:0001625 controlled RG2833 content diet This is any condition in which the main influencing factor is a diet made up of standard chow and a specified amount of RG2833, a brain-penetrant histone deacetylase 1/3 (HDAC1/3) inhibitor. PMCID:PMC9164640 This is any condition in which the main influencing factor is pioglitazone, a member of the class of thiazolidenediones that is an insulin-sensitizing drug, a pantothenate kinase inhibitor, a cardioprotective agent, a PPARgamma agonist, an antidepressant, and a hypoglycemic agent. slaulederkind 2025-05-27T10:27:52Z CHEBI:8228 MESH:D000077205 PMID:38188512 5-{4-[2-(5-ethylpyridin-2-yl)ethoxy]benzyl}-1,3-thiazolidine-2,4-dione Actos experimental_condition_ontology Pioglitazone Hydrochloride XCO:0001626 pioglitazone This is any condition in which the main influencing factor is pioglitazone, a member of the class of thiazolidenediones that is an insulin-sensitizing drug, a pantothenate kinase inhibitor, a cardioprotective agent, a PPARgamma agonist, an antidepressant, and a hypoglycemic agent. CID:4829 This is any condition in which the main influencing factor is polysorbate 20, a nonionic surfactant and detergent widely used in various applications, including biochemical and life science research, food production, and personal care products. Polysorbate 20 is a polymer composed of PEG-ylated sorbitan, where the total number of poly(ethylene glycol) units is 20 (w + x + y + z = 20) and a single terminal is capped by a dodecanoyl group. slaulederkind 2025-05-29T11:48:58Z CHEBI:53424 CID:443314 Kolliphor PS 20 Tween 20 polyoxyethylene (20) sorbitan monolaurate experimental_condition_ontology XCO:0001627 polysorbate 20 This is any condition in which the main influencing factor is polysorbate 20, a nonionic surfactant and detergent widely used in various applications, including biochemical and life science research, food production, and personal care products. Polysorbate 20 is a polymer composed of PEG-ylated sorbitan, where the total number of poly(ethylene glycol) units is 20 (w + x + y + z = 20) and a single terminal is capped by a dodecanoyl group. https://en.wikipedia.org/wiki/Polysorbate_20 https://www.sigmaaldrich.com This is a condition in which an empty adenovirus vector (transiently or stably) has been transferred into a cell or organism. This condition is used as a control for an adenovirus transfer of a specific gene. slaulederkind 2025-05-29T12:59:16Z GEO:GSE249368 PMID:39938686 sham gene transfer using an adenovirus EV sham gene transfer using an adenovirus empty vector experimental_condition_ontology XCO:0001628 sham gene transfer using an empty adenovirus vector This is a condition in which an empty adenovirus vector (transiently or stably) has been transferred into a cell or organism. This condition is used as a control for an adenovirus transfer of a specific gene. https://en.wikipedia.org/wiki/Transduction_(genetics) https://www.cancer.gov/publications/dictionaries/cancer-terms/def/adenovirus-vector This is any condition in which the main influencing factor is TRULI, a potent and ATP-competitive inhibitor of Lats1 (large tumor suppressor kinase 1) and Lats2 (large tumor suppressor kinase 2) kinases. TRULI promotes Yap-dependent proliferation in postmitotic mammalian tissues by inhibiting phosphorylation of YES1-associated transcriptional regulator (YAP1). slaulederkind 2025-05-29T14:35:10Z CAS:1424635-83-5 GEO:GSE249368 PMID:39938686 LATS Inhibitor 1 Lats-IN-1 N-[(2E)-3-Benzyl-1,3-thiazol-2(3H)-ylidene]-1H-pyrrolo[2,3-b]pyridine-3-carboxamide N-[3-(phenylmethyl)-2(3H)-thiazolylidene]-1H-pyrrolo[2,3-b]pyridine-3-carboxamide experimental_condition_ontology XCO:0001629 TRULI This is any condition in which the main influencing factor is TRULI, a potent and ATP-competitive inhibitor of Lats1 (large tumor suppressor kinase 1) and Lats2 (large tumor suppressor kinase 2) kinases. TRULI promotes Yap-dependent proliferation in postmitotic mammalian tissues by inhibiting phosphorylation of YES1-associated transcriptional regulator (YAP1). https://www.bertin-bioreagent.com/lats-in-1/ https://www.medchemexpress.com/truli.html This is any condition in which the main influencing factor is desferrioxamine B, a natural product native to Streptomyces pilosus that has a role as an iron chelator, a siderophore, a ferroptosis inhibitor and a bacterial metabolite. slaulederkind 2025-06-02T12:28:06Z CHEBI:4356 MESH:D003676 PMID:39872995 DFO Deferrioxamine B N'-{5-[acetyl(hydroxy)amino]pentyl}-N-(5-{4-[(5-aminopentyl)(hydroxy)amino]-4-oxobutanamido}pentyl)-N-hydroxybutanediamide deferoxamine desferrioxamine experimental_condition_ontology XCO:0001630 desferrioxamine B This is any condition in which the main influencing factor is desferrioxamine B, a natural product native to Streptomyces pilosus that has a role as an iron chelator, a siderophore, a ferroptosis inhibitor and a bacterial metabolite. CID:2973 This is any condition in which the main influencing factor is a chelator, an organic chemical that bonds with and removes free metal ions from solutions. The complex between a metal ion and a chelator is water-soluble and not easily dissociated. slaulederkind 2025-06-02T12:43:24Z CHEBI:38161 PMID:39872995 chelating agent metal chelating Agent metal chelator experimental_condition_ontology XCO:0001631 chelator This is any condition in which the main influencing factor is a chelator, an organic chemical that bonds with and removes free metal ions from solutions. The complex between a metal ion and a chelator is water-soluble and not easily dissociated. https://www.sciencedirect.com/topics/medicine-and-dentistry/chelating-agent This is any condition in which the main influencing factor is SCH 23390, a selective dopamine receptor D1 (DRD1) antagonist. slaulederkind 2025-06-02T13:10:11Z CHEBI:73297 CID:3036864 PMID:40141377 (R)-2,3,4,5-Tetrahydro-8-chloro-3-methyl-5-phenyl-1H-3-benzazepin-7-ol 8-chloro-3-methyl-5-phenyl-2,3,4,5-tetrahydro-1H-3-benzazepin-7-ol SCH-23390 SCH23390 experimental_condition_ontology XCO:0001632 SCH 23390 This is any condition in which the main influencing factor is SCH 23390, a selective dopamine receptor D1 (DRD1) antagonist. MESH:C534628 This is any condition in which the main influencing factor is the gap junction protein, alpha 1 gene (Gja1) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulederkind 2025-06-02T13:57:31Z gene transfer of the Cx43 gene using an adenovirus vector gene transfer of the Gja1 gene using an adenoviral vector gene transfer of the connexin 43 gene using an adenovirus vector gene transfer of the gap junction protein, alpha 1 gene using an adenoviral vector gene transfer of the gap junction protein, alpha 1 gene using an adenovirus vector gene transfer of the wild type Gja1 gene using an adenovirus vector gene transfer of the wild-type Gja1 gene using an adenovirus vector transduction of Gja1 using an adenoviral vector transduction of Gja1 using an adenovirus vector experimental_condition_ontology XCO:0001633 gene transfer of the Gja1 gene using an adenovirus vector This is any condition in which the main influencing factor is the gap junction protein, alpha 1 gene (Gja1) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:39938686 This is any condition in which the main influencing factor is the S282A variant of the gap junction protein, alpha 1 gene (Gja1) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulederkind 2025-06-02T14:18:51Z gene transfer of the Cx43 gene S282A variant using an adenovirus vector gene transfer of the Gja1 gene S282A variant using an adenoviral vector gene transfer of the connexin 43 gene S282A variant using an adenovirus vector gene transfer of the gap junction protein, alpha 1 gene S282A variant using an adenoviral vector gene transfer of the gap junction protein, alpha 1 gene S282A variant using an adenovirus vector gene transfer of the wild type Gja1 gene S282A variant using an adenovirus vector gene transfer of the wild-type Gja1 S282A variant gene using an adenovirus vector transduction of Gja1 S282A variant using an adenoviral vector transduction of Gja1 S282A variant using an adenovirus vector experimental_condition_ontology XCO:0001634 gene transfer of the Gja1 gene S282A variant using an adenovirus vector This is any condition in which the main influencing factor is the S282A variant of the gap junction protein, alpha 1 gene (Gja1) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:39938686 This is any condition in which the main influencing factor is ginsenoside C-K, a ginsenoside found in Panax species that has a role as a plant metabolite, an antineoplastic agent, a hepatoprotective agent, an anti-allergic agent and an anti-inflammatory agent. Ginsenoside C-K is also a beta-D-glucoside, a 12beta-hydroxy steroid, a tetracyclic triterpenoid, a 3beta-hydroxy steroid and a 3beta-hydroxy-4,4-dimethylsteroid. slaulederkind 2025-06-03T14:55:21Z CHEBI:77146 GEO:GSE261056 MESH:C112772 3beta,12beta)-3,12-dihydroxydammar-24-en-20-yl beta-D-glucopyranoside ginsenoside CK ginsenoside K ginsenoside compound K experimental_condition_ontology XCO:0001635 ginsenoside C-K This is any condition in which the main influencing factor is ginsenoside C-K, a ginsenoside found in Panax species that has a role as a plant metabolite, an antineoplastic agent, a hepatoprotective agent, an anti-allergic agent and an anti-inflammatory agent. Ginsenoside C-K is also a beta-D-glucoside, a 12beta-hydroxy steroid, a tetracyclic triterpenoid, a 3beta-hydroxy steroid and a 3beta-hydroxy-4,4-dimethylsteroid. CID:9852086 This is any condition in which the main influencing factor is any maternal exposure to corn oil that has multigenerational effects. This is a condition typically studied to determine the effect of maternal corn oil use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-06-03T15:15:14Z GEO:GSE255311 multigenerational maternal exposure to maize oil experimental_condition_ontology XCO:0001636 multigenerational maternal exposure to corn oil This is any condition in which the main influencing factor is any maternal exposure to corn oil that has multigenerational effects. This is a condition typically studied to determine the effect of maternal corn oil use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to corn oil. This is a condition typically studied to determine the effect of maternal (F0) corn oil exposure on the F1 offspring. This is typically a control condition for gestational maternal exposure to some chemical agent. slaulederkind 2025-06-03T15:59:35Z GEO:GSE255311 gestational maternal exposure to maize oil maternal exposure to corn oil during pregnancy maternal exposure to maize oil during pregnancy experimental_condition_ontology XCO:0001637 gestational maternal exposure to corn oil This is any condition in which the main influencing factor is any gestational maternal exposure to corn oil. This is a condition typically studied to determine the effect of maternal (F0) corn oil exposure on the F1 offspring. This is typically a control condition for gestational maternal exposure to some chemical agent. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is dipentyl phthalate, a phthalate ester that is the dipentyl ester of benzene-1,2-dicarboxylic acid. Dipentyl phthalate is a phthalate ester, a diester, and a male reproductive toxicant. slaulederkind 2025-06-03T16:14:31Z CHEBI:34680 MESH:C034171 amyl phthalate di-n-amyl phthalate di-n-pentyl phthalate diamyl phthalate dipentyl benzene-1,2-dicarboxylate experimental_condition_ontology XCO:0001638 dipentyl phthalate This is any condition in which the main influencing factor is dipentyl phthalate, a phthalate ester that is the dipentyl ester of benzene-1,2-dicarboxylic acid. Dipentyl phthalate is a phthalate ester, a diester, and a male reproductive toxicant. CID:8561 This is any condition in which the main influencing factor is any maternal exposure to dipentyl phthalate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) dipentyl phthalate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-06-03T16:33:28Z CHEBI:34680 multigenerational maternal exposure to di-n-pentyl phthalate multigenerational maternal exposure to diamyl phthalate multigenerational maternal exposure to dipentyl benzene-1,2-dicarboxylate experimental_condition_ontology XCO:0001639 multigenerational maternal exposure to dipentyl phthalate This is any condition in which the main influencing factor is any maternal exposure to dipentyl phthalate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) dipentyl phthalate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to dipentyl phthalate. This is a condition typically studied to determine the effect of maternal (F0) dipentyl phthalate use/exposure on the F1 offspring. slaulederkind 2025-06-03T16:43:59Z CHEBI:34680 gestational maternal exposure to di-n-pentyl phthalate gestational maternal exposure to diamyl phthalate gestational maternal exposure to dipentyl benzene-1,2-dicarboxylate maternal exposure to dipentyl phthalate during pregnancy experimental_condition_ontology XCO:0001640 gestational maternal exposure to dipentyl phthalate This is any condition in which the main influencing factor is any gestational maternal exposure to dipentyl phthalate. This is a condition typically studied to determine the effect of maternal (F0) dipentyl phthalate use/exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is 2,2′,5,5′-tetrachlorobiphenyl-4-ol, a metabolite of the polychlorinated biphenyl (PCB) compound PCB52. 2,2′,5,5′-tetrachlorobiphenyl-4-ol is formed when the human body metabolizes PCB52 slaulederkind 2025-06-05T10:00:30Z CID:39971 (1,1'-Biphenyl)-4-ol, 2,2',5,5'-tetrachloro 2,2',5,5'-Tetrachloro-4-biphenylol 4-Hydroxy-2,2',5,5'-tetrachlorobiphenyl 4-OH-PCB52 4–52 experimental_condition_ontology XCO:0001641 2,2′,5,5′-tetrachlorobiphenyl-4-ol This is any condition in which the main influencing factor is 2,2′,5,5′-tetrachlorobiphenyl-4-ol, a metabolite of the polychlorinated biphenyl (PCB) compound PCB52. 2,2′,5,5′-tetrachlorobiphenyl-4-ol is formed when the human body metabolizes PCB52 PMID:36804509 This is any condition in which the main influencing factor is an empty or vehicle-loaded polymeric implant, used as a study control for drugs or chemicals delivered by polymeric implant. Implants are cylindrical or other shaped devices, which are injected or implanted into the subcutaneous tissue with a large bore needle. slaulederkind 2025-06-05T10:41:50Z PMID:40097135 polymeric implant sham surgery experimental_condition_ontology XCO:0001642 polymeric implant sham procedure This is any condition in which the main influencing factor is an empty or vehicle-loaded polymeric implant, used as a study control for drugs or chemicals delivered by polymeric implant. Implants are cylindrical or other shaped devices, which are injected or implanted into the subcutaneous tissue with a large bore needle. https://www.sciencedirect.com/topics/materials-science/polymeric-implant This is any condition in which the main influencing factor is beta-aminopropionitrile, an organic compound with both amine and nitrile functional groups. Beta-aminopropionitrile is an antineoplastic agent, an antirheumatic drug, and an inhibitor of lysyl oxidase, an enzyme involved in collagen and elastin cross-linking. slaulederkind 2025-06-05T12:04:28Z CHEBI:27413 GEO:GSE161044 MESH:D000629 PMID:38326494 2-cyanoethylamine 3-aminopropanenitrile 3-aminopropionitrile BAPN aminopropionitrile experimental_condition_ontology XCO:0001643 beta-aminopropionitrile This is any condition in which the main influencing factor is a solid diet in which the amount of beta-aminopropionitrile is maintained at a specified level. slaulederkind 2025-06-05T12:34:17Z CHEBI:27413 GEO:GSE161044 MESH:D000629 PMID:38326494 controlled 3-aminopropanenitrile content diet controlled BAPN content diet controlled aminopropionitrile content diet experimental_condition_ontology XCO:0001644 controlled beta-aminopropionitrile content diet This is any condition in which the main influencing factor is a solid diet in which the amount of beta-aminopropionitrile is maintained at a specified level. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is pterygopalatine artery occlusion, an experimental surgical procedure which restricts the amount of cranial blood flowing through the left, right, or both pterygopalatine artery(ies). This procedure is used as part of a more extensive procedure to study intracranial aneurysms in laboratory rats. slaulederkind 2025-06-05T13:04:48Z maxillary artery occlusion pterygomaxillary artery occlusion pterygopalatine artery occlusion experimental_condition_ontology XCO:0001645 pterygopalatine artery occlusion This is any condition in which the main influencing factor is pterygopalatine artery occlusion, an experimental surgical procedure which restricts the amount of cranial blood flowing through the left, right, or both pterygopalatine artery(ies). This procedure is used as part of a more extensive procedure to study intracranial aneurysms in laboratory rats. PMID:38326494 This is any condition in which the main influencing factor is gene transfer of the rat Ctnnd2 (catenin delta 2) gene using an adeno-associated virus vector. Gene transfer into a cell or organism using an adeno-associated virus vector is performed to induce synthesis of the carried gene's product in the recipient cell or organism. slaulederkind 2025-06-06T11:32:30Z GEO:GSE273113 AAV‐Ctnnd2 gene transfer gene transfer of the rat Ctnnd2 gene using an AAV vector gene transfer of the rat catenin delta 2 gene using adeno-associated virus vector gene transfer with pAAV‐CMV‐rCTNND2‐P2A‐EGFP‐tWPA experimental_condition_ontology XCO:0001646 gene transfer of the rat Ctnnd2 gene using an adeno-associated virus vector This is any condition in which the main influencing factor is gene transfer of the rat Ctnnd2 (catenin delta 2) gene using an adeno-associated virus vector. Gene transfer into a cell or organism using an adeno-associated virus vector is performed to induce synthesis of the carried gene's product in the recipient cell or organism. PMID:39965128 This is any condition in which the main influencing factor is an empty adeno-associated virus vector that has been transferred into a cell or organism. This condition is used as a control for a adeno-associated virus transfer of a specific gene. The empty vector is identical to the experimental adeno-associated virus except for the specific gene being tested. slaulederkind 2025-06-06T11:53:36Z GEO:GSE273113 gene transfer of an empty AAV vector sham gene transfer using an empty AAV vector AAV‐EGFP experimental_condition_ontology XCO:0001647 sham gene transfer using an empty adeno-associated virus vector This is any condition in which the main influencing factor is an empty adeno-associated virus vector that has been transferred into a cell or organism. This condition is used as a control for a adeno-associated virus transfer of a specific gene. The empty vector is identical to the experimental adeno-associated virus except for the specific gene being tested. PMID:39965128 This is any condition in which the main influencing factor is human iPSC-derived exosomes. iPSCs (induced pluripotent stem cells) are generated by reprogramming adult somatic cells (typically skin or blood cells) back into an embryonic-like pluripotent state. Exosomes are nano-sized biovesicles released into surrounding body fluids upon fusion of multivesicular bodies and the plasma membrane. slaulederkind 2025-06-09T13:04:10Z PMID:40214483 human iPSC-Exos human iPSC-derived exosomes human induced pluripotent stem cell-derived exosomes experimental_condition_ontology XCO:0001648 human iPSC-derived exosomes This is any condition in which the main influencing factor is human iPSC-derived exosomes. iPSCs (induced pluripotent stem cells) are generated by reprogramming adult somatic cells (typically skin or blood cells) back into an embryonic-like pluripotent state. Exosomes are nano-sized biovesicles released into surrounding body fluids upon fusion of multivesicular bodies and the plasma membrane. PMID:30815248 https://www.criver.com/products-services/cell-sourcing/human-stem-cells/ipsc This is any condition in which the main influencing factor is leucine, an essential branched-chain amino acid that consists of glycine in which one of the hydrogens attached to the alpha-carbon is substituted by an isobutyl group. Leucine is important for hemoglobin formation and may be used by skeletal muscle during exercise to generate energy. slaulederkind 2025-06-09T13:47:01Z CID:6106 GEO:GSE203486 PMID:37196349 2-Amino-4-methylpentanoic acid L Leu D-leucine L-leucine experimental_condition_ontology XCO:0001649 leucine This is any condition in which the main influencing factor is leucine, an essential branched-chain amino acid that consists of glycine in which one of the hydrogens attached to the alpha-carbon is substituted by an isobutyl group. Leucine is important for hemoglobin formation and may be used by skeletal muscle during exercise to generate energy. CHEBI:25017 MESH:D007930 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of leucine consumed by an organism as part of an experiment. Leucine is a branched-chain amino acid that consists of glycine in which one of the hydrogens attached to the alpha-carbon is substituted by an isobutyl group. slaulederkind 2025-06-09T14:07:07Z GEO:GSE203486 PMID:37196349 controlled 2-Amino-4-methylpentanoic acid content drinking water controlled Leu content drinking water experimental_condition_ontology XCO:0001650 controlled leucine content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of leucine consumed by an organism as part of an experiment. Leucine is a branched-chain amino acid that consists of glycine in which one of the hydrogens attached to the alpha-carbon is substituted by an isobutyl group. CHEBI:25017 This is any condition in which the main influencing factor is a specific-pathogen-free diet, a diet formulated and provided to animals that are maintained in an SPF (specific-pathogen-free) environment, meaning they are free of certain identified pathogens. SPF diets are typically designed to be sterile and free of pathogens, and they often include ingredients like autoclaved standard chow pellets and sterilized water. slaulederkind 2025-06-09T14:39:21Z SPF diet specific pathogen free diet specific-pathogen-free diet experimental_condition_ontology XCO:0001651 specific pathogen-free diet This is any condition in which the main influencing factor is a specific-pathogen-free diet, a diet formulated and provided to animals that are maintained in an SPF (specific-pathogen-free) environment, meaning they are free of certain identified pathogens. SPF diets are typically designed to be sterile and free of pathogens, and they often include ingredients like autoclaved standard chow pellets and sterilized water. PMID:34864461 PMID:39920864 This is any condition in which the main influencing factor is a specific-pathogen-free rat breed and growth diet, an SPF diet with 200 g/kg crude protein and 3.44 kcal/g energy content. slaulederkind 2025-06-09T15:02:12Z https://en.keaoxieli.com/ specific-pathogen-free rat breed and growth diet experimental_condition_ontology XCO:0001652 SPF rat breed and growth diet This is any condition in which the main influencing factor is a specific-pathogen-free rat breed and growth diet, an SPF diet with 200 g/kg crude protein and 3.44 kcal/g energy content. PMID:37196349 This is any condition in which the main influencing factor is a specific-pathogen-free rat maintenance diet, an SPF diet with 180 g/kg crude protein and 3.40 kcal/g energy content. slaulederkind 2025-06-09T15:25:50Z https://en.keaoxieli.com/ specific-pathogen-free rat maintenance diet experimental_condition_ontology XCO:0001653 SPF rat maintenance diet This is any condition in which the main influencing factor is a specific-pathogen-free rat maintenance diet, an SPF diet with 180 g/kg crude protein and 3.40 kcal/g energy content. PMID:37196349 This is any condition in which the main influencing factor is suckling, that act of feeding on or being fed by milk directly from a mother's breast/mammary glands. slaulederkind 2025-06-09T16:09:35Z GEO:GSE203486 PMID:37196349 breastfeeding nursing experimental_condition_ontology XCO:0001654 suckling This is any condition in which the main influencing factor is suckling, that act of feeding on or being fed by milk directly from a mother's breast/mammary glands. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to sucrose that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) sucrose use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-06-09T17:05:18Z CHEBI:17992 GEO:GSE290103 PMID:40097492 experimental_condition_ontology XCO:0001655 multigenerational maternal exposure to sucrose This is any condition in which the main influencing factor is any maternal exposure to sucrose that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) sucrose use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to sucrose. This is a condition typically studied to determine the effect of maternal (F0) sucrose exposure on the F1 offspring. slaulederkind 2025-06-09T17:12:14Z maternal exposure to sucrose during pregnancy experimental_condition_ontology XCO:0001656 gestational maternal exposure to sucrose This is any condition in which the main influencing factor is any gestational maternal exposure to sucrose. This is a condition typically studied to determine the effect of maternal (F0) sucrose exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is gene transfer of the mouse-jellyfish EGFPL10A (flourescent protein/ribosomal protein) fusion gene using an adeno-associated virus vector. This expression of this vector is double floxed for use with Cre transgenic animals. This vector is used as part a viral TRAP (translating ribosome affinity purification) system to access translating mRNAs. slaulederkind 2025-06-10T13:20:37Z gene transduction of AAV-FLEX-EGFPL10a gene transduction of EF1a-AAV5-FLEX-GFPL10a gene transfer of AAV-FLEX-EGFPL10a gene transfer of EF1a-AAV5-FLEX-GFPL10a gene transfer of the mouse-jellyfish EGFPL10A fusion gene using an adeno-associated viral vector experimental_condition_ontology XCO:0001657 gene transfer of the mouse-jellyfish EGFPL10A fusion gene using an adeno-associated virus vector This is any condition in which the main influencing factor is gene transfer of the mouse-jellyfish EGFPL10A (flourescent protein/ribosomal protein) fusion gene using an adeno-associated virus vector. This expression of this vector is double floxed for use with Cre transgenic animals. This vector is used as part a viral TRAP (translating ribosome affinity purification) system to access translating mRNAs. PMID:28423326 https://www.addgene.org/98747/ This is any condition in which the main influencing factor is the hydrochloride salt of cocaine, which is used clinically as a local anesthetic and vasoconstrictor. Cocaine's local anesthetic effects come from it's binding to and blocking of the voltage-gated sodium channels in the neuronal cell membrane. Cocaine also has powerful central nervous system effects similar to the amphetamines and is a drug of abuse. slaulederkind 2025-06-12T12:56:32Z CHEBI:613010 GEO:GSE134107 MESH:D003042 PMID:33159041 (1R,2R,3S,5S)-3-(benzoyloxy)-2-(methoxycarbonyl)-8-methyl-8-azoniabicyclo[3.2.1]octane chloride cocaine HCl experimental_condition_ontology XCO:0001658 cocaine hydrochloride This is any condition in which the main influencing factor is the hydrochloride salt of cocaine, which is used clinically as a local anesthetic and vasoconstrictor. Cocaine's local anesthetic effects come from it's binding to and blocking of the voltage-gated sodium channels in the neuronal cell membrane. Cocaine also has powerful central nervous system effects similar to the amphetamines and is a drug of abuse. CID:656832 This is any condition in which the main influencing factor is Urolithin A, a coumarin that has various biological effects. Research on Urolithin A has found effects on diverse biological activities, encompassing anti-inflammatory, antioxidant, anti-tumor, and anti-aging properties. slaulederkind 2025-06-12T13:27:13Z CHEBI:168442 GEO:GSE283003 MESH:C026423 PMID:40034121 3,8-dihydroxybenzo[c]chromen-6-one UA Uro A Uro-A experimental_condition_ontology XCO:0001659 Urolithin A This is any condition in which the main influencing factor is Urolithin A, a coumarin that has various biological effects. Research on Urolithin A has found effects on diverse biological activities, encompassing anti-inflammatory, antioxidant, anti-tumor, and anti-aging properties. CID:5488186 PMID:37892516 This is any condition in which the main influencing factor is C75, a fatty acid synthase (FASN) inhibitor and an activator of carnitine palmitoyl-transferase-1 (CPT1A). C75 has shown potential therapeutic effects in several cancer models. slaulederkind 2025-06-12T14:13:12Z GEO:GSE285267 PMID:39877365 4-Methylene-2-octyl-5-oxotetrahydrofuran-3-carboxylic acid rac-(2R,3S)-4-methylidene-2-octyl-5-oxotetrahydrofuran-3-carboxylic acid experimental_condition_ontology XCO:0001660 C75 This is any condition in which the main influencing factor is C75, a fatty acid synthase (FASN) inhibitor and an activator of carnitine palmitoyl-transferase-1 (CPT1A). C75 has shown potential therapeutic effects in several cancer models. CHEBI:189865 https://www.selleckchem.com/products/c-75.html This is any condition in which the main influencing factor is rabeprazole, a benzimidazole that has a role as a H(+)/K(+)-exchanging ATPase inhibitor (proton pump inhibitor). Rabeprazole is used as an anti-ulcer drug. slaulederkind 2025-06-13T13:38:50Z CHEBI:8768 GEO:GSE293658 MESH:D064750 PMID:40239879 2-({[4-(3-methoxypropoxy)-3-methylpyridin-2-yl]methyl}sulfinyl)-1H-benzimidazole experimental_condition_ontology XCO:0001661 rabeprazole This is any condition in which the main influencing factor is rabeprazole, a benzimidazole that has a role as a H(+)/K(+)-exchanging ATPase inhibitor (proton pump inhibitor). Rabeprazole is used as an anti-ulcer drug. CID:5029 This is any condition in which the main influencing factor is Jiawei Lianpu Yin, a compound formula used in traditional Chinese medicine (TCM). Jiawei Lianpu Yin is a combination of eleven different herbal ingredients. It has been used to treat gastric disorders. slaulederkind 2025-06-16T17:11:29Z GEO:GSE293658 PMID:40239879 JWLPY experimental_condition_ontology XCO:0001662 Jiawei Lianpu Yin This is any condition in which the main influencing factor is Jiawei Lianpu Yin, a compound formula used in traditional Chinese medicine (TCM). Jiawei Lianpu Yin is a combination of eleven different herbal ingredients. It has been used to treat gastric disorders. PMID:40239879 This is any condition in which the main influencing factor is Helicobacter pylori, a microaerophilic, gram-negative spiral bacteria active as a human gastric pathogen, although most individuals harboring the bacteria are asymptomatic.  Helicobacter pylori was originally classified in the genus Campylobacter, but has been officially transferred to Helicobacter. slaulederkind 2025-06-16T17:28:32Z GEO:GSE293658 PMID:40239879 Campylobacter pylori H. pylori experimental_condition_ontology XCO:0001663 Helicobacter pylori  This is any condition in which the main influencing factor is Helicobacter pylori, a microaerophilic, gram-negative spiral bacteria active as a human gastric pathogen, although most individuals harboring the bacteria are asymptomatic.  Helicobacter pylori was originally classified in the genus Campylobacter, but has been officially transferred to Helicobacter. MESH:D016480 https://www.mayoclinic.org/diseases-conditions/h-pylori/symptoms-causes/syc-20356171 This is any condition in which the main influencing factor is bismuth subcitrate potassium, a complex salt that is used to treat duodenal and gastric ulcers associated with Helicobacter pylori. Bismuth subcitrate potassium is a soluble, complex bismuth salt of citric acid. slaulederkind 2025-06-16T18:00:56Z GEO:GSE293658 PMID:40239879 Bismuth(3+) potassium 2-olato-1,2,3-propanetricarboxylate (1:5:2) bismuth subcitrate potassium anhydrous experimental_condition_ontology XCO:0001664 bismuth subcitrate potassium This is any condition in which the main influencing factor is bismuth subcitrate potassium, a complex salt that is used to treat duodenal and gastric ulcers associated with Helicobacter pylori. Bismuth subcitrate potassium is a soluble, complex bismuth salt of citric acid. CID:10101269 This is any condition in which the main influencing factor is running on an inclined treadmill with shock grid, a set-up designed to force the subject to continue moving on the treadmill. If the subject stops forward movement, the shock grid will be encountered at the back end of the treadmill. The apparatus is designed to make the subject run/walk until exhausted slaulederkind 2025-06-17T14:09:34Z PMID:16033863 https://www.panlab.com/en/ running on inclined treadmill equipped with shock grid running on sloped treadmill with shock grid experimental_condition_ontology XCO:0001665 running on inclined treadmill with shock grid This is any condition in which the main influencing factor is running on an inclined treadmill with shock grid, a set-up designed to force the subject to continue moving on the treadmill. If the subject stops forward movement, the shock grid will be encountered at the back end of the treadmill. The apparatus is designed to make the subject run/walk until exhausted https://omnitech-usa.com/product/accupacer-mouse-treadmill/ This is any condition in which the main influencing factor is surgical manipulation and left renal artery/branch(es) ligation to achieve partial or total blockage of blood flow from the left renal artery. The left renal artery/branch(es) may be clamped or tied with a suture(s) to achieve blockage of blood flow. slaulederkind 2025-06-20T11:03:46Z GEO:GSM4824135 left renal artery constriction left renal artery occlusion experimental_condition_ontology XCO:0001666 left renal artery ligation This is any condition in which the main influencing factor is surgical manipulation and left renal artery/branch(es) ligation to achieve partial or total blockage of blood flow from the left renal artery. The left renal artery/branch(es) may be clamped or tied with a suture(s) to achieve blockage of blood flow. ISBN-13:978-1455756438 This is any condition in which the main influencing factor is cyclo(L-His-L-Pro), a homodetic cyclic peptide resulting from the formal condensation of both the amino and acid groups of L-histidine with the acid and amino groups of L-proline. It is a metabolite of thyrotropin-releasing hormone (TRH). slaulederkind 2025-06-20T12:41:03Z CID:449094 (3S,8aS)-3-[(1H-imidazol-5-yl)methyl]hexahydropyrrolo[1,2-a]pyrazine-1,4-dione CHP cyclo(L-histidyl-L-proline) cyclo(his-pro) cyclo(histidyl-proline) cyclo(prolylhistidine) histidylproline diketopiperazine, histidylproline dioxopiperazine experimental_condition_ontology XCO:0001667 cyclo(L-His-L-Pro) This is any condition in which the main influencing factor is cyclo(L-His-L-Pro), a homodetic cyclic peptide resulting from the formal condensation of both the amino and acid groups of L-histidine with the acid and amino groups of L-proline. It is a metabolite of thyrotropin-releasing hormone (TRH). CHEBI:90039 This is a condition in which the main influencing factor is operant conditioning in a Skinner box, a learning process in which voluntary behaviors are modified by association with the addition (or removal) of reward or aversive stimuli while the subject is in an operant conditioning chamber. The frequency or duration of the behavior may increase through reinforcement or decrease through punishment or extinction. slaulederkind 2025-06-27T16:27:34Z PMID:40133300 instrumental conditioning in a skinner box instrumental conditioning in an operant conditioning chamber operant conditioning in an operant conditioning chamber experimental_condition_ontology XCO:0001668 operant conditioning in a skinner box This is a condition in which the main influencing factor is operant conditioning in a Skinner box, a learning process in which voluntary behaviors are modified by association with the addition (or removal) of reward or aversive stimuli while the subject is in an operant conditioning chamber. The frequency or duration of the behavior may increase through reinforcement or decrease through punishment or extinction. https://en.wikipedia.org/wiki/Operant_conditioning This is any condition in which the main influencing factor is drug withdrawal via context exposure in a Skinner box lacking levers, cues, and rewards. This withdrawal paradigm uses context exposure (stimuli that were continuously present while learning drug use with operant conditioning). slaulederkind 2025-06-27T16:42:47Z drug withdrawal drug withdrawal via context exposure in an operant conditioning chamber experimental_condition_ontology XCO:0001669 drug withdrawal via context exposure in a Skinner box This is any condition in which the main influencing factor is drug withdrawal via context exposure in a Skinner box lacking levers, cues, and rewards. This withdrawal paradigm uses context exposure (stimuli that were continuously present while learning drug use with operant conditioning). PMID:40133300 https://en.wikipedia.org/wiki/Operant_conditioning This is any condition in which the main influencing factor is controlled air ozone content surrounding an organism or breathed by the organism as part of an experiment. Ozone (trioxygen) is an inorganic molecule made up of three oxygen atoms. slaulederkind 2025-06-27T17:33:26Z PMID:39865885 controlled air O3 content controlled air trioxygen content experimental_condition_ontology XCO:0001670 controlled air ozone content This is any condition in which the main influencing factor is controlled air ozone content surrounding an organism or breathed by the organism as part of an experiment. Ozone (trioxygen) is an inorganic molecule made up of three oxygen atoms. https://en.wikipedia.org/wiki/Ozone https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any parental exposure to controlled air ozone content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal/paternal (F0) controlled air ozone content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. Paternal exposure to controlled air ozone content may occur anytime before successful copulation. slaulederkind 2025-06-27T17:41:56Z PMID:39865885 experimental_condition_ontology XCO:0001671 multigenerational maternal exposure to controlled air ozone oxygen content This is any condition in which the main influencing factor is any parental exposure to controlled air ozone content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal/paternal (F0) controlled air ozone content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. Paternal exposure to controlled air ozone content may occur anytime before successful copulation. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to controlled air ozone content. This is a condition typically studied to determine the effect of maternal (F0) controlled air ozone content exposure on the F1 offspring. slaulederkind 2025-06-30T10:33:14Z PMID:39865885 maternal exposure to controlled air O3 content during pregnancy maternal exposure to controlled air ozone content during pregnancy experimental_condition_ontology XCO:0001672 gestational maternal exposure to controlled air ozone content This is any condition in which the main influencing factor is any gestational maternal exposure to controlled air ozone content. This is a condition typically studied to determine the effect of maternal (F0) controlled air ozone content exposure on the F1 offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a peripheral nerve stump conduit implantation, which aids the regeneration of a nerve from a proximal stump caused by transection, ablation, or other damage. Ideally, the conduit guides the regenerating nerve from the proximal to distal stump, therefore replacing the portion of the nerve that has been damaged or removed. Materials used for nerve conduits may be natural or synthetic, absorbable or nonabsorbable. slaulederkind 2025-07-15T14:31:50Z GEO:GSE280040 nerve conduit implantation experimental_condition_ontology XCO:0001673 peripheral nerve stump conduit implantation This is any condition in which the main influencing factor is a peripheral nerve stump conduit implantation, which aids the regeneration of a nerve from a proximal stump caused by transection, ablation, or other damage. Ideally, the conduit guides the regenerating nerve from the proximal to distal stump, therefore replacing the portion of the nerve that has been damaged or removed. Materials used for nerve conduits may be natural or synthetic, absorbable or nonabsorbable. PMID:26491662 PMID:39746959 This is any condition in which the main influencing factor is a peripheral nerve stump cone-shaped conduit implantation, which aids the regeneration of a nerve from a proximal stump caused by transection, ablation, or other damage. The conduit is created in the shape of a frustum of a cone, with the proximal diameter greater than the distal diameter. Ideally, the spatially-constrained, cone-shaped conduit guides the regenerating nerve from the proximal to distal stump more efficently than a cylindrical conduit. slaulederkind 2025-07-15T15:00:14Z GEO:GSE280040 peripheral nerve frustum cone-shaped, spatially-confined conduit implantation peripheral nerve frustum cone-shaped, spatially-constrained conduit implantation peripheral nerve stump CC implantation peripheral nerve stump cone-shaped conduit implantation experimental_condition_ontology XCO:0001674 peripheral nerve cone-shaped conduit implantation This is any condition in which the main influencing factor is a peripheral nerve stump cone-shaped conduit implantation, which aids the regeneration of a nerve from a proximal stump caused by transection, ablation, or other damage. The conduit is created in the shape of a frustum of a cone, with the proximal diameter greater than the distal diameter. Ideally, the spatially-constrained, cone-shaped conduit guides the regenerating nerve from the proximal to distal stump more efficently than a cylindrical conduit. PMID:39746959 This is any condition in which the main influencing factor is a peripheral nerve stump cylinder-shaped conduit implantation, which aids the regeneration of a nerve from a proximal stump caused by transection, ablation, or other damage. Ideally, the conduit guides the regenerating nerve from the proximal to distal stump, therefore replacing the portion of the nerve that has been damaged or removed. slaulederkind 2025-07-15T15:14:12Z cylindrical conduit nerve implantation peripheral nerve cylindrical conduit implantation peripheral nerve stump TC implantation traditional cylindrical nerve conduit implantation experimental_condition_ontology XCO:0001675 peripheral nerve cylinder-shaped conduit implantation This is any condition in which the main influencing factor is a peripheral nerve stump cylinder-shaped conduit implantation, which aids the regeneration of a nerve from a proximal stump caused by transection, ablation, or other damage. Ideally, the conduit guides the regenerating nerve from the proximal to distal stump, therefore replacing the portion of the nerve that has been damaged or removed. PMID:26491662 PMID:39746959 This is any condition in which the main influencing factor is verteporfin, a benzoporphyrin derivative used as a photosensitizer in photodynamic therapy to eliminate abnormal blood vessels in the eye associated with neovascular (wet) age-related macular degeneration. slaulederkind 2025-07-15T16:49:40Z GEO:GSE280040 MESH:D000077362 PMID:39746959 Visudyne experimental_condition_ontology XCO:0001676 verteporfin This is any condition in which the main influencing factor is verteporfin, a benzoporphyrin derivative used as a photosensitizer in photodynamic therapy to eliminate abnormal blood vessels in the eye associated with neovascular (wet) age-related macular degeneration. CHEBI:32293 This is any condition in which the main influencing factor is standard rat chow supplemented with powdered milk and fruit. Standard rat chow is a laboratory foodstuff which typically has 380-390 kcal/100 g with 9-10% of calories derived from fat, 70-80% of calories derived from carbohydrate, and 10-15% of calories derived from protein. Additional calories and nutrients would come from dried fruit and milk. slaulederkind 2025-07-15T17:16:19Z standard rodent chow supplemented with powdered milk and fruit GEO:GSE143555 experimental_condition_ontology XCO:0001677 standard rat chow supplemented with powdered milk and fruit This is any condition in which the main influencing factor is standard rat chow supplemented with powdered milk and fruit. Standard rat chow is a laboratory foodstuff which typically has 380-390 kcal/100 g with 9-10% of calories derived from fat, 70-80% of calories derived from carbohydrate, and 10-15% of calories derived from protein. Additional calories and nutrients would come from dried fruit and milk. PMID:34107264 This is any condition in which the main influencing factor is a controlled whole egg content diet, a regimen of solid food in which the amount of whole dried chicken egg consumed is controlled. A whole egg lab chow diet is one which has close to half of the total chow weight made up of powdered chicken eggs. slaulederkind 2025-07-17T08:34:40Z GEO:GSE157491 controlled whole chicken egg content diet experimental_condition_ontology XCO:0001678 controlled whole egg content diet This is any condition in which the main influencing factor is a controlled whole egg content diet, a regimen of solid food in which the amount of whole dried chicken egg consumed is controlled. A whole egg lab chow diet is one which has close to half of the total chow weight made up of powdered chicken eggs. PMID:33141822 This is any condition in which the main influencing factor is any maternal exposure to limited bedding and nesting that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) limited bedding and nesting use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-07-17T09:26:12Z GEO:GSE297538 PMID:40445441 experimental_condition_ontology XCO:0001679 multigenerational maternal exposure to limited bedding and nesting This is any condition in which the main influencing factor is any maternal exposure to limited bedding and nesting that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) limited bedding and nesting use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is butane-1,3-diol, a butanediol commonly used as a solvent for flavoring agents and is a co-monomer used in certain polyurethane and polyester resins. It is also used as a hypoglycemic agent. slaulederkind 2025-07-17T09:32:47Z CHEBI:52683 MESH:C028491 1,3-Butanediol 1,3-butylene glycol butylene glycol experimental_condition_ontology XCO:0001680 butane-1,3-diol This is any condition in which the main influencing factor is butane-1,3-diol, a butanediol commonly used as a solvent for flavoring agents and is a co-monomer used in certain polyurethane and polyester resins. It is also used as a hypoglycemic agent. CID:7896 This is any condition in which the main influencing factor is a drink made up of water and a specified amount of butane-1,3-diol consumed by an organism as part of an experiment. Butane-1,3-diol is a butanediol commonly used as a solvent for flavoring agents and is a co-monomer used in certain polyurethane and polyester resins. It is also used as a hypoglycemic agent. slaulederkind 2025-07-17T09:45:48Z CHEBI:52683 GEO:GSE298451 MESH:C028491 controlled 1,3-Butanediol content drinking water controlled 1,3-butylene glycol content drinking water controlled butylene glycol content drinking water experimental_condition_ontology XCO:0001681 controlled butane-1,3-diol content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of butane-1,3-diol consumed by an organism as part of an experiment. Butane-1,3-diol is a butanediol commonly used as a solvent for flavoring agents and is a co-monomer used in certain polyurethane and polyester resins. It is also used as a hypoglycemic agent. CID:7896 This is any condition in which the main influencing factor is diazepam, a 1,4-benzodiazepinone that has a role as a xenobiotic, an environmental contaminant, an anxiolytic drug, an anticonvulsant and a sedative. It is also an organochlorine compound. slaulederkind 2025-07-17T10:10:17Z CHEBI:49575 GEO:GSE143555 MESH:D003975 PMID:34107264 7-Chloro-1,3-dihydro-1-methyl-5-phenyl-2H-1,4-benzodiazepin-2-one experimental_condition_ontology XCO:0001682 diazepam This is any condition in which the main influencing factor is diazepam, a 1,4-benzodiazepinone that has a role as a xenobiotic, an environmental contaminant, an anxiolytic drug, an anticonvulsant and a sedative. It is also an organochlorine compound. CID:3016 This is any condition in which the main influencing factor is any maternal exposure to limited bedding and nesting during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) limited bedding and nesting use/exposure during the postnatal, preweaning period on the F1 offspring. slaulederkind 2025-07-17T10:25:07Z GEO:GSE297538 maternal exposure to limited bedding and nesting during nursing of offspring experimental_condition_ontology XCO:0001683 maternal exposure to limited bedding and nesting during nursing This is any condition in which the main influencing factor is any maternal exposure to limited bedding and nesting during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) limited bedding and nesting use/exposure during the postnatal, preweaning period on the F1 offspring. PMID:40445441 https://www.merriam-webster.com This is any condition in which the main influencing factor is empagliflozin, an inhibitor of sodium-glucose co-transporter-2 (SGLT2), the transporter primarily responsible for the reabsorption of glucose in the kidney. It is used as a hypoglycemic agent for the management of type 2 diabetes mellitus. slaulederkind 2025-07-18T10:46:51Z CHEBI:82720 GEO:GSE263155 MESH:C570240 PMID:40409667 (1S)-1,5-anhydro-1-(4-chloro-3-{4-[(3S)-tetrahydrofuran-3-yloxy]benzyl}phenyl)-D-glucitol Jardiance experimental_condition_ontology XCO:0001684 empagliflozin This is any condition in which the main influencing factor is empagliflozin, an inhibitor of sodium-glucose co-transporter-2 (SGLT2), the transporter primarily responsible for the reabsorption of glucose in the kidney. It is used as a hypoglycemic agent for the management of type 2 diabetes mellitus. CID:11949646 This is any condition in which the main influencing factor is a controlled empagliflozin content diet, a regimen of solid food in which the amount of empagliflozin consumed is controlled. Empagliflozin is an inhibitor of sodium-glucose co-transporter-2 (SGLT2), the transporter primarily responsible for the reabsorption of glucose in the kidney. It is used as a hypoglycemic agent for the management of type 2 diabetes mellitus. slaulederkind 2025-07-18T10:52:18Z CHEBI:82720 GEO:GSE263155 MESH:C570240 PMID:40409667 controlled (1S)-1,5-anhydro-1-(4-chloro-3-{4-[(3S)-tetrahydrofuran-3-yloxy]benzyl}phenyl)-D-glucitol content diet controlled Jardiance content diet experimental_condition_ontology XCO:0001685 controlled empagliflozin content diet This is any condition in which the main influencing factor is a controlled empagliflozin content diet, a regimen of solid food in which the amount of empagliflozin consumed is controlled. Empagliflozin is an inhibitor of sodium-glucose co-transporter-2 (SGLT2), the transporter primarily responsible for the reabsorption of glucose in the kidney. It is used as a hypoglycemic agent for the management of type 2 diabetes mellitus. CID:11949646 This is any condition in which the main influencing factor is BT2, a mitochondrial branched-chain α-ketoacid dehydrogenase (BCKD) kinase (BCKDK/BDK) inhibitor. BT2 is also an MCL1 (MCL1 apoptosis regulator, BCL2 family member) inhibitor. slaulederkind 2025-07-18T12:12:17Z CID:739884 GEO:GSE263155 PMID:40409667 3,6-Dichlorobenzo[b]thiophene-2-carboxylic acid 3,6-Dichlorobenzothiophene-2-carboxylic acid 3,6-dichloro-1-benzothiophene-2-carboxylate experimental_condition_ontology XCO:0001686 BT2 This is any condition in which the main influencing factor is BT2, a mitochondrial branched-chain α-ketoacid dehydrogenase (BCKD) kinase (BCKDK/BDK) inhibitor. BT2 is also an MCL1 (MCL1 apoptosis regulator, BCL2 family member) inhibitor. https://www.chemicalbook.com/ChemicalProductProperty_EN_CB01492789.htm https://www.sigmaaldrich.com/US/en/product/sigma/sml3706 This is any condition in which the main influencing factor is a controlled BT2 content diet, a regimen of solid food in which the amount of BT2 consumed is controlled. BT2 (3,6-Dichloro-1-benzothiophene-2-carboxylic acid) is a small-molecule BCKDK (branched chain ketoacid dehydrogenase kinase) inhibitor that enhances branched-chain amino acid (BCAA) catabolism. slaulederkind 2025-07-18T12:32:19Z CID:739884 GEO:GSE263155 PMID:40409667 controlled 3,6-Dichloro-1-benzothiophene-2-carboxylic acid content diet controlled 3,6-Dichlorobenzo[b]thiophene-2-carboxylic acid content diet controlled 3,6-dichloro-1-benzothiophene-2-carboxylate content diet experimental_condition_ontology XCO:0001687 controlled BT2 content diet This is any condition in which the main influencing factor is a controlled BT2 content diet, a regimen of solid food in which the amount of BT2 consumed is controlled. BT2 (3,6-Dichloro-1-benzothiophene-2-carboxylic acid) is a small-molecule BCKDK (branched chain ketoacid dehydrogenase kinase) inhibitor that enhances branched-chain amino acid (BCAA) catabolism. https://www.chemicalbook.com/ChemicalProductProperty_EN_CB01492789.htm https://www.merriam-webster.com/ This is any condition in which the main influencing factor is allogeneic platelet-rich plasma, a concentrate of non-self plasma derived from whole blood (centrifuged to remove red blood cells but retaining platelets). PRP (platelet-rich plasma) contains multiple growth factors and other cytokines that can stimulate the healing of soft tissues and joints. slaulederkind 2025-07-18T13:09:29Z GEO:GSE266521 allogeneic PRP allogenic PRP allogenic platelet-rich plasma experimental_condition_ontology XCO:0001688 allogeneic platelet-rich plasma This is any condition in which the main influencing factor is allogeneic platelet-rich plasma, a concentrate of non-self plasma derived from whole blood (centrifuged to remove red blood cells but retaining platelets). PRP (platelet-rich plasma) contains multiple growth factors and other cytokines that can stimulate the healing of soft tissues and joints. https://en.wikipedia.org/wiki/Platelet-rich_plasma This is any condition in which the main influencing factor is mitoquinone, a synthetic analogue of coenzyme Q10 which has antioxidant effects. The Mitoquinone molecule is based on a novel technology, targeted lipophilic cations, that transport and concentrate antioxidants into the mitochondria, where they accumulate up to a thousand fold. slaulederkind 2025-07-22T11:38:45Z CID:11388332 GEO:GSE131040 MESH:C429014 PMID:33344732 10-(4,5-dimethoxy-2-methyl-3,6-dioxocyclohexa-1,4-dien-1-yl)decyl-triphenylphosphanium methanesulfonate MitoQ mitoquinone mesylate experimental_condition_ontology XCO:0001689 mitoquinone This is any condition in which the main influencing factor is mitoquinone, a synthetic analogue of coenzyme Q10 which has antioxidant effects. The Mitoquinone molecule is based on a novel technology, targeted lipophilic cations, that transport and concentrate antioxidants into the mitochondria, where they accumulate up to a thousand fold. CHEBI:233321 https://en.wikipedia.org/wiki/Mitoquinone_mesylate This is any condition in which the main influencing factor is nanoparticle-bound mitoquinone, a particle with a size between 1 and 100 nanometers that has mitoquinone attached to it. This particle allows delivery of mitoquinone to the placenta without crossing the placenta. slaulederkind 2025-07-22T11:58:17Z CHEBI:233321 CID:11388332 GEO:GSE131040 MESH:C429014 mitoquinone-nanoparticle nanoparticle-bound mitoquinone experimental_condition_ontology XCO:0001690 MitoQ-NP This is any condition in which the main influencing factor is nanoparticle-bound mitoquinone, a particle with a size between 1 and 100 nanometers that has mitoquinone attached to it. This particle allows delivery of mitoquinone to the placenta without crossing the placenta. PMID:33344732 http://en.wikipedia.org/wiki/Nanoparticle This is any condition in which the main influencing factor is any maternal exposure to MitoQ-NP that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) MitoQ-NP use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-07-22T12:19:13Z CHEBI:233321 CID:11388332 GEO:GSE131040 MESH:C429014 multigenerational maternal exposure to nanoparticle-bound mitoquinone experimental_condition_ontology XCO:0001691 multigenerational maternal exposure to MitoQ-NP This is any condition in which the main influencing factor is any maternal exposure to MitoQ-NP that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) MitoQ-NP use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 PMID:33344732 This is any condition in which the main influencing factor is any gestational maternal exposure to MitoQ-NP (nanoparticle-bound mitoquinone). This is a condition typically studied to determine the effect of maternal (F0) MitoQ-NP use/exposure on the F1 offspring. slaulederkind 2025-07-22T12:31:53Z CHEBI:233321 CID:11388332 GSE131040 MESH:C429014 gestational maternal exposure to nanoparticle-bound mitoquinone maternal exposure to MitoQ-NP during pregnancy experimental_condition_ontology XCO:0001692 gestational maternal exposure to MitoQ-NP This is any condition in which the main influencing factor is any gestational maternal exposure to MitoQ-NP (nanoparticle-bound mitoquinone). This is a condition typically studied to determine the effect of maternal (F0) MitoQ-NP use/exposure on the F1 offspring. PMID:33344732 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is housing of pairs with intruder-resident paradigm. This paradigm typically involves two male rodents, but may be modified to involve two pregnant-lactating rodents. The experimental purpose of this paradigm is to study social stress. slaulederkind 2025-07-22T13:30:32Z PMID:20136688 housing with defeat paradigm housing with acute defeat paradigm housing with chronic defeat paradigm experimental_condition_ontology XCO:0001693 housing with intruder-resident paradigm This is any condition in which the main influencing factor is housing of pairs with intruder-resident paradigm. This paradigm typically involves two male rodents, but may be modified to involve two pregnant-lactating rodents. The experimental purpose of this paradigm is to study social stress. PMID:33344732 https://www.sciencedirect.com/topics/medicine-and-dentistry/resident-intruder This is any condition in which the main influencing factor is any maternal exposure to housing with intruder-resident paradigm that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) housing with intruder-resident paradigm exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-07-22T13:42:42Z GEO:GSE131040 PMID:20136688 multigenerational maternal exposure to housing with defeat paradigm multigenerational maternal exposure to housing with acute defeat paradigm multigenerational maternal exposure to housing with chronic defeat paradigm experimental_condition_ontology XCO:0001694 multigenerational maternal exposure to housing with intruder-resident paradigm This is any condition in which the main influencing factor is any maternal exposure to housing with intruder-resident paradigm that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) housing with intruder-resident paradigm exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 PMID:33344732 This is any condition in which the main influencing factor is any gestational maternal exposure to housing with intruder-resident paradigm. This is a condition typically studied to determine the effect of maternal (F0) housing with intruder-resident paradigm exposure on the F1 offspring. slaulederkind 2025-07-22T14:06:40Z GEO:GSE131040 PMID:20136688 gestational maternal exposure to housing with acute defeat paradigm gestational maternal exposure to housing with chronic defeat paradigm gestational maternal exposure to housing with defeat paradigm maternal exposure to housing with intruder-resident paradigm during pregnancy experimental_condition_ontology gestational maternal exposure to social stress XCO:0001695 gestational maternal exposure to housing with intruder-resident paradigm This is any condition in which the main influencing factor is any gestational maternal exposure to housing with intruder-resident paradigm. This is a condition typically studied to determine the effect of maternal (F0) housing with intruder-resident paradigm exposure on the F1 offspring. PMID:25839742 PMID:33344732 This is any condition in which the main influencing factor is a methionine/choline deficient diet. This diet is used to study induction of non-alcoholic steatohepatitis (NASH) in experimental animal models. slaulederkind 2025-07-22T14:59:46Z CHEBI:15354 CHEBI:16811 GEO:GSE138666 PMID:34013171 MCD diet MCD-diet methionine choline deficient diet experimental_condition_ontology XCO:0001696 methionine/choline deficient diet This is any condition in which the main influencing factor is a methionine/choline deficient diet. This diet is used to study induction of non-alcoholic steatohepatitis (NASH) in experimental animal models. https://www.mpbio.com/us/methionine-choline-deficient-diet-pelleted This is any condition in which the main influencing factor is gene transfer of the Cre recombinase gene (a bacteriophage P1 enzyme) using an adeno-associated virus vector. Gene transfer into a cell or organism using an adeno-associated virus vector is performed to induce synthesis of the carried gene's product in the recipient cell or organism. slaulederkind 2025-08-29T10:00:27Z PMID:31329100 gene transduction of the Cre recombinase gene using an AAV vector gene transduction of the Cre recombinase gene using an adeno-associated virus vector gene transfer of the Cre recombinase gene using an AAV vector gene transfer of AAV8-hSyn-Cre experimental_condition_ontology XCO:0001697 gene transfer of the Cre recombinase gene using an adeno-associated virus vector This is any condition in which the main influencing factor is gene transfer of the Cre recombinase gene (a bacteriophage P1 enzyme) using an adeno-associated virus vector. Gene transfer into a cell or organism using an adeno-associated virus vector is performed to induce synthesis of the carried gene's product in the recipient cell or organism. https://en.wikipedia.org/wiki/Cre_recombinase This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of collapsin response mediator protein 1 (CRMP1) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) CRMP1 exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-03T16:35:56Z multigenerational maternal exposure to CRMP-1 multiple antigenic peptides multigenerational maternal exposure to CRMP1 MAPs multigenerational maternal exposure to CRMP1 multiple antigenic peptides multigenerational maternal exposure to DPYSL1 multiple antigenic peptides multigenerational maternal exposure to DRP-1 multiple antigenic peptides multigenerational maternal exposure to DRP1 multiple antigenic peptides multigenerational maternal exposure to collapsin response mediator protein 1 MAPs multigenerational maternal exposure to collapsin response mediator protein 1 multiple antigenic peptides multigenerational maternal exposure to dihydropyrimidinase related protein 1 multiple antigenic peptides multigenerational maternal exposure to dihydropyrimidinase-like 1 multiple antigenic peptides experimental_condition_ontology XCO:0001698 multigenerational maternal exposure to collapsin response mediator protein 1 MAPs This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of collapsin response mediator protein 1 (CRMP1) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) CRMP1 exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:29972240 PMID:39929953 This is any condition in which the main influencing factor is collapsin response mediator protein 1 (CRMP1), a cytosolic phosphoprotein expressed exclusively in the nervous system and probably involved in neural development. slaulederkind 2025-10-03T16:36:45Z PMID:39929953 CRMP-1 CRMP1 DPYSL1 DRP-1 DRP1 dihydropyrimidinase related protein-1 dihydropyrimidinase-like 1 experimental_condition_ontology XCO:0001699 collapsin response mediator protein 1 This is any condition in which the main influencing factor is collapsin response mediator protein 1 (CRMP1), a cytosolic phosphoprotein expressed exclusively in the nervous system and probably involved in neural development. RGD:731741 This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of collapsin response mediator protein 1 (CRMP1) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) CRMP1 exposure on the F1 offspring. slaulederkind 2025-10-03T16:54:12Z pregestational maternal exposure to CRMP-1 multiple antigenic peptides pregestational maternal exposure to CRMP1 MAPs pregestational maternal exposure to CRMP1 multiple antigenic peptides pregestational maternal exposure to DPYSL1 multiple antigenic peptides pregestational maternal exposure to DRP-1 multiple antigenic peptides pregestational maternal exposure to DRP1 multiple antigenic peptides pregestational maternal exposure to collapsin response mediator protein 1 multiple antigenic peptides pregestational maternal exposure to dihydropyrimidinase related protein-1 multiple antigenic peptides pregestational maternal exposure to dihydropyrimidinase-like 1 multiple antigenic peptides experimental_condition_ontology XCO:0001700 pregestational maternal exposure to collapsin response mediator protein 1 MAPs This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of collapsin response mediator protein 1 (CRMP1) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) CRMP1 exposure on the F1 offspring. PMID:39929953 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of collapsin response mediator protein 2 (CRMP2) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) collapsin response mediator protein 2 exposure on the F1 offspring. slaulederkind 2025-10-06T19:57:20Z pregestational maternal exposure to CRMP-2 multiple antigenic peptides pregestational maternal exposure to CRMP2 MAPs pregestational maternal exposure to CRMP2 multiple antigenic peptides pregestational maternal exposure to DPYSL2 multiple antigenic peptides pregestational maternal exposure to collapsin response mediator protein 2 multiple antigenic peptides pregestational maternal exposure to dihydropyrimidinase related protein-2 multiple antigenic peptides pregestational maternal exposure to dihydropyrimidinase-like 2 multiple antigenic peptides experimental_condition_ontology XCO:0001701 pregestational maternal exposure to collapsin response mediator protein 2 MAPs This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of collapsin response mediator protein 2 (CRMP2) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) collapsin response mediator protein 2 exposure on the F1 offspring. PMID:39929953 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of collapsin response mediator protein 2 (CRMP2) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) CRMP2 exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-06T20:06:06Z multigenerational maternal exposure to CRMP-2 multiple antigenic peptides multigenerational maternal exposure to CRMP2 MAPs multigenerational maternal exposure to CRMP2 multiple antigenic peptides multigenerational maternal exposure to DPYSL 2 multiple antigenic peptides multigenerational maternal exposure to collapsin response mediator protein 2 multiple antigenic peptides multigenerational maternal exposure to dihydropyrimidinase related protein 2 multiple antigenic peptides multigenerational maternal exposure to dihydropyrimidinase-like 2 multiple antigenic peptides experimental_condition_ontology XCO:0001702 multigenerational maternal exposure to collapsin response mediator protein 2 MAPs This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of collapsin response mediator protein 2 (CRMP2) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) CRMP2 exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:29972240 PMID:39929953 This is any condition in which the main influencing factor is collapsin response mediator protein 2 (CRMP2), a protein that facilitates neuron guidance, growth and polarity. CRMP2 also plays a role in microtubule assembly and synaptic signaling through interactions with calcium channels. slaulederkind 2025-10-06T20:17:44Z PMID:39929953 CRMP-2 CRMP2 DPYSL2 dihydropyrimidinase related protein 2 dihydropyrimidinase-like 2 experimental_condition_ontology XCO:0001703 collapsin response mediator protein 2 This is any condition in which the main influencing factor is collapsin response mediator protein 2 (CRMP2), a protein that facilitates neuron guidance, growth and polarity. CRMP2 also plays a role in microtubule assembly and synaptic signaling through interactions with calcium channels. RGD:737388 This is any condition in which the main influencing factor is stress induced phosphoprotein 1 (STIP1), an adaptor protein that coordinates the functions of HSP70 and HSP90 in protein folding by assisting in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90. slaulederkind 2025-10-06T20:31:00Z HOP Hsp70/Hsp90-organizing protein STI1 STI1L STIP1 experimental_condition_ontology XCO:0001704 stress induced phosphoprotein 1 This is any condition in which the main influencing factor is stress induced phosphoprotein 1 (STIP1), an adaptor protein that coordinates the functions of HSP70 and HSP90 in protein folding by assisting in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90. RGD:733337 This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of stress induced phosphoprotein 1 (STIP1) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) STIP1 exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-06T20:40:05Z multigenerational maternal exposure to HOP multiple antigenic peptides multigenerational maternal exposure to Hsp70/Hsp90-organizing protein multiple antigenic peptides multigenerational maternal exposure to STI1 multiple antigenic peptides multigenerational maternal exposure to STI1L multiple antigenic peptides multigenerational maternal exposure to STIP1 MAPs multigenerational maternal exposure to STIP1 multiple antigenic peptides multigenerational maternal exposure to stress induced phosphoprotein 1 multiple antigenic peptides experimental_condition_ontology XCO:0001705 multigenerational maternal exposure to stress induced phosphoprotein 1 MAPs This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of stress induced phosphoprotein 1 (STIP1) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) STIP1 exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:29972240 PMID:39929953 This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of stress induced phosphoprotein 1 (STIP1) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) STIP1 exposure on the F1 offspring. slaulederkind 2025-10-06T21:06:23Z multigenerational maternal exposure to HOP multiple antigenic peptides multigenerational maternal exposure to Hsp70/Hsp90-organizing protein multiple antigenic peptides multigenerational maternal exposure to STI1 multiple antigenic peptides multigenerational maternal exposure to STI1L multiple antigenic peptides multigenerational maternal exposure to STIP1 MAPs multigenerational maternal exposure to STIP1 multiple antigenic peptides pregestational maternal exposure to stress induced phosphoprotein 1 multiple antigenic peptides experimental_condition_ontology XCO:0001706 pregestational maternal exposure to stress induced phosphoprotein 1 MAPs This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of stress induced phosphoprotein 1 (STIP1) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) STIP1 exposure on the F1 offspring. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is enolase 2 (ENO2), an enolase isoenzyme, found in neurons and cells of neuronal origin. ENO2 is an enzyme with phosphopyruvate hydratase activity involved in gluconeogenesis. slaulederkind 2025-10-09T10:10:31Z 2-phospho-D-glycerate hydrolyase ENO2 NSE gamma enolase neural enolase neuron-specific enolase experimental_condition_ontology XCO:0001707 enolase 2 This is any condition in which the main influencing factor is enolase 2 (ENO2), an enolase isoenzyme, found in neurons and cells of neuronal origin. ENO2 is an enzyme with phosphopyruvate hydratase activity involved in gluconeogenesis. RGD:733932 This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of enolase 2 (ENO2) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) ENO2 exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-09T12:10:51Z multigenerational maternal exposure to 2-phospho-D-glycerate hydrolyase multiple antigenic peptides multigenerational maternal exposure to ENO2 MAPs multigenerational maternal exposure to ENO2 multiple antigenic peptides multigenerational maternal exposure to NSE multiple antigenic peptides multigenerational maternal exposure to enolase 2 multiple antigenic peptides multigenerational maternal exposure to gamma enolase multiple antigenic peptides multigenerational maternal exposure to neural enolase multiple antigenic peptides multigenerational maternal exposure to neuron-specific enolase multiple antigenic peptides experimental_condition_ontology XCO:0001708 multigenerational maternal exposure to enolase 2 MAPs This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of enolase 2 (ENO2) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) ENO2 exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:29972240 PMID:39929953 This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of enolase 2 (ENO2) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) ENO2 exposure on the F1 offspring. slaulederkind 2025-10-09T12:29:36Z PMID:39929953 pregestational maternal exposure to 2-phospho-D-glycerate hydrolyase multiple antigenic peptides pregestational maternal exposure to ENO2 MAPs pregestational maternal exposure to ENO2 multiple antigenic peptides pregestational maternal exposure to NSE multiple antigenic peptides pregestational maternal exposure to enolase 2 multiple antigenic peptides pregestational maternal exposure to gamma enolase multiple antigenic peptides pregestational maternal exposure to neural enolase multiple antigenic peptides pregestational maternal exposure to neuron-specific enolase multiple antigenic peptides experimental_condition_ontology XCO:0001709 pregestational maternal exposure to enolase 2 MAPs This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of enolase 2 (ENO2) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) ENO2 exposure on the F1 offspring. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is guanine deaminase, an enzyme responsible for the hydrolytic deamination of guanine. Guanine deaminase plays a role in microtubule assembly. slaulederkind 2025-10-09T13:08:39Z CYPIN GAH GDA cytoplasmic PSD95 interactor guanase guanine aminase guanine aminohydrolase experimental_condition_ontology XCO:0001710 guanine deaminase This is any condition in which the main influencing factor is guanine deaminase, an enzyme responsible for the hydrolytic deamination of guanine. Guanine deaminase plays a role in microtubule assembly. RGD:734048 This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of guanine deaminase (GDA) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) GDA exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-09T14:28:11Z multigenerational maternal exposure to CYPIN multiple antigenic peptides multigenerational maternal exposure to GAH multiple antigenic peptides multigenerational maternal exposure to GDA MAPs multigenerational maternal exposure to GDA multiple antigenic peptides multigenerational maternal exposure to cytoplasmic PSD95 interactor multiple antigenic peptides multigenerational maternal exposure to guanase multiple antigenic peptides multigenerational maternal exposure to guanine aminase multiple antigenic peptides multigenerational maternal exposure to guanine aminohydrolase multiple antigenic peptides multigenerational maternal exposure to guanine deaminase multiple antigenic peptides experimental_condition_ontology XCO:0001711 multigenerational maternal exposure to guanine deaminase MAPs This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of guanine deaminase (GDA) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) GDA exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:29972240 PMID:39929953 This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of guanine deaminase (GDA) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) GDA exposure on the F1 offspring. slaulederkind 2025-10-09T14:35:52Z PMID:39929953 pregestational maternal exposure to CYPIN multiple antigenic peptides pregestational maternal exposure to GAH multiple antigenic peptides pregestational maternal exposure to GDA MAPs pregestational maternal exposure to GDA multiple antigenic peptides pregestational maternal exposure to cytoplasmic PSD95 interactor multiple antigenic peptides pregestational maternal exposure to guanase multiple antigenic peptides pregestational maternal exposure to guanine aminase multiple antigenic peptides pregestational maternal exposure to guanine aminohydrolase multiple antigenic peptides pregestational maternal exposure to guanine deaminase multiple antigenic peptides experimental_condition_ontology XCO:0001712 pregestational maternal exposure to guanine deaminase MAPs This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of guanine deaminase (GDA) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) GDA exposure on the F1 offspring. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is lactate dehydrogenase A (LDHA), a subunit of an enzyme with L-lactate dehydrogenase (NAD+) activity that is involved in a post-glycolytic process. slaulederkind 2025-10-09T15:08:14Z L-lactate dehydrogenase A chain LDH muscle subunit LDH-A LDH-M LDH1 LDHA LDHM lactate dehydrogenase M experimental_condition_ontology XCO:0001713 lactate dehydrogenase A This is any condition in which the main influencing factor is lactate dehydrogenase A (LDHA), a subunit of an enzyme with L-lactate dehydrogenase (NAD+) activity that is involved in a post-glycolytic process. RGD:736025 This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of lactate dehydrogenase A (LDHA) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) LDHA exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-09T15:15:22Z multigenerational maternal exposure to L-lactate dehydrogenase A chain multiple antigenic peptides multigenerational maternal exposure to LDH muscle subunit multiple antigenic peptides multigenerational maternal exposure to LDH-A multiple antigenic peptides multigenerational maternal exposure to LDH-M multiple antigenic peptides multigenerational maternal exposure to LDH1 multiple antigenic peptides multigenerational maternal exposure to LDHA MAPs multigenerational maternal exposure to LDHM multiple antigenic peptides multigenerational maternal exposure to lactate dehydrogenase A multiple antigenic peptides multigenerational maternal exposure to lactate dehydrogenase M multiple antigenic peptides experimental_condition_ontology XCO:0001714 multigenerational maternal exposure to lactate dehydrogenase A MAPs This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of lactate dehydrogenase A (LDHA) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) LDHA exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:29972240 PMID:39929953 This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of lactate dehydrogenase A (LDHA) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) LDHA exposure on the F1 offspring. slaulederkind 2025-10-09T15:35:00Z PMID:39929953 pregestational maternal exposure to L-lactate dehydrogenase A chain multiple antigenic peptides pregestational maternal exposure to LDH muscle subunit multiple antigenic peptides pregestational maternal exposure to LDH-A multiple antigenic peptides pregestational maternal exposure to LDH-M multiple antigenic peptides pregestational maternal exposure to LDH1 multiple antigenic peptides pregestational maternal exposure to LDHA MAPs pregestational maternal exposure to LDHA multiple antigenic peptides pregestational maternal exposure to LDHM multiple antigenic peptides pregestational maternal exposure to lactate dehydrogenase A multiple antigenic peptides pregestational maternal exposure to lactate dehydrogenase M multiple antigenic peptides experimental_condition_ontology XCO:0001715 pregestational maternal exposure to lactate dehydrogenase A MAPs This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of lactate dehydrogenase A (LDHA) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) LDHA exposure on the F1 offspring. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is lactate dehydrogenase B (LDHB), a subunit of an enzyme with L-lactate dehydrogenase (NAD+) activity that is involved in a post-glycolytic process. slaulederkind 2025-10-10T10:03:19Z L-lactate dehydrogenase B chain LDH heart subunit LDH-B LDH-H LDHB lactate dehydrogenase H chain experimental_condition_ontology XCO:0001716 lactate dehydrogenase B This is any condition in which the main influencing factor is lactate dehydrogenase B (LDHB), a subunit of an enzyme with L-lactate dehydrogenase (NAD+) activity that is involved in a post-glycolytic process. RGD:735463 This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of lactate dehydrogenase B (LDHB) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) LDHB exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-10T10:29:43Z multigenerational maternal exposure to L-lactate dehydrogenase B chain multiple antigenic peptides multigenerational maternal exposure to LDH heart subunit multiple antigenic peptides multigenerational maternal exposure to LDH-B multiple antigenic peptides multigenerational maternal exposure to LDH-H multiple antigenic peptides multigenerational maternal exposure to LDHB MAPs multigenerational maternal exposure to LDHB multiple antigenic peptides multigenerational maternal exposure to lactate dehydrogenase B multiple antigenic peptides multigenerational maternal exposure to lactate dehydrogenase H chain multiple antigenic peptides experimental_condition_ontology XCO:0001717 multigenerational maternal exposure to lactate dehydrogenase B MAPs This is any condition in which the main influencing factor is any maternal exposure to an autoantibody-generating level of lactate dehydrogenase B (LDHB) multiple antigenic peptides (MAPs) that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) LDHB exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:29972240 PMID:39929953 This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of lactate dehydrogenase B (LDHB) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) LDHB exposure on the F1 offspring. slaulederkind 2025-10-10T10:34:58Z PMID:39929953 pregestational maternal exposure to L-lactate dehydrogenase B chain multiple antigenic peptides pregestational maternal exposure to LDH heart subunit multiple antigenic peptides pregestational maternal exposure to LDH-B multiple antigenic peptides pregestational maternal exposure to LDH-H multiple antigenic peptides pregestational maternal exposure to LDHB MAPs pregestational maternal exposure to LDHB multiple antigenic peptides pregestational maternal exposure to lactate dehydrogenase B multiple antigenic peptides pregestational maternal exposure to lactate dehydrogenase H chain multiple antigenic peptides experimental_condition_ontology XCO:0001718 pregestational maternal exposure to lactate dehydrogenase B MAPs This is any condition in which the main influencing factor is any pregestational maternal exposure to an autoantibody-generating level of lactate dehydrogenase B (LDHB) multiple antigenic peptides (MAPs). This is a condition typically studied to determine the effect of maternal (F0) LDHB exposure on the F1 offspring. ISBN-13:978-1455756438 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is lactate dehydrogenase A (LDHA) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). slaulederkind 2025-10-10T11:06:16Z L-lactate dehydrogenase A chain multiple antigenic peptides LDH muscle subunit multiple antigenic peptides LDH-A multiple antigenic peptides LDH-M multiple antigenic peptides LDH1 multiple antigenic peptides LDHA MAPs LDHA multiple antigenic peptides LDHM multiple antigenic peptides lactate dehydrogenase M multiple antigenic peptides experimental_condition_ontology XCO:0001719 lactate dehydrogenase A MAPs This is any condition in which the main influencing factor is lactate dehydrogenase A (LDHA) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). PMID:39929953 This is any condition in which the main influencing factor is lactate dehydrogenase B (LDHB) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). slaulederkind 2025-10-10T12:50:12Z L-lactate dehydrogenase B chain multiple antigenic peptides LDH heart subunit multiple antigenic peptides LDH-B multiple antigenic peptides LDH-H multiple antigenic peptides LDHB MAPs LDHB multiple antigenic peptides lactate dehydrogenase H chain multiple antigenic peptides experimental_condition_ontology XCO:0001720 lactate dehydrogenase B MAPs This is any condition in which the main influencing factor is lactate dehydrogenase B (LDHB) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). PMID:39929953 This is any condition in which the main influencing factor is stress induced phosphoprotein 1 (STIP1) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). slaulederkind 2025-10-10T15:31:42Z HOP multiple antigenic peptides Hsp70/Hsp90-organizing protein multiple antigenic peptides STI1 multiple antigenic peptides STI1L multiple antigenic peptides STIP1 MAPs STIP1 multiple antigenic peptides stress induced phosphoprotein 1 multiple antigenic peptides experimental_condition_ontology XCO:0001721 stress induced phosphoprotein 1 MAPs This is any condition in which the main influencing factor is stress induced phosphoprotein 1 (STIP1) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). PMID:39929953 This is any condition in which the main influencing factor is guanine deaminase presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). slaulederkind 2025-10-10T16:08:15Z CYPIN multiple antigenic peptides GAH multiple antigenic peptides GDA MAPs GDA multiple antigenic peptides cytoplasmic PSD95 interactor multiple antigenic peptides guanase multiple antigenic peptides guanine aminase multiple antigenic peptides guanine aminohydrolase multiple antigenic peptides guanine deaminase multiple antigenic peptides experimental_condition_ontology XCO:0001722 guanine deaminase MAPs This is any condition in which the main influencing factor is guanine deaminase presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). PMID:39929953 This is any condition in which the main influencing factor is enolase 2 (ENO2) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). slaulederkind 2025-10-10T16:38:26Z 2-phospho-D-glycerate hydrolyase multiple antigenic peptides ENO2 MAPs ENO2 multiple antigenic peptides NSE multiple antigenic peptides enolase 2 multiple antigenic peptides gamma enolase multiple antigenic peptides neural enolase multiple antigenic peptides neuron-specific enolase multiple antigenic peptides experimental_condition_ontology XCO:0001723 enolase 2 MAPs This is any condition in which the main influencing factor is enolase 2 (ENO2) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). PMID:39929953 This is any condition in which the main influencing factor is collapsin response mediator protein 2 (CRMP2) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). slaulederkind 2025-10-10T17:00:10Z CRMP-2 multiple antigenic peptides CRMP2 MAPs CRMP2 multiple antigenic peptides DPYSL2 multiple antigenic peptides collapsin response mediator protein 2 multiple antigenic peptides dihydropyrimidinase related protein 2 multiple antigenic peptides dihydropyrimidinase-like 2 multiple antigenic peptides experimental_condition_ontology XCO:0001724 collapsin response mediator protein 2 MAPs This is any condition in which the main influencing factor is collapsin response mediator protein 2 (CRMP2) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). PMID:39929953 This is any condition in which the main influencing factor is collapsin response mediator protein 1 (CRMP1) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). slaulederkind 2025-10-10T17:27:46Z CRMP-1 multiple antigenic peptides CRMP1 MAPs CRMP1 multiple antigenic peptides DPYSL1 multiple antigenic peptides DRP-1 multiple antigenic peptides DRP1 multiple antigenic peptides collapsin response mediator protein 1 multiple antigenic peptides dihydropyrimidinase related protein-1 multiple antigenic peptides dihydropyrimidinase-like 1 multiple antigenic peptides experimental_condition_ontology XCO:0001725 collapsin response mediator protein 1 MAPs This is any condition in which the main influencing factor is collapsin response mediator protein 1 (CRMP1) presented as multiple antigenic peptides (MAPs), which are four copies of the same peptide epitope synthesized on a lysine-based core (MAPs-4 system). PMID:39929953 This is any condition in which the main influencing factor is any maternal exposure to a mix of Freund's adjuvant and saline that serves as vehicle control for antibody-generating conditions that have multigenerational effects. These are conditions typically studied to determine the effect of a maternal (F0) exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-13T13:23:36Z multigenerational maternal exposure to Freund's adjuvant and 0.9% sodium chloride solution experimental_condition_ontology XCO:0001726 multigenerational maternal exposure to Freund's adjuvant and saline This is any condition in which the main influencing factor is any maternal exposure to a mix of Freund's adjuvant and saline that serves as vehicle control for antibody-generating conditions that have multigenerational effects. These are conditions typically studied to determine the effect of a maternal (F0) exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:39929953 This is any condition in which the main influencing factor is any pregestational maternal exposure to a mix of Freund's adjuvant and saline that serves as vehicle control for antibody-generating conditions that have multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) vehicle control exposure on the F1 offspring. slaulederkind 2025-10-13T13:44:52Z pregestational maternal exposure to Freund's adjuvant and 0.9% sodium chloride solution experimental_condition_ontology XCO:0001727 pregestational maternal exposure to Freund's adjuvant and saline This is any condition in which the main influencing factor is any pregestational maternal exposure to a mix of Freund's adjuvant and saline that serves as vehicle control for antibody-generating conditions that have multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) vehicle control exposure on the F1 offspring. PMID:39929953 This is any condition in which the main influencing factor is the transfer (transiently or stably) of the human CYP11A1 (cytochrome P450 family 11 subfamily A member 1) gene into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. slaulederkind 2025-10-14T16:57:35Z RGD:735631 adenoviral transfer of the human CYP11A1 gene gene transfer of the human cytochrome P450 family 11 subfamily A member 1 gene using an adenovirus vector transfer of recombinant adenovirus containing the human CYP11A1 gene experimental_condition_ontology XCO:0001728 gene transfer of the human CYP11A1 gene using an adenovirus vector This is any condition in which the main influencing factor is the transfer (transiently or stably) of the human CYP11A1 (cytochrome P450 family 11 subfamily A member 1) gene into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. PMID:35002603 This is any condition in which the main influencing factor is any maternal exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-14T17:11:20Z multigenerational maternal exposure to adenoviral transfer of the human CYP11A1 gene multigenerational maternal exposure to gene transfer of the human cytochrome P450 family 11 subfamily A member 1 gene using an adenovirus vector multigenerational maternal exposure to transfer of recombinant adenovirus containing the human CYP11A1 gene experimental_condition_ontology XCO:0001729 multigenerational maternal exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector This is any condition in which the main influencing factor is any maternal exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:35002603 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector. This is a condition typically studied to determine the effect of a maternal (F0) exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector on the F1 offspring. slaulederkind 2025-10-14T17:18:24Z gestational maternal exposure to adenoviral transfer of the human CYP11A1 gene gestational maternal exposure to gene transfer of the human cytochrome P450 family 11 subfamily A member 1 gene using an adenovirus vector gestational maternal exposure to transfer of recombinant adenovirus containing the human CYP11A1 gene maternal exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector during pregnancy experimental_condition_ontology XCO:0001730 gestational maternal exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector This is any condition in which the main influencing factor is any gestational maternal exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector. This is a condition typically studied to determine the effect of a maternal (F0) exposure to gene transfer of the human CYP11A1 gene using an adenovirus vector on the F1 offspring. PMID:35002603 https://www.merriam-webster.com This is any condition in which the main influencing factor is any maternal exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-14T18:22:31Z multigenerational maternal exposure to adenoviral transfer of the enhanced green fluorescent protein gene multigenerational maternal exposure to gene transfer of EGFP gene using an adenovirus vector multigenerational maternal exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector multigenerational maternal exposure to transfer of recombinant adenovirus containing the enhanced green fluorescent protein gene experimental_condition_ontology XCO:0001731 multigenerational maternal exposure to gene transfer of enhanced green fluorescent protein gene using an adenovirus vector This is any condition in which the main influencing factor is any maternal exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:35002603 https://www.merriam-webster.com This is any condition in which the main influencing factor is any gestational maternal exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector. This is a condition typically studied to determine the effect of a maternal (F0) exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector on the F1 offspring. slaulederkind 2025-10-14T18:30:48Z gestational maternal exposure to adenoviral transfer of the EGFP gene gestational maternal exposure to gene transfer of the EGFP gene using an adenovirus vector gestational maternal exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector gestational maternal exposure to transfer of recombinant adenovirus containing the enhanced green fluorescent protein gene maternal exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector during pregnancy experimental_condition_ontology XCO:0001732 gestational maternal exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector This is any condition in which the main influencing factor is any gestational maternal exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector. This is a condition typically studied to determine the effect of a maternal (F0) exposure to gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector on the F1 offspring. PMID:35002603 https://www.merriam-webster.com This is any condition in which the main influencing factor is an experimental transection of the rat spinal cord at the vertebral level of thoracic 8 (T8). This procedure involves exposure of the spinal cord at the vertebral level of thoracic 8-10 (T8-10) and complete transection of the isolated section of spinal cord at T8. slaulederkind 2025-10-21T17:26:23Z GEO:GSE294927 GEO:GSE294930 experimental spinal cord transection at thoracic 8 experimental_condition_ontology XCO:0001733 experimental spinal cord transection at T8 This is any condition in which the main influencing factor is an experimental transection of the rat spinal cord at the vertebral level of thoracic 8 (T8). This procedure involves exposure of the spinal cord at the vertebral level of thoracic 8-10 (T8-10) and complete transection of the isolated section of spinal cord at T8. ISBN-13:978-1455756438 PMID:40338665 This is any condition in which the main influencing factor is inosine, a purine nucleoside that is an intermediate in the degradation of purines and purine nucleosides to uric acid and in pathways of purine salvage. It also occurs in human tRNA molecules. Animal studies have suggested that inosine has neuroprotective properties slaulederkind 2025-10-21T17:40:54Z CHEBI:17596 CID:135398641 MESH:D007288 PMID:40338665 hypoxanthine D-riboside hypoxanthosine ribonosine experimental_condition_ontology XCO:0001734 inosine This is any condition in which the main influencing factor is inosine, a purine nucleoside that is an intermediate in the degradation of purines and purine nucleosides to uric acid and in pathways of purine salvage. It also occurs in human tRNA molecules. Animal studies have suggested that inosine has neuroprotective properties MESH:D007288 https://en.wikipedia.org/wiki/Inosine This is any condition in which the main influencing factor is sodium carbonate/sodium bicarbonate buffer, a combination of sodium carbonate/sodium bicarbonate in water to form a solution with a pH range of 9.2 to 10.6. slaulederkind 2025-10-21T18:04:13Z PMID:33387836 PMID:40338665 Na2CO3/NaHCO3 buffer sodium carbonate/sodium bicarbonate buffer solution experimental_condition_ontology sodium bicarbonate buffer XCO:0001735 sodium carbonate/sodium bicarbonate buffer This is any condition in which the main influencing factor is sodium carbonate/sodium bicarbonate buffer, a combination of sodium carbonate/sodium bicarbonate in water to form a solution with a pH range of 9.2 to 10.6. https://www.aatbio.com/resources/buffer-preparations-and-recipes/carbonate-bicarbonate-buffer-ph-9-2-to-10-6 https://www.merriam-webster.com This is any condition in which the main influencing factor is a uterine tissue autograft, a transplantation of autologous uterine tissue. This procedure is used as an experimentally induced model of endometriosis in laboratory animals. As an example, the grafted tissue may be removed from the uterine horn and attached to mesenteric arteries supplying the small intestine. slaulederkind 2025-10-23T11:14:13Z GEO:GSE296883 PMID:4054348 transplant of autologous uterine tissue uterine horn autograft experimental_condition_ontology XCO:0001736 uterine tissue autograft This is any condition in which the main influencing factor is a uterine tissue autograft, a transplantation of autologous uterine tissue. This procedure is used as an experimentally induced model of endometriosis in laboratory animals. As an example, the grafted tissue may be removed from the uterine horn and attached to mesenteric arteries supplying the small intestine. PMID:40502156 https://www.merriam-webster.com This is any condition in which the main influencing factor is simvastatin, a derivative of lovastatin and potent competitive inhibitor of 3-hydroxy-3-methylglutaryl coenzyme A reductase, which is the rate-limiting enzyme in cholesterol biosynthesis. It may also interfere with steroid hormone production. Due to the induction of hepatic LDL receptors, it increases breakdown of LDL cholesterol. slaulederkind 2025-10-23T11:46:48Z CHEBI:9150 CID:54454 GEO:GSE296883 PMID:40502156 Zocor experimental_condition_ontology XCO:0001737 simvastatin This is any condition in which the main influencing factor is simvastatin, a derivative of lovastatin and potent competitive inhibitor of 3-hydroxy-3-methylglutaryl coenzyme A reductase, which is the rate-limiting enzyme in cholesterol biosynthesis. It may also interfere with steroid hormone production. Due to the induction of hepatic LDL receptors, it increases breakdown of LDL cholesterol. MESH:D019821 This is any condition in which the main influencing factor is primaquine, an N-substituted diamine that is a drug used in the treatment of malaria and Pneumocystis pneumonia. It is an aminoquinoline and an aromatic ether. slaulederkind 2025-10-23T12:01:48Z CHEBI:8405 GEO:GSE296883 MESH:D011319 PMID:40502156 90-34-6 N(4)-(6-methoxyquinolin-8-yl)pentane-1,4-diamine experimental_condition_ontology XCO:0001738 primaquine This is any condition in which the main influencing factor is primaquine, an N-substituted diamine that is a drug used in the treatment of malaria and Pneumocystis pneumonia. It is an aminoquinoline and an aromatic ether. CID:4908 This is any condition in which the main influencing factor is dicyclohexyl phthalate,a phthalate ester. Phthalate esters are esters of phthalic acid and are mainly used as plasticizers and found in many commercial products. Phthalates are hazardous due to their ability to act as endocrine disruptors. slaulederkind 2025-10-23T14:46:03Z CAS:84-61-7 CHEBI:34693 MESH:C036042 DCHP experimental_condition_ontology XCO:0001739 dicyclohexyl phthalate This is any condition in which the main influencing factor is dicyclohexyl phthalate,a phthalate ester. Phthalate esters are esters of phthalic acid and are mainly used as plasticizers and found in many commercial products. Phthalates are hazardous due to their ability to act as endocrine disruptors. CID:6777 This is any condition in which the main influencing factor is any maternal exposure to dicyclohexyl phthalate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) dicyclohexyl phthalate exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-23T14:53:47Z GEO:GSE293297 multigenerational maternal exposure to DCHP experimental_condition_ontology XCO:0001740 multigenerational maternal exposure to dicyclohexyl phthalate This is any condition in which the main influencing factor is any maternal exposure to dicyclohexyl phthalate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) dicyclohexyl phthalate exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is gestational maternal exposure to dicyclohexyl phthalate. This is a condition typically studied to determine the effect of maternal (F0) exposure to dicyclohexyl phthalate on the F1 offspring. slaulederkind 2025-10-23T15:13:45Z GEO:GSE293297 gestational maternal exposure to DCHP maternal exposure to dicyclohexyl phthalate during pregnancy experimental_condition_ontology XCO:0001741 gestational maternal exposure to dicyclohexyl phthalate This is any condition in which the main influencing factor is gestational maternal exposure to dicyclohexyl phthalate. This is a condition typically studied to determine the effect of maternal (F0) exposure to dicyclohexyl phthalate on the F1 offspring. PMID:25839742 https://www.merriam-webster.com This is any condition in which the main influencing factor is gene transfer using plasmid vector pVAX1 as the carrier of the genetic material. The pVAX1 plasmid was designed for use in the development of DNA vaccines. slaulederkind 2025-10-23T18:09:10Z GEO:GSE206597 experimental_condition_ontology XCO:0001742 gene transfer using plasmid vector pVAX1 This is any condition in which the main influencing factor is gene transfer using plasmid vector pVAX1 as the carrier of the genetic material. The pVAX1 plasmid was designed for use in the development of DNA vaccines. https://www.thermofisher.com/order/catalog/product/V26020#/V26020 This is any condition in which the main influencing factor is gene transfer of an empty plasmid vector pVAX1 that has been transferred into a cell or organism.. The pVAX1 plasmid was designed for use in the development of DNA vaccines. slaulederkind 2025-10-23T18:14:11Z GEO:GSE206597 gene transfer using empty plasmid vector pVAX1 gene transfer using only the backbone of plasmid vector pVAX1 sham gene transfer using an empty plasmid pVAX1 vector sham gene transformation using an empty plasmid pVAX1 vector experimental_condition_ontology XCO:0001743 sham gene transfer using an empty plasmid vector pVAX1 This is any condition in which the main influencing factor is gene transfer of an empty plasmid vector pVAX1 that has been transferred into a cell or organism.. The pVAX1 plasmid was designed for use in the development of DNA vaccines. https://www.thermofisher.com/order/catalog/product/V26020#/V26020 This is any condition in which the major influencing factor is an empty plasmid vector has been transferred (transiently or stably) into a cell or organism. This condition is used as a control for a plasmid transfer of a specific gene. slaulederkind 2025-10-23T18:21:36Z GEO:GSE206597 empty plasmid vector transfer transformation using an empty plasmid vector experimental_condition_ontology XCO:0001744 sham gene transfer using an empty plasmid vector This is any condition in which the major influencing factor is an empty plasmid vector has been transferred (transiently or stably) into a cell or organism. This condition is used as a control for a plasmid transfer of a specific gene. https://en.wikipedia.org/wiki/Plasmid This is any condition in which the main influencing factor is gene transfer of the P.gingivalis fimA gene and HA2 protein domain using the plasmid vector pVAX1. The pVAX1 plasmid was designed for use in the development of DNA vaccines. The FimA gene and the HA2 domain are virulence factors that cooperate during bacterial infection by promoting adhesion and providing nutrients for colonization. slaulederkind 2025-10-27T09:32:21Z GEO:GSE206597 transformation with the P.gingivalis fimA gene and HA2 protein domain using the plasmid vector pVAX1 gene transfer of pVAX1-HA2-fimA experimental_condition_ontology XCO:0001745 gene transfer of the P.gingivalis fimA gene and HA2 protein domain using the plasmid vector pVAX1 This is any condition in which the main influencing factor is gene transfer of the P.gingivalis fimA gene and HA2 protein domain using the plasmid vector pVAX1. The pVAX1 plasmid was designed for use in the development of DNA vaccines. The FimA gene and the HA2 domain are virulence factors that cooperate during bacterial infection by promoting adhesion and providing nutrients for colonization. PMID:36838435 This is any condition in which the main influencing factor is an CpG-CpG oligodeoxynucleotide (ODN) adjuvant. CpG-ODN are short synthetic DNA molecules that mimic microbial DNA by activating Toll-like Receptor 9 (TLR9) and, when paired with a vaccine antigen, lead to increased production of antibodies and enhanced cellular immunity. slaulederkind 2025-10-27T13:09:42Z GEO:GSE206597 Cytosine-phosphorothioate-guanine oligodeoxynucleotide adjuvant cytosine-phosphate-guanine ODN adjuvant cytosine-phosphate-guanine oligodeoxynucleotide adjuvant experimental_condition_ontology XCO:0001746 CpG-ODN adjuvant This is any condition in which the main influencing factor is an CpG-CpG oligodeoxynucleotide (ODN) adjuvant. CpG-ODN are short synthetic DNA molecules that mimic microbial DNA by activating Toll-like Receptor 9 (TLR9) and, when paired with a vaccine antigen, lead to increased production of antibodies and enhanced cellular immunity. PMID:_29156818 This is any condition in which the main influencing factor is a left carotid artery occlusion sham procedure, which follows the same surgical process as a left common carotid artery occlusion without blocking the left common carotid artery or any other arteries. slaulederkind 2025-10-27T14:43:27Z GEO:GSE271722 left common carotid artery occlusion sham procedure experimental_condition_ontology XCO:0001747 left carotid artery occlusion sham procedure This is any condition in which the main influencing factor is a left carotid artery occlusion sham procedure, which follows the same surgical process as a left common carotid artery occlusion without blocking the left common carotid artery or any other arteries. PMID:40010549 This is any condition in which the main influencing factor is ibuprofen, a monocarboxylic acid that is propionic acid in which one of the hydrogens at position 2 is substituted by a 4-(2-methylpropyl)phenyl group. It is a non-steroidal anti-inflammatory agent (NSAID) with antipyretic and analgesic actions. slaulederkind 2025-10-27T16:18:15Z CID:3672 GEO:GSE296883 MESH:D007052 PMID:40502156 Advil Motrin experimental_condition_ontology XCO:0001748 ibuprofen This is any condition in which the main influencing factor is ibuprofen, a monocarboxylic acid that is propionic acid in which one of the hydrogens at position 2 is substituted by a 4-(2-methylpropyl)phenyl group. It is a non-steroidal anti-inflammatory agent (NSAID) with antipyretic and analgesic actions. CHEBI:5855 This is any condition in which the main influencing factor is fenoprofen, a monocarboxylic acid that is propanoic acid in which one of the hydrogens at position 2 is substituted by a 3-phenoxyphenyl group. Fenoprofen is a non-steroidal anti-inflammatory drug pharmacologically similar to aspirin, but it causes less gastrointestinal bleeding. slaulederkind 2025-10-27T16:30:44Z GEO:GSE296883 MESH:D005279 PMID:40502156 experimental_condition_ontology XCO:0001749 fenoprofen This is any condition in which the main influencing factor is fenoprofen, a monocarboxylic acid that is propanoic acid in which one of the hydrogens at position 2 is substituted by a 3-phenoxyphenyl group. Fenoprofen is a non-steroidal anti-inflammatory drug pharmacologically similar to aspirin, but it causes less gastrointestinal bleeding. CHEBI:5004 This is any condition in which the main influencing factor is any maternal exposure to nicotine that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) nicotine use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-27T17:01:35Z GEO:GSE291986 PMID:41013184 multigenerational maternal exposure to (R,S)-nicotine multigenerational maternal exposure to nicotine tartrate experimental_condition_ontology XCO:0001750 multigenerational maternal exposure to nicotine This is any condition in which the main influencing factor is any maternal exposure to nicotine that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) nicotine use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any gestational maternal exposure to nicotine. This is a condition typically studied to determine the effect of maternal (F0) nicotine use/exposure on the F1 offspring. slaulederkind 2025-10-27T17:10:45Z GEO:GSE291986 PMID:41013184 gestational maternal exposure to (R,S)-nicotine gestational maternal exposure to nicotine tartrate experimental_condition_ontology XCO:0001751 gestational maternal exposure to nicotine This is any condition in which the main influencing factor is any gestational maternal exposure to nicotine. This is a condition typically studied to determine the effect of maternal (F0) nicotine use/exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any pregestational maternal exposure to saline. This is a vehicle control condition typically studied to determine the effect of maternal (F0) saline (vehicle) use/exposure on the F1 offspring. slaulederkind 2025-10-28T11:41:56Z GEO:GSE296650 PMID:40582636 pregestational maternal exposure to 0.9% sodium chloride solution pregestational maternal exposure to normal saline experimental_condition_ontology XCO:0001752 pregestational maternal exposure to saline This is any condition in which the main influencing factor is any pregestational maternal exposure to saline. This is a vehicle control condition typically studied to determine the effect of maternal (F0) saline (vehicle) use/exposure on the F1 offspring. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to saline during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) saline (vehicle) use/exposure during the postnatal, preweaning period on the F1 offspring. slaulederkind 2025-10-28T12:13:40Z GEO:GSE296650 PMID:40582636 maternal exposure to 0.9% sodium chloride solution during nursing maternal exposure to normal saline during nursing experimental_condition_ontology XCO:0001753 maternal exposure to saline during nursing This is any condition in which the main influencing factor is any maternal exposure to saline during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) saline (vehicle) use/exposure during the postnatal, preweaning period on the F1 offspring. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is fentanyl, a potent, synthetic opioid analgesic/anesthetic. Fentanyl is primarily a mu-opioid agonist. slaulederkind 2025-10-28T12:33:56Z CHEBI:119915 CID:3345 GEO:GSE296650 PMID:40582636 fentanyl citrate experimental_condition_ontology XCO:0001754 fentanyl This is any condition in which the main influencing factor is fentanyl, a potent, synthetic opioid analgesic/anesthetic. Fentanyl is primarily a mu-opioid agonist. MESH:D005283 https://en.wikipedia.org/wiki/Fentanyl This is any condition in which the main influencing factor is any maternal exposure to fentanyl that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) fentanyl use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. slaulederkind 2025-10-28T12:47:49Z GEO:GSE296650 PMID:40582636 multigenerational maternal exposure to fentanyl citrate multigenerational maternal exposure to fentanyl hydrochloride experimental_condition_ontology XCO:0001755 multigenerational maternal exposure to fentanyl This is any condition in which the main influencing factor is any maternal exposure to fentanyl that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) fentanyl use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. PMID:25839742 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any pregestational maternal exposure to fentanyl. This is a condition typically studied to determine the effect of maternal (F0) fentanyl use/exposure on the F1 offspring. slaulederkind 2025-10-28T12:58:41Z GEO:GSE296650 PMID:40582636 pregestational maternal exposure to fentanyl HCl pregestational maternal exposure to fentanyl citrate pregestational maternal exposure to fentanyl hydrochloride experimental_condition_ontology XCO:0001756 pregestational maternal exposure to fentanyl This is any condition in which the main influencing factor is any pregestational maternal exposure to fentanyl. This is a condition typically studied to determine the effect of maternal (F0) fentanyl use/exposure on the F1 offspring. https://www.merriam-webster.com/ This is any condition in which the main influencing factor is gestational maternal exposure to fentanyl. This is a condition typically studied to determine the effect of maternal (F0) fentanyl use/exposure on the F1 offspring. slaulederkind 2025-10-28T13:06:57Z GEO:GSE296650 PMID:40582636 gestational maternal exposure to fentanyl HCl gestational maternal exposure to fentanyl citrate gestational maternal exposure to fentanyl hydrochloride experimental_condition_ontology XCO:0001757 gestational maternal exposure to fentanyl This is any condition in which the main influencing factor is gestational maternal exposure to fentanyl. This is a condition typically studied to determine the effect of maternal (F0) fentanyl use/exposure on the F1 offspring. ISBN-13:9780781733908 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is any maternal exposure to fentanyl during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) fentanyl use/exposure during the postnatal, preweaning period on the F1 offspring." slaulederkind 2025-10-28T13:18:51Z GEO:GSE296650 PMID:40582636 maternal exposure to fentanyl HCl during nursing maternal exposure to fentanyl citrate during nursing maternal exposure to fentanyl hydrochloride during nursing experimental_condition_ontology XCO:0001758 maternal exposure to fentanyl during nursing This is any condition in which the main influencing factor is any maternal exposure to fentanyl during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) fentanyl use/exposure during the postnatal, preweaning period on the F1 offspring." https://www.merriam-webster.com/ This is any condition in which the main influencing factor is experimental osteoarthritis of the knee joint. Osteoarthritis can be initiated in rodents via surgical methods, chemical methods, and/or directed injury to cause joint instability. slaulederkind 2025-10-28T16:55:14Z GEO:GSE301460 PMID:40727099 experimental KOA experimental knee osteoarthritis experimental_condition_ontology XCO:0001759 experimental osteoarthritis of the knee joint This is any condition in which the main influencing factor is experimental osteoarthritis of the knee joint. Osteoarthritis can be initiated in rodents via surgical methods, chemical methods, and/or directed injury to cause joint instability. PMID:25064117 PMID:40727099 This is any condition in which the main influencing factor is experimental, surgery-induced osteoarthritis of the knee joint. A model of osteoarthritis of the knee can be established in rodents by excision of the medial collateral ligament, anterior cruciate ligament, and the medial meniscus, followed by daily forced activity. This procedure is a modified Hulth method of establishing osteoarthritis of the knee (KOA). slaulederkind 2025-10-28T17:18:42Z GEO:GSE301460 PMID:33313256 experimental, surgery-induced KOA experimental, surgery-induced knee osteoarthritis experimental_condition_ontology XCO:0001760 experimental, surgery-induced osteoarthritis of the knee joint This is any condition in which the main influencing factor is experimental, surgery-induced osteoarthritis of the knee joint. A model of osteoarthritis of the knee can be established in rodents by excision of the medial collateral ligament, anterior cruciate ligament, and the medial meniscus, followed by daily forced activity. This procedure is a modified Hulth method of establishing osteoarthritis of the knee (KOA). PMID:40727099 This is any condition in which the main influencing factor is Shengyu decoction, a combination of seven different herbal medicines. Shengyu decoction has been used in traditional Chinese medicine (TCM) to treat cardiovascular and brain-related disorders. slaulederkind 2025-10-28T17:30:34Z GEO:GSE301460 PMID:24296086 SYD MSD modified “Shengyu” decoction experimental_condition_ontology XCO:0001761 Shengyu decoction This is any condition in which the main influencing factor is Shengyu decoction, a combination of seven different herbal medicines. Shengyu decoction has been used in traditional Chinese medicine (TCM) to treat cardiovascular and brain-related disorders. PMID:40727099 This is any condition in which the main influencing factor is experimental carotid balloon angioplasty, mechanically damaging the intima of the carotid artery(ies) by use of a soft catheter with an inflatable tip. The procedure involves surgically exposing the carotid artery(ies) and its lumen, followed by insertion of the inflatable catheter tip. slaulederkind 2025-10-30T10:02:14Z GEO:GSE285663 experimental_condition_ontology experimental balloon angioplasty XCO:0001762 experimental carotid intima injury This is any condition in which the main influencing factor is experimental carotid balloon angioplasty, mechanically damaging the intima of the carotid artery(ies) by use of a soft catheter with an inflatable tip. The procedure involves surgically exposing the carotid artery(ies) and its lumen, followed by insertion of the inflatable catheter tip. PMID:40727099 XCO:0000268 This is any condition in which the main influencing factor is ligustilide, the main active ingredient of Angelica roots, which has been used in Chinese medicine to treat menstrual disorders. Ligustilide exerts anti-inflammatory, anti-cancer, neuroprotective and anti-hepatotoxic effects slaulederkind 2025-10-30T12:57:42Z CHEBI:68232 CID:5319022 GEO:GSE301071 MESH:C027820 PMID:37698739 (Z)-ligustilide 3-Butylidene-4,5-dihydrophthalide experimental_condition_ontology (E)-ligustilide XCO:0001763 ligustilide This is any condition in which the main influencing factor is ligustilide, the main active ingredient of Angelica roots, which has been used in Chinese medicine to treat menstrual disorders. Ligustilide exerts anti-inflammatory, anti-cancer, neuroprotective and anti-hepatotoxic effects PMID:21851645 This is any condition in which the main influencing factor is adrenaline, a neurotransmitter and sympathomimetic hormone from the adrenal medulla. It stimulates both the alpha- and beta- adrenergic systems, causes systemic vasoconstriction and gastrointestinal relaxation, stimulates the heart, and dilates bronchi and cerebral vessels. As a medication adrenaline is used in asthma and cardiac failure and to delay absorption of local anesthetics. slaulederkind 2025-10-30T13:59:12Z CHEBI:33568 CID:5816 GEO:GSE301071 PMID:37698739 adrenalin epinephrine experimental_condition_ontology XCO:0001764 vasoconstrictor () bronchodilator agent () hormone () neurotransmitter () adrenergic receptor agonist (XCO:0000664) vasoconstrictor (XCO:0000141) bronchodilator agent (XCO:0000666) hormone (XCO:0000125) neurotransmitter (XCO:0000144) adrenergic receptor agonist (XCO:0000664) adrenaline This is any condition in which the main influencing factor is adrenaline, a neurotransmitter and sympathomimetic hormone from the adrenal medulla. It stimulates both the alpha- and beta- adrenergic systems, causes systemic vasoconstriction and gastrointestinal relaxation, stimulates the heart, and dilates bronchi and cerebral vessels. As a medication adrenaline is used in asthma and cardiac failure and to delay absorption of local anesthetics. CID:5816 MESH:D004837 This is any condition in which the main influencing factor is hydroxyurea, an antineoplastic agent that inhibits DNA synthesis through the inhibition of ribonucleoside diphosphate reductase. Hydroxyurea  is used in the treatment of chronic myeloid leukaemia as well as for sickle-cell disease. slaulederkind 2025-10-30T14:19:07Z CID:3657 GEO:GSE301071 PMID:37698739 N-hydroxyurea  hydroxycarbamide experimental_condition_ontology XCO:0001765 hydroxyurea This is any condition in which the main influencing factor is hydroxyurea, an antineoplastic agent that inhibits DNA synthesis through the inhibition of ribonucleoside diphosphate reductase. Hydroxyurea  is used in the treatment of chronic myeloid leukaemia as well as for sickle-cell disease. CHEBI:44423 MESH:D006918 This is any condition in which the main influencing factor is fentanyl hydrochloride, the hydrochloride salt form of fentanyl. Fentanyl is a potent, synthetic opioid analgesic/anesthetic and primarily a mu-opioid agonist. slaulederkind 2025-10-30T15:04:15Z GEO:GSE296650 PMID:40582636 fentanyl HCl experimental_condition_ontology XCO:0001766 fentanyl hydrochloride This is any condition in which the main influencing factor is fentanyl hydrochloride, the hydrochloride salt form of fentanyl. Fentanyl is a potent, synthetic opioid analgesic/anesthetic and primarily a mu-opioid agonist. CID:83932 This is any condition in which the main influencing factor is the compression of the L5 spinal nerve by ligation of a cannula to the nerve root. This is an experimental model of L5 spinal nerve injury. slaulederkind 2025-10-31T14:06:02Z lumbar spinal nerve compression GEO:GSE246156 compression of the L5 spinal nerve fifth lumbar spinal nerve compression spinal nerve L5 compression experimental_condition_ontology XCO:0001767 L5 spinal nerve compression This is any condition in which the main influencing factor is the compression of the L5 spinal nerve by ligation of a cannula to the nerve root. This is an experimental model of L5 spinal nerve injury. PMID:40786564 This is any condition in which the main influencing factor is an L5 spinal nerve compression sham procedure, which follows the same surgical process as an L5 spinal nerve compression without ligating the cannula to the nerve. slaulederkind 2025-10-31T14:25:18Z GEO:GSE246156 fifth lumbar spinal nerve compression sham procedure spinal nerve L5 compression sham procedure experimental_condition_ontology XCO:0001768 L5 spinal nerve compression sham procedure This is any condition in which the main influencing factor is an L5 spinal nerve compression sham procedure, which follows the same surgical process as an L5 spinal nerve compression without ligating the cannula to the nerve. PMID:40786564 This is any condition in which the main influencing factor is cannabidiol, a major compound isolated from Cannabis sativa extract that binds to a wide variety of physiological targets of the body's endocannabinoid system. It has shown antimicrobial and anticonvulsant activity, and acts via cytochrome P450 and glucuronosyltransferase inhibition. slaulederkind 2025-12-29T15:36:07Z CHEBI:69478 CID:644019 GEO:GSE279163 MESH:D002185 PMID:39815058 CBD experimental_condition_ontology XCO:0001769 cannabidiol This is any condition in which the main influencing factor is cannabidiol, a major compound isolated from Cannabis sativa extract that binds to a wide variety of physiological targets of the body's endocannabinoid system. It has shown antimicrobial and anticonvulsant activity, and acts via cytochrome P450 and glucuronosyltransferase inhibition. CID:644019 https://en.wikipedia.org/wiki/Cannabidiol This is any condition in which the main influencing factor is polyethyloxated castor oil, a nonionic surfactant derived from the reaction of castor oil with ethylene oxide. It is used as an emulsifier and solubilizer for water-insoluble drugs. slaulederkind 2025-12-29T16:30:52Z ethoxylated castor oil PECO Cremophor EL Cremophor EL-40  Kollliphor EL PEG-35 castor oil PEG-40 castor oil polyoxyethylene(40) castor oil experimental_condition_ontology XCO:0001770 polyethyloxated castor oil This is any condition in which the main influencing factor is polyethyloxated castor oil, a nonionic surfactant derived from the reaction of castor oil with ethylene oxide. It is used as an emulsifier and solubilizer for water-insoluble drugs. https://biologyinsights.com/what-is-cremophor-el-and-why-is-it-used-in-medicine/ This is any condition in which the main influencing factor is controlled air naphthalene content surrounding an organism or breathed by the organism as part of an experiment. Naphthalene is an aromatic hydrocarbon comprising two fused benzene rings. Naphthalene is the main ingredient of traditional mothballs. slaulederkind 2025-12-30T17:36:27Z CID:931 GEO:GSE281993 MESH:C031721 PMID:40806382 controlled air camphor tar content controlled air naphthalene vapor content controlled air tar camphor content controlled air white tar content experimental_condition_ontology XCO:0001771 controlled air naphthalene content This is any condition in which the main influencing factor is controlled air naphthalene content surrounding an organism or breathed by the organism as part of an experiment. Naphthalene is an aromatic hydrocarbon comprising two fused benzene rings. Naphthalene is the main ingredient of traditional mothballs. CHEBI:16482 https://en.wikipedia.org/wiki/Naphthalene This is any condition in which the main influencing factor is a carbon black nanoparticle with a size between 1 and 100 nanometers composed of carbon black. Carbon black is an elemental carbon in the form of virtually pure colloidal particles that are produced by incomplete combustion or thermal decomposition of gaseous or liquid hydrocarbons under controlled conditions. slaulederkind 2026-01-02T09:10:30Z GEO:GSE281993 PMID:40806382 CB nanoparticle experimental_condition_ontology XCO:0001772 carbon black nanoparticle This is any condition in which the main influencing factor is a carbon black nanoparticle with a size between 1 and 100 nanometers composed of carbon black. Carbon black is an elemental carbon in the form of virtually pure colloidal particles that are produced by incomplete combustion or thermal decomposition of gaseous or liquid hydrocarbons under controlled conditions. CHEBI:133602 CHEBI:82297 This is any condition in which the main influencing factor is controlled air carbon black nanoparticle content surrounding an organism or breathed by the organism as part of an experiment. Carbon black is an elemental carbon in the form of virtually pure colloidal particles that are produced by incomplete combustion or thermal decomposition of gaseous or liquid hydrocarbons under controlled conditions. Nanoparticles have a particle size of less than 100 nm in any direction. slaulederkind 2026-01-02T09:31:19Z GEO:GSE281993 PMID:40806382 controlled air CB nanoparticle content experimental_condition_ontology XCO:0001773 controlled air carbon black nanoparticle content This is any condition in which the main influencing factor is controlled air carbon black nanoparticle content surrounding an organism or breathed by the organism as part of an experiment. Carbon black is an elemental carbon in the form of virtually pure colloidal particles that are produced by incomplete combustion or thermal decomposition of gaseous or liquid hydrocarbons under controlled conditions. Nanoparticles have a particle size of less than 100 nm in any direction. CHEBI:133602 CHEBI:82297 This is any condition in which the main influencing factor is IDPN (3,3'-iminodipropionitrile), an organic compound formed from ammonia and acrylonitrile. 3,3'-iminodipropionitrile is a neurotoxin with ototoxic and hepatotoxic effects. slaulederkind 2026-01-02T10:10:56Z CHEBI:231607 GEO:GSE292500 MESH:C008110 PMID:40908485 3,3'-iminodipropionitrile 3,3′-Azanediyldipropanenitrile Bis(2-cyanoethyl)amine experimental_condition_ontology XCO:0001774 IDPN This is any condition in which the main influencing factor is IDPN (3,3'-iminodipropionitrile), an organic compound formed from ammonia and acrylonitrile. 3,3'-iminodipropionitrile is a neurotoxin with ototoxic and hepatotoxic effects. CID:8149 https://en.wikipedia.org/wiki/IDPN_(chemical) This is any condition in which the main influencing factor is a drink made up of water and a specified amount of IDPN, a colorless liquid used in medical research (neurotoxin) and as a chemical intermediate, consumed by a subject. slaulederkind 2026-01-02T10:31:56Z GEO:GSE292500 MESH:C008110 PMID:40908485 controlled 3,3'-iminodipropionitrile content drinking water controlled 3,3′-Azanediyldipropanenitrile content drinking water controlled Bis(2-cyanoethyl)amine content drinking water experimental_condition_ontology XCO:0001775 controlled IDPN content drinking water This is any condition in which the main influencing factor is a drink made up of water and a specified amount of IDPN, a colorless liquid used in medical research (neurotoxin) and as a chemical intermediate, consumed by a subject. CHEBI:231607 CID:8149 This is any condition in which the main influencing factor is CM5480, a selective inhibitor for Orai1, a protein crucial for store-operated calcium entry and calcium release-activated calcium (CRAC) channel function. slaulederkind 2026-01-08T15:06:33Z GEO:GSE307656 GEO:GSE307657 RGD:1311873 CM 5480 CM-5480 experimental_condition_ontology XCO:0001777 CM5480 This is any condition in which the main influencing factor is CM5480, a selective inhibitor for Orai1, a protein crucial for store-operated calcium entry and calcium release-activated calcium (CRAC) channel function. OMIM:610277 PMID:41212057 This is any condition in which the main influencing factor is a metal oxide with formula CeO2 (ceric oxide). Ceric oxide is used for polishing glass and as an oxidant and catalyst in organic synthesis. In precllinical trials ceric oxide functions as an agent which promotes anti-inflammatory and antioxidative processes. slaulederkind 2026-01-08T15:41:10Z CID:73963 CeO2 GSE306375 MESH:C030583 ceria cerium oxide experimental_condition_ontology XCO:0001778 ceric oxide This is any condition in which the main influencing factor is a metal oxide with formula CeO2 (ceric oxide). Ceric oxide is used for polishing glass and as an oxidant and catalyst in organic synthesis. In precllinical trials ceric oxide functions as an agent which promotes anti-inflammatory and antioxidative processes. CHEBI:79089 PMID:41484209 This is any condition in which the main influencing factor is a particle with a size between 1 and 100 nanometers composed of ceric oxide (CeO2). These particles can switch between Ce3+ and Ce4+ oxidation states, giving them catalytic, self-regenerating free radical-scavenging activity. slaulederkind 2026-01-08T15:55:24Z CeO2 nanoparticle cerium oxide nanoparticle nanoceria experimental_condition_ontology XCO:0001779 ceric oxide nanoparticle This is any condition in which the main influencing factor is a particle with a size between 1 and 100 nanometers composed of ceric oxide (CeO2). These particles can switch between Ce3+ and Ce4+ oxidation states, giving them catalytic, self-regenerating free radical-scavenging activity. PMID:41484209 This is any condition in which the main influencing factor is exposure to controlled moderate ambient light at an intensity of about 1,000 to 15,000 lux, which is somewhere between normal home lighting (50-150 lux) and direct sunlight (100,000 lux). 1,000 lux means that 1000 lumens (a measure of total light output) are distributed over an area of 1 square meter (1000 lm/m²). slaulederkind 2026-01-08T17:01:15Z GEO:GSE306375 PMID:41484209 1,000 to 15,000 lux exposure moderate intensity light exposure experimental_condition_ontology XCO:0001780 moderate ambient light exposure This is any condition in which the main influencing factor is exposure to controlled moderate ambient light at an intensity of about 1,000 to 15,000 lux, which is somewhere between normal home lighting (50-150 lux) and direct sunlight (100,000 lux). 1,000 lux means that 1000 lumens (a measure of total light output) are distributed over an area of 1 square meter (1000 lm/m²). https://riverdi.com/blog/lux-vs-lumens-difference-between-lux-and-lumens This is any condition in which the main influencing factor is the transection or resection of one or both of the phrenic nerves. The phrenic nerves convey impulses between the central nervous system and the diaphragm. slaulederkind 2026-01-08T18:03:46Z bilateral diaphragm denervation experimental_condition_ontology XCO:0001781 diaphragm denervation This is any condition in which the main influencing factor is the transection or resection of one or both of the phrenic nerves. The phrenic nerves convey impulses between the central nervous system and the diaphragm. PMID:25532023 This is any condition in which the main influencing factor is the transection or resection of either the left or right phrenic nerve. The phrenic nerves convey impulses between the central nervous system and the diaphragm. slaulederkind 2026-01-08T18:14:59Z GEO:GSE305304 UDD unilateral diaphragm DNV experimental_condition_ontology XCO:0001782 unilateral diaphragm denervation This is any condition in which the main influencing factor is the transection or resection of either the left or right phrenic nerve. The phrenic nerves convey impulses between the central nervous system and the diaphragm. PMID:41243395 This is any condition in which the main influencing factor is streptomycin sulfate, the sulfate salt form of streptomycin, an aminoglycoside antibiotic derived from Streptomyces griseus. Streptomycin sulfate is used medically for severe infections and in labs to prevent bacterial contamination in cell cultures by inhibiting bacterial protein synthesis. Side effects include dizziness, hearing issues (ototoxicity), and kidney toxicity. slaulederkind 2026-01-09T11:20:42Z CHEBI:32158 GEO:GSE292500 PMID:40908485 streptomycin sulfate salt experimental_condition_ontology XCO:0001783 streptomycin sulfate This is any condition in which the main influencing factor is streptomycin sulfate, the sulfate salt form of streptomycin, an aminoglycoside antibiotic derived from Streptomyces griseus. Streptomycin sulfate is used medically for severe infections and in labs to prevent bacterial contamination in cell cultures by inhibiting bacterial protein synthesis. Side effects include dizziness, hearing issues (ototoxicity), and kidney toxicity. CID:19648 https://toku-e.com/streptomycin-sulfate This is any condition in which the main influencing factor is MyoMed-205, a small-molecule inhibitor of MuRF1 (TRIM63/tripartite motif containing 63), a muscle-specific E3 ligase. MyoMed-205 reduces ubiquitination and subsequent proteasomal degradation of muscle proteins by inhibiting MuRF1 activity. slaulederkind 2026-01-09T13:21:14Z GEO:GSE305304 experimental_condition_ontology XCO:0001784 MyoMed‐205 This is any condition in which the main influencing factor is MyoMed-205, a small-molecule inhibitor of MuRF1 (TRIM63/tripartite motif containing 63), a muscle-specific E3 ligase. MyoMed-205 reduces ubiquitination and subsequent proteasomal degradation of muscle proteins by inhibiting MuRF1 activity. PMID:41243395 https://www.medchemexpress.com/myomed-205 This is any condition in which the main influencing factor is a unilateral diaphragm denervation sham procedure, which follows the same surgical process as a unilateral diaphragm denervation without transecting or resecting a phrenic nerve. slaulederkind 2026-01-09T13:38:23Z UDD sham procedure unilateral diaphragm DNV sham procedure experimental_condition_ontology XCO:0001785 unilateral diaphragm denervation sham procedure This is any condition in which the main influencing factor is a unilateral diaphragm denervation sham procedure, which follows the same surgical process as a unilateral diaphragm denervation without transecting or resecting a phrenic nerve. PMID:41243395 https://www.merriam-webster.com/ This is any condition in which the main influencing factor is a lateral fluid percussion injury sham procedure, which follows the same surgical process as a lateral fluid percussion injury without applying a brief fluid pressure pulse onto the intact dura after performing a craniectomy on the head of the subject. slaulederkind 2026-01-09T14:18:35Z LFPI sham procedure lateral fluid-percussion injury sham procedure parasagittal fluid percussion injury sham procedure experimental_condition_ontology XCO:0001786 lateral fluid percussion injury sham procedure This is any condition in which the main influencing factor is a lateral fluid percussion injury sham procedure, which follows the same surgical process as a lateral fluid percussion injury without applying a brief fluid pressure pulse onto the intact dura after performing a craniectomy on the head of the subject. PMID:19022291 PMID:21876530 This is any condition in which the main influencing factor is extracorporeal circulating blood transfusion, the continuous intravenous reinfusion of blood into the same individual from whom it was removed. slaulederkind 2026-02-10T16:39:40Z ECC extracorporeal circulation experimental_condition_ontology ECMO extracorporeal membrane oxygenation XCO:0001787 extracorporeal circulating blood transfusion This is any condition in which the main influencing factor is extracorporeal circulating blood transfusion, the continuous intravenous reinfusion of blood into the same individual from whom it was removed. PMID:41044028 This is any condition in which the main influencing factor is extracorporeal circulating blood transfusion with UTOpiA, a two filter process that involves inline granulocyte-monocyte apheresis (GMA) followed by an inline filter containing HLA-modified human induced pluripotent stem cell-derived hepatocyte-like cell (iHLC) organoids. The combined components of the circuit define a bioartificial liver system that manages inflammation, restores liver function, and promotes regeneration in rat models of severe liver failure. slaulederkind 2026-02-10T17:11:08Z extracorporeal circulating blood transfusion with Universal Tandem Optimized iHLC with granulocyte and monocyte/macrophage Apheresis extracorporeal circulation with UTOpiA experimental_condition_ontology XCO:0001788 extracorporeal circulating blood transfusion with UTOpiA This is any condition in which the main influencing factor is extracorporeal circulating blood transfusion with UTOpiA, a two filter process that involves inline granulocyte-monocyte apheresis (GMA) followed by an inline filter containing HLA-modified human induced pluripotent stem cell-derived hepatocyte-like cell (iHLC) organoids. The combined components of the circuit define a bioartificial liver system that manages inflammation, restores liver function, and promotes regeneration in rat models of severe liver failure. PMID:41044028