format-version: 1.2
data-version: 4.204
date: 14:06:2025 20:13
saved-by: jrsmith
auto-generated-by: --RGD OBO FILE GENERATOR -- build 2023-05-30 --
default-namespace: experimental_condition_ontology
ontology: xco

[Term]
id: XCO:0000000
name: experimental condition
def: "A state of being, an external or environmental factor or a treatment observed or administered prior to or concurrent with an investigative procedure such as an assessment of a morphological or physiological state or property in a single individual or sample or in a group of individuals or samples, especially a state, factor or treatment which has the potential to influence the outcome of such an assessment." [http://www.thefreedictionary.com/ "Multiple_Dictionaries", PMID:22654893]

[Term]
id: XCO:0000001
name: activity
def: "The state of being involved in some action, either physical or mental." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000000 ! experimental condition

[Term]
id: XCO:0000002
name: resting
def: "A state in which the organism is not exhibiting any physical exertion." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000059 ! physical activity

[Term]
id: XCO:0000003
name: resting on treadmill
def: "A state in which the organism is on an non-operating exercise machine in which there is an endless belt that moves when operational so that the organism can walk or run in place." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000002 ! resting

[Term]
id: XCO:0000004
name: walking on treadmill
def: "The action of ambulation on an exercise apparatus with an endless moving belt on which the organism can walk in place." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000007 ! walking

[Term]
id: XCO:0000005
name: running on treadmill
def: "The act of rapidly moving the feet on an exercise apparatus with an endless belt that allows the user to perform the action of running in place." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000008 ! running

[Term]
id: XCO:0000006
name: swimming
def: "This is any condition in which the main influencing factor is swimming, the action of a subject moving it's appendages to propel itself through water." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000059 ! physical activity

[Term]
id: XCO:0000007
name: walking
def: "This is any condition in which the main influencing factor is walking, the act of ambulation, moving oneself forward on legs or on an exercise apparatus." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000059 ! physical activity

[Term]
id: XCO:0000008
name: running
def: "This is any condition in which the main influencing factor is running, the action of rapid movement of feet that propels the organism forward or is done on an exercise machine so that the organism performs the activity in place." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000059 ! physical activity

[Term]
id: XCO:0000009
name: controlled air content
def: "This is any condition in which the main influencing factor is control of the amount of one or more of the gases or particles which make up or are found in the air surrounding an organism during the time course of some biological measurement." [https://www.merriam-webster.com/, ISBN:978-1416049982]
synonym: "controlled atmosphere composition" EXACT []
synonym: "controlled atmospheric composition" EXACT []
synonym: "Not4Curation" RELATED []
is_a: XCO:0000998 ! controlled breathing condition

[Term]
id: XCO:0000010
name: controlled air oxygen content
def: "This is any condition in which the main influencing factor is controlled air oxygen content surrounding an organism or breathed by the organism as part of the experiment." [RGD:MS]
synonym: "air oxygen content" EXACT []
is_a: XCO:0000009 ! controlled air content

[Term]
id: XCO:0000011
name: air temperature
def: "The degree of heat or cold of the air surrounding an organism." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000111 ! temperature exposure

[Term]
id: XCO:0000012
name: controlled air carbon dioxide content
def: "This is any condition in which the main influencing factor is controlled air carbon dioxide content surrounding an organism or breathed by the organism as part of the experiment." [RGD:MS]
synonym: "air carbon dioxide content" EXACT []
is_a: XCO:0000009 ! controlled air content

[Term]
id: XCO:0000013
name: diet
def: "The food and drink consumed by an organism day to day." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0001365 ! consumption

[Term]
id: XCO:0000014
name: controlled content diet
def: "A regimen of solid food in which the amount of one or more elements of the diet are controlled." [RGD:MS]
is_a: XCO:0000019 ! solid diet

[Term]
id: XCO:0000015
name: controlled calorie content diet
def: "A regimen of solid food in which the number of calories consumed is controlled." [RGD:MS]
is_a: XCO:0000014 ! controlled content diet

[Term]
id: XCO:0000016
name: standard rat chow
def: "This is any condition in which the main influencing factor is standard rat chow, a laboratory foodstuff which typically has 380-390 kcal/100 g with 9-10% of calories derived from fat, 70-80% of calories derived from carbohydrate, and 10-15% of calories derived from protein." [https://www.zeiglerfeed.com/research-diets/rodent-nih-31-open-formula-auto/, PMID:36386439]
synonym: "standard rodent chow" BROAD []
is_a: XCO:0000069 ! standard diet

[Term]
id: XCO:0000017
name: nephrectomy
def: "Surgical removal of kidney." [RGD:MS]
is_a: XCO:0000026 ! surgical removal
created_by: mshimoyama
creation_date: 2011-11-02T02:06:00Z

[Term]
id: XCO:0000018
name: bilateral nephrectomy
def: "Surgical removal of both kidneys." [RGD:MS]
is_a: XCO:0000017 ! nephrectomy
created_by: mshimoyama
creation_date: 2011-11-02T02:07:13Z

[Term]
id: XCO:0000019
name: solid diet
def: "The solid food that is consumed by an organism." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000013 ! diet

[Term]
id: XCO:0000020
name: drink
def: "A liquid consumed by an organism." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000013 ! diet

[Term]
id: XCO:0000021
name: water
def: "This is any condition in which the main influencing factor is water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Water may be used for drinking, as a solvent, or as an environmental component." [http://www.yourdictionary.com/drink "YourDictionary", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "H2O" EXACT []
is_a: XCO:0000020 ! drink
is_a: XCO:0000342 ! chemical with specified structure
is_a: XCO:0001231 ! solvent

[Term]
id: XCO:0000022
name: controlled sodium content diet
def: "A regimen of solid food in which the amount of sodium consumed is controlled." [RGD:MS]
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000253 ! sodium ion

[Term]
id: XCO:0000023
name: controlled ethanol content drinking water
def: "A drink made up of water and a specified amount of ethanol, the alcohol with chemical formula CH3-CH2-OH obtained from the fermentation of sugars and starches or by chemical synthesis which is the intoxicating ingredient of alcoholic beverages, for consumption by an organism in an experiment." [American_Heritage:The_American_Heritage_Science_Dictionary_2005, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000070 ! alcoholic drink
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000325 ! ethanol

[Term]
id: XCO:0000024
name: controlled iron content diet
def: "A regimen of solid food in which the amount of iron consumed is controlled." [https://www.merriam-webster.com, ISBN-13:9780781733908]
synonym: "controlled Fe content diet" EXACT []
is_a: XCO:0000920 ! controlled mineral content diet

[Term]
id: XCO:0000025
name: controlled fat content diet
def: "A regimen of solid food in which the amount of fat consumed is controlled." [RGD:MS]
is_a: XCO:0000014 ! controlled content diet

[Term]
id: XCO:0000026
name: surgical removal
def: "The process of ablating or extracting all or part of an organ, gland or other body part from an organism as a medical or experimental procedure." [http://www.thefreedictionary.com/ "Multiple_Dictionaries"]
is_a: XCO:0000165 ! surgical manipulation

[Term]
id: XCO:0000027
name: surgical implantation
def: "Any insertion of a tissue, material or device into the body using a procedure involving incision into the body." [Collins:Collins_Online_English_Dictionary, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000165 ! surgical manipulation

[Term]
id: XCO:0000028
name: caffeinated drink
def: "A drink containing caffeine, one of the methylxanthines soluble in water and alcohol and obtainable from coffee, tea, guarana and mate." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000020 ! drink
relationship: has_component XCO:0001134 ! caffeine

[Term]
id: XCO:0000029
name: controlled carbohydrate content diet
def: "A regimen of solid food in which the amount of carbohydrates consumed is controlled." [RGD:MS]
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000172 ! carbohydrate

[Term]
id: XCO:0000030
name: controlled protein content diet
def: "A regimen of solid food in which the amount of protein consumed is controlled." [RGD:MS]
is_a: XCO:0000014 ! controlled content diet

[Term]
id: XCO:0000031
name: controlled calcium content diet
def: "A regimen of solid food in which the amount of calcium consumed is controlled." [RGD:MS]
is_a: XCO:0000014 ! controlled content diet

[Term]
id: XCO:0000032
name: controlled potassium content diet
def: "A regimen of solid food in which the amount of potassium consumed is controlled." [RGD:MS]
is_a: XCO:0000014 ! controlled content diet

[Term]
id: XCO:0000033
name: housing condition
is_a: XCO:0000000 ! experimental condition

[Term]
id: XCO:0000034
name: individual housing
is_a: XCO:0000033 ! housing condition

[Term]
id: XCO:0000035
name: housing in pairs
is_a: XCO:0000033 ! housing condition

[Term]
id: XCO:0000036
name: housing with socially dominant partner
is_a: XCO:0000035 ! housing in pairs
is_a: XCO:0000490 ! ongoing social environment condition

[Term]
id: XCO:0000037
name: housing with socially subordinate partner
is_a: XCO:0000035 ! housing in pairs
is_a: XCO:0000490 ! ongoing social environment condition

[Term]
id: XCO:0000038
name: radiation exposure
def: "The condition of being subjected to any type of energy transmitted by waves through space or through some medium or to a stream of particles, such as electrons or alpha particles." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000000 ! experimental condition

[Term]
id: XCO:0000039
name: ionizing radiation exposure
def: "The condition of being subjected to transmitted energy composed of particles that individually carry enough kinetic energy to liberate an electron from an atom or molecule." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Ionizing_radiation "Wikipedia", ISBN:978-1416049982]
is_a: XCO:0000045 ! electromagnetic radiation exposure

[Term]
id: XCO:0000040
name: gamma ray exposure
def: "The condition of being subjected to high frequency, high energy electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components. Gamma radiation is traditionally considered to have wavelengths less than 0.01 nm and are generally emitted by nuclei rather than by electrons." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Gamma_ray "Wikipedia", ISBN:978-1416049982]
synonym: "gamma radiation exposure" EXACT []
is_a: XCO:0000039 ! ionizing radiation exposure

[Term]
id: XCO:0000041
name: radon exposure
def: "The condition of being subjected to transmitted energy from the gaseous radioactive element radon, atomic number 86, resulting from decay of radium. Such radiation is composed of particles that individually carry enough kinetic energy to liberate an electron from an atom or molecule. alpha, beta, and gamma rays are released during the radioactive decay of radon." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Ionizing_radiation "Wikipedia", ISBN:978-1416049982]
is_a: XCO:0000039 ! ionizing radiation exposure

[Term]
id: XCO:0000042
name: ultraviolet ray exposure
def: "The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, in the part of the electromagnetic spectrum with wavelengths between about 10 and 400 nm.  Ultraviolet radiation can be ionizing or non-ionizing depending on the wavelength." [http://en.wikipedia.org/wiki/Electromagnetic_Radiation "Wikipedia", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "UV radiation exposure" EXACT []
is_a: XCO:0000045 ! electromagnetic radiation exposure

[Term]
id: XCO:0000043
name: X-ray exposure
def: "The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths between approximately 0.01 and 10 nm." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, http://en.wikipedia.org/wiki/Electromagnetic_Radiation "Wikipedia"]
synonym: "roentgen radiation exposure" EXACT []
synonym: "X-radiation exposure" EXACT []
is_a: XCO:0000039 ! ionizing radiation exposure

[Term]
id: XCO:0000044
name: non-ionizing radiation exposure
def: "The condition of being subjected to transmitted energy that does not carry enough energy per quantum to completely remove an electron from an atom or molecule. Such radiation has sufficient energy only for excitation, the movement of an electron to a higher energy state." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Non-ionizing_radiation "Wikipedia", ISBN:978-1416049982]
is_a: XCO:0000045 ! electromagnetic radiation exposure

[Term]
id: XCO:0000045
name: electromagnetic radiation exposure
def: "The condition of being subjected to energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components. Electromagnetic radiation includes, in order of decreasing wavelength, radio waves, microwaves, infrared, visible, and ultraviolet light, x-rays, gamma rays, and cosmic rays." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Electromagnetic_Radiation "Wikipedia", ISBN:978-1416049982]
is_a: XCO:0000038 ! radiation exposure

[Term]
id: XCO:0000046
name: infrared radiation exposure
def: "The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths longer than those of visible light, i.e. from approximately 750 to 2500 nm." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, http://en.wikipedia.org/wiki/Electromagnetic_Radiation "Wikipedia"]
synonym: "IR radiation exposure" EXACT []
is_a: XCO:0000044 ! non-ionizing radiation exposure
is_a: XCO:0000045 ! electromagnetic radiation exposure

[Term]
id: XCO:0000047
name: sensory stimulus
def: "An action or condition designed to cause the registration or perception of a stimulus and the voyage made by incoming nerve impulses from the sense organs to the nerve centers. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond." [http://www.medterms.com "MedicineNet", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000000 ! experimental condition

[Term]
id: XCO:0000048
name: auditory stimulus
def: "Any action or condition designed to cause the registration or perception of a stimulus by organs and receptors involved in the sense of hearing. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "audible sound stimulus" EXACT []
is_a: XCO:0000047 ! sensory stimulus

[Term]
id: XCO:0000049
name: visual stimulus
def: "Any action or condition designed to cause the registration or perception of a stimulus by the optical sense organs. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000047 ! sensory stimulus

[Term]
id: XCO:0000050
name: olfactory stimulus
def: "Any action or condition designed to cause the registration or perception of a stimulus, by organs or receptors involved in the sense of smell. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000047 ! sensory stimulus

[Term]
id: XCO:0000051
name: taste stimulus
def: "Any action or condition designed to cause the registration or perception of a stimulus by the gustatory receptors in the tongue. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000047 ! sensory stimulus

[Term]
id: XCO:0000052
name: tactile stimulus
def: "Any action or condition designed to cause the registration or perception of a stimulus by organs and receptors involved in the sense of touch, that is, the physiological sense by which external objects or forces are perceived through contact with the body. A stimulus is anything that excites or incites an organism or part thereof to function, become active, or respond." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000047 ! sensory stimulus

[Term]
id: XCO:0000053
name: targeted heat exposure
def: "An activity or condition involving a high temperature directed toward a particular part of an organism's body." [Collins:Collins_Online_English_Dictionary]
synonym: "heat exposure, targeted" EXACT []
is_a: XCO:0000308 ! heat exposure

[Term]
id: XCO:0000054
name: targeted cold exposure
def: "An activity or condition involving a low temperature directed toward a particular part of an organism's body." [Collins:Collins_Online_English_Dictionary]
synonym: "cold exposure, targeted" EXACT []
is_a: XCO:0000306 ! cold exposure

[Term]
id: XCO:0000055
name: tactile electric shock exposure
def: "This is any condition in which the main influencing factor is the stimulation of nerves involved in the physiological sense by which external objects or forces are perceived through contact with the body via application of an electric current." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "foot shock" RELATED []
is_a: XCO:0000052 ! tactile stimulus

[Term]
id: XCO:0000056
name: naive control condition
def: "A baseline condition in which none of the experimental manipulations are performed." [RGD:MS]
synonym: "standard control condition" RELATED []
is_obsolete: true

[Term]
id: XCO:0000057
name: rebreathed air
def: "This is any experimental condition in which the main influencing factor is rebreathed air, air which has been exhaled and breathed in again." [Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed]
is_a: XCO:0000009 ! controlled air content
created_by: mshimoyama
creation_date: 2009-12-17T01:47:13Z

[Term]
id: XCO:0000058
name: room temperature
def: "The temperature of the air surrounding an organism which is considered the most common level for the facility. For humans the temperature considered most comfortable for a room is between 18 and 27 degrees celsius." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000011 ! air temperature
created_by: mshimoyama
creation_date: 2009-12-17T01:49:34Z

[Term]
id: XCO:0000059
name: physical activity
def: "Action in which a part of the body or whole body is involved in movement." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000001 ! activity
created_by: mshimoyama
creation_date: 2009-12-17T01:50:15Z

[Term]
id: XCO:0000060
name: mental activity
def: "Being in a state of action within the mind often involving manipulation of words or numbers." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000001 ! activity
created_by: mshimoyama
creation_date: 2009-12-17T01:50:54Z

[Term]
id: XCO:0000061
name: serial subtraction exercise
def: "An activity in which a person starts with a number and deducts a specified number from that and then deducts the same number from the remainder of the first computation, without using a calculator or pencil and paper." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000060 ! mental activity
created_by: mshimoyama
creation_date: 2009-12-17T01:51:15Z

[Term]
id: XCO:0000062
name: cycling
def: "The action of riding on a stationary or moving vehicle with wheels that is propelled by the movement of a person's legs." [RGD:MS]
is_a: XCO:0000059 ! physical activity
created_by: mshimoyama
creation_date: 2009-12-17T01:51:51Z

[Term]
id: XCO:0000063
name: cycling, stationary
def: "The act of propelling the wheel or wheels of a fixed exercise machine through the action of one's legs." [RGD:MS]
is_a: XCO:0000062 ! cycling
created_by: mshimoyama
creation_date: 2009-12-17T01:52:04Z

[Term]
id: XCO:0000064
name: cycling, non-stationary
def: "The action of propelling a two wheeled vehicle by the movement of a person's legs." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000062 ! cycling
created_by: mshimoyama
creation_date: 2009-12-17T01:52:17Z

[Term]
id: XCO:0000065
name: hand dynamometer activity
def: "The action of squeezing an apparatus that measures the muscular contraction of the hand, used as a condition of exertion in experiments measuring other physiological functions." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000059 ! physical activity
created_by: mshimoyama
creation_date: 2009-12-17T01:52:57Z

[Term]
id: XCO:0000066
name: body position change
def: "Change in position or attitude of body as part of the experiment in which measurements are taken before, during and/or after the change." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000081 ! body position
created_by: mshimoyama
creation_date: 2009-12-17T01:53:24Z

[Term]
id: XCO:0000067
name: body position change, seated to standing
is_a: XCO:0000066 ! body position change
created_by: mshimoyama
creation_date: 2009-12-17T01:53:35Z

[Term]
id: XCO:0000068
name: body position change, supine to standing
is_a: XCO:0000066 ! body position change
created_by: mshimoyama
creation_date: 2009-12-17T01:53:58Z

[Term]
id: XCO:0000069
name: standard diet
is_a: XCO:0000019 ! solid diet
is_a: XCO:0000099 ! control condition
created_by: mshimoyama
creation_date: 2009-12-17T01:56:44Z

[Term]
id: XCO:0000070
name: alcoholic drink
def: "A drink containing ethanol, a transparent, colorless, volatile, flammable liquid, which is formed by microbial fermentation of carbohydrates." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "ethanol" RELATED []
is_a: XCO:0000020 ! drink
created_by: mshimoyama
creation_date: 2010-01-05T03:10:55Z

[Term]
id: XCO:0000071
name: beer
def: "An alcoholic drink brewed by fermenting malt with sugar and yeast and flavored with hops." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000070 ! alcoholic drink
created_by: mshimoyama
creation_date: 2010-01-05T03:11:11Z

[Term]
id: XCO:0000072
name: wine
def: "Alcoholic drink made by fermenting the juice of grapes." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000070 ! alcoholic drink
created_by: mshimoyama
creation_date: 2010-01-05T03:11:23Z

[Term]
id: XCO:0000073
name: liquor
def: "Alcoholic beverage produced by distillation." [Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000070 ! alcoholic drink
created_by: mshimoyama
creation_date: 2010-01-05T03:11:33Z

[Term]
id: XCO:0000074
name: controlled caffeine content drinking water
def: "A drink made up of water and a specified amount of caffeine consumed by an organism as part of an experiment. Caffeine is a xanthine alkaloid that acts primarily as a central nervous system and metabolic stimulant, and also as a mild vasoconstrictor, diuretic, and bronchodilator." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Caffeine "Wikipedia", ISBN:978-1416049982]
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001134 ! caffeine
created_by: mshimoyama
creation_date: 2010-01-05T03:15:30Z

[Term]
id: XCO:0000075
name: tea
is_a: XCO:0000028 ! caffeinated drink
created_by: mshimoyama
creation_date: 2010-01-05T03:15:42Z

[Term]
id: XCO:0000076
name: coffee
def: "A drink made of the decoction or infusion of the dried, roasted sees of Coffea arabica or Coffea canephora." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000028 ! caffeinated drink
created_by: mshimoyama
creation_date: 2010-01-05T03:15:55Z

[Term]
id: XCO:0000077
name: tobacco use
def: "The use of any product made for human consumption from Nicotiana tabacum." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0001365 ! consumption
created_by: mshimoyama
creation_date: 2010-01-05T03:17:37Z

[Term]
id: XCO:0000078
name: cigar smoking
def: "The action of smoking, inhalation of the gases and hydrocarbon vapors generated by burning a cigar, a rolled cylinder of tobacco wrapped in tobacco leaves." [http://medical-dictionary.thefreedictionary.com "Multiple_Dictionaries"]
synonym: "Cigar Smoking NCI Thesaurus" RELATED [NCI:C19702]
is_a: XCO:0000077 ! tobacco use
created_by: mshimoyama
creation_date: 2010-01-05T03:17:52Z

[Term]
id: XCO:0000079
name: cigarette smoking
def: "The action of smoking, inhalation of the gases and hydrocarbon vapors generated by burning a cigarette, a small roll of finely cut tobacco enclosed in a wrapper of thin paper." [http://medical-dictionary.thefreedictionary.com "Multiple_Dictionaries"]
synonym: "Cigarette Smoking_NCI Thesaurus" RELATED [NCI:C18270]
is_a: XCO:0000077 ! tobacco use
created_by: mshimoyama
creation_date: 2010-01-05T03:18:03Z

[Term]
id: XCO:0000080
name: tobacco chewing
def: "Mastication of a form of the prepared leaves of Nicotiana tabacum that is chewed." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000077 ! tobacco use
created_by: mshimoyama
creation_date: 2010-01-05T03:18:13Z

[Term]
id: XCO:0000081
name: body position
def: "The attitude or posture of the body." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "posture" RELATED []
is_a: XCO:0000000 ! experimental condition
created_by: mshimoyama
creation_date: 2010-03-04T09:05:26Z

[Term]
id: XCO:0000082
name: sitting position
def: "A position of rest in which the weight is largely supported by the buttocks, usually with the body vertical." [Encarta:Encarta_World_English_Dictionary]
synonym: "seated" RELATED []
is_a: XCO:0000081 ! body position
created_by: mshimoyama
creation_date: 2010-03-04T09:06:36Z

[Term]
id: XCO:0000083
name: standing position
def: "A position in which an organism is upright balanced on two legs for bipedal organisms or four legs for quadrapedal organisms." [RGD:MS]
is_a: XCO:0000081 ! body position
created_by: mshimoyama
creation_date: 2010-03-04T09:06:49Z

[Term]
id: XCO:0000084
name: supine position
def: "A position in which the organism is lying face up." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000081 ! body position
created_by: mshimoyama
creation_date: 2010-03-04T09:07:12Z

[Term]
id: XCO:0000085
name: stationary bicycle dynamometer
is_a: XCO:0000063 ! cycling, stationary
created_by: mshimoyama
creation_date: 2010-03-04T01:56:42Z

[Term]
id: XCO:0000086
name: exercise training program
def: "A fixed series of exercises or body movements repeated at intervals over a specified period of time as part of a program to improve strength, aerobic capacity or other elements of fitness." [RGD:MS]
is_a: XCO:0000059 ! physical activity
created_by: mshimoyama
creation_date: 2010-03-04T02:09:06Z

[Term]
id: XCO:0000087
name: specific pathogen-free condition
def: "A standard living condition with the absence of a resident pathogen, a biological agent that causes disease, especially a microorganism such as a bacterium, virus, or fungus." [https://www.dictionary.com, https://www.merriam-webster.com/]
is_a: XCO:0000099 ! control condition
created_by: mshimoyama
creation_date: 2010-06-29T03:35:43Z

[Term]
id: XCO:0000088
name: chemical
def: "This is any condition in which the main influencing factor is a compound or substance that has been purified or prepared, especially artificially." [https://languages.oup.com/google-dictionary-en/]
is_a: XCO:0000000 ! experimental condition
created_by: mshimoyama
creation_date: 2010-11-01T01:00:51Z

[Term]
id: XCO:0000089
name: neoplasm-inducing chemical
def: "Any condition in which the main influencing factor is a chemical, i.e., a substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules, which has the capacity to promote the formation of neoplasms, new and abnormal growths, specifically those in which cell multiplication is uncontrolled and progressive." [American_Heritage:The_American_Heritage_Science_Dictionary_2005, Collins:Collins_Online_English_Dictionary, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "cancer inducing agent" NARROW []
synonym: "carcinogen" NARROW []
synonym: "carcinogenic agent" NARROW []
synonym: "neoplasm inducing agent" EXACT []
is_a: XCO:0000259 ! disease-inducing chemical
created_by: mshimoyama
creation_date: 2010-11-01T01:01:08Z

[Term]
id: XCO:0000090
name: 7,12-dimethyltetraphene
def: "A tetraphene having methyl substituents at the 7- and 12- positions. It is a potent carcinogen and is present in tobacco smoke." []
synonym: "7,12-dimethylbenzo[a]anthracene" RELATED []
synonym: "7,12-DMBA" EXACT []
synonym: "7,12-DMBA" RELATED []
synonym: "9,10-Dimethyl-1,2-benzanthracene" RELATED []
synonym: "DMBA" RELATED []
xref: CHEBI:254496
xref: CID:6001
xref: MESH:D015127
is_a: XCO:0000093 ! polycyclic arene
created_by: mshimoyama
creation_date: 2010-11-01T01:01:46Z

[Term]
id: XCO:0000091
name: steroid
def: "Any condition in which the main influencing factor is a naturally occurring compound or related synthetic analog with a molecular structure based on the cyclopenta[a]phenanthrene carbon skeleton, that is, a phenanthrene, to the a side of which a three-carbon fragment is fused.  According to the definition at the Chemical Entities of Biological Importance (ChEBI) database, 'By extension, one or more bond scissions, ring expansions and/or ring contractions of the skeleton may have occurred' which expands the class to include molecules based on but not containing the cannonical arrangement of four fused cycloalkane rings." [http://en.wikipedia.org/wiki/Steroid "Wikipedia", http://www.medilexicon.com/medicaldictionary.php?t=22261 "MediLexicon"]
xref: CHEBI:35341
is_a: XCO:0000342 ! chemical with specified structure
created_by: mshimoyama
creation_date: 2010-11-01T01:03:53Z

[Term]
id: XCO:0000092
name: 17 beta-estradiol
def: "The predominant circulating form of estrogen, the female sex hormone." [http://en.wikipedia.org/wiki/Estradiol "Wikipedia"]
synonym: "beta-estradiol" RELATED []
synonym: "CO47085" RELATED []
synonym: "E2" RELATED []
synonym: "estradiol" RELATED []
xref: CHEBI:16469
is_a: XCO:0000294 ! estrogen/estrogen analog
created_by: mshimoyama
creation_date: 2010-11-01T01:04:03Z

[Term]
id: XCO:0000093
name: polycyclic arene
def: "Any organic compound whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, and whose carbon atoms form continuous or closed chains linked by alternating double and single bonds that may be represented graphically by multiple interlinking circular or triangular forms." [http://www.thefreedictionary.com/ "Multiple_Dictionaries"]
synonym: "polycyclic aromatic hydrocarbon" RELATED []
xref: CHEBI:33848
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000278 ! polycyclic hydrocarbon
created_by: mshimoyama
creation_date: 2010-11-01T01:07:01Z

[Term]
id: XCO:0000094
name: ovariectomy
def: "The removal of one or both ovaries, the female gonads, from an organism." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "oophorectomy" RELATED []
is_a: XCO:0000026 ! surgical removal
created_by: mshimoyama
creation_date: 2010-11-02T01:28:36Z

[Term]
id: XCO:0000095
name: bilateral ovariectomy
def: "Surgical removal of both ovaries." [RGD:MS]
is_a: XCO:0000094 ! ovariectomy
created_by: mshimoyama
creation_date: 2010-11-02T01:29:19Z

[Term]
id: XCO:0000096
name: unilateral ovariectomy
def: "Surgical removal of a single ovary." [RGD:MS]
is_a: XCO:0000094 ! ovariectomy
created_by: mshimoyama
creation_date: 2010-11-02T01:29:34Z

[Term]
id: XCO:0000097
name: right ovariectomy
def: "Surgical removal of the right ovary." [RGD:MS]
is_a: XCO:0000096 ! unilateral ovariectomy
created_by: mshimoyama
creation_date: 2010-11-02T01:29:48Z

[Term]
id: XCO:0000098
name: left ovariectomy
def: "Surgical removal of the left ovary." [RGD:MS]
is_a: XCO:0000096 ! unilateral ovariectomy
created_by: mshimoyama
creation_date: 2010-11-02T01:30:01Z

[Term]
id: XCO:0000099
name: control condition
alt_id: XCO:0000056
alt_id: XCO:0000791
def: "This is any condition in which the major influencing factor is a uniform set of parameters accepted as normal or average and used by general consent as a basis of comparison. It is a baseline condition in which none of the experimental manipulations are performed." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "naive control condition" EXACT []
synonym: "standard condition" EXACT []
synonym: "standard control condition" EXACT []
is_a: XCO:0000000 ! experimental condition
created_by: mshimoyama
creation_date: 2010-11-02T02:06:02Z

[Term]
id: XCO:0000100
name: sham surgical control condition
def: "A surgical treatment or procedure that is performed as a control and that is similar to but omits a key therapeutic element of the treatment or procedure under investigation." [Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed]
synonym: "placebo surgery" EXACT []
synonym: "sham surgery" EXACT []
is_a: XCO:0000099 ! control condition
is_a: XCO:0000165 ! surgical manipulation
created_by: mshimoyama
creation_date: 2010-11-02T02:06:46Z

[Term]
id: XCO:0000101
name: vehicle control condition
def: "A treatment used as a control in which a saline or other solution is administered in the same manner as the experimental solution minus the key element of the experimental solution." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "vehicle control diet" RELATED []
xref: PMID:28928461
is_a: XCO:0000099 ! control condition
created_by: mshimoyama
creation_date: 2010-11-02T02:07:02Z

[Term]
id: XCO:0000102
name: fasting
def: "Abstaining from the consumption of food, often for a specified period of time." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000013 ! diet
created_by: mshimoyama
creation_date: 2010-11-08T09:37:31Z

[Term]
id: XCO:0000103
name: glucose solution
def: "A mixture in which molecules of glucose, the monosaccharide sugar (C6H12O6) which is the end product of carbohydrate metabolism, and the chief source of energy for living organisms, are distributed uniformly throughout another substance (the solvent), usually water, so that the mixture is homogeneous at the molecular level." [American_Heritage:The_American_Heritage_Science_Dictionary_2005, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "dextrose solution" RELATED []
relationship: has_component XCO:0000275 ! glucose
created_by: mshimoyama
creation_date: 2010-11-08T09:40:03Z

[Term]
id: XCO:0000104
name: glucose solution, 2.8M
def: "A mixture in which 2.8 moles of glucose, the monosaccharide sugar (C6H12O6) which is the end product of carbohydrate metabolism, and the chief source of energy for living organisms, are distributed uniformly throughout a sufficient volume of another substance (the solvent), usually water, so that the mixture is homogeneous at the molecular level and the final volume is one liter." [American_Heritage:The_American_Heritage_Science_Dictionary_2005, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000103 ! glucose solution
created_by: mshimoyama
creation_date: 2010-11-08T09:40:19Z

[Term]
id: XCO:0000105
name: pancreatectomy
def: "Surgical removal of part or all of the pancreas, the combined endocrine/exocrine gland situated transversely behind the stomach, between the spleen and the duodenum." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000026 ! surgical removal
created_by: mshimoyama
creation_date: 2010-11-10T02:19:58Z

[Term]
id: XCO:0000106
name: anesthetic/analgesic
def: "This is any condition in which the main influencing factor is a drug or agent used to reduce or eliminate pain or sensation." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "Not4Curation" RELATED []
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: mshimoyama
creation_date: 2011-01-21T09:44:08Z

[Term]
id: XCO:0000107
name: pentobarbital
def: "Short to intermediate acting barbiturate used as a sedative and hypnotic." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000106 ! anesthetic/analgesic
created_by: mshimoyama
creation_date: 2011-01-21T09:45:03Z

[Term]
id: XCO:0000108
name: pentobarbital, sodium
def: "Sodium salt of pentobarbital, a short to intermediate acting barbiturate used as a sedative and hypnotic." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000107 ! pentobarbital
created_by: mshimoyama
creation_date: 2011-01-21T09:46:40Z

[Term]
id: XCO:0000109
name: isoflurane
def: "Potent inhalational anesthetic." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000106 ! anesthetic/analgesic
created_by: mshimoyama
creation_date: 2011-01-21T09:48:47Z

[Term]
id: XCO:0000110
name: prone position
def: "A position in which the organism is lying face down." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000081 ! body position
created_by: mshimoyama
creation_date: 2011-02-07T01:44:52Z

[Term]
id: XCO:0000111
name: temperature exposure
is_a: XCO:0000000 ! experimental condition
created_by: mshimoyama
creation_date: 2011-02-08T02:22:15Z

[Term]
id: XCO:0000112
name: unilateral nephrectomy
def: "Surgical removal of a single kidney." [RGD:MS]
is_a: XCO:0000017 ! nephrectomy
created_by: mshimoyama
creation_date: 2011-11-02T02:08:41Z

[Term]
id: XCO:0000113
name: right nephrectomy
def: "Surgical removal of the right kidney." [RGD:MS]
is_a: XCO:0000112 ! unilateral nephrectomy
created_by: mshimoyama
creation_date: 2011-11-02T02:11:31Z

[Term]
id: XCO:0000114
name: left nephrectomy
def: "Surgical removal of the left kidney." [RGD:MS]
is_a: XCO:0000112 ! unilateral nephrectomy
created_by: mshimoyama
creation_date: 2011-11-02T02:12:44Z

[Term]
id: XCO:0000115
name: perfusate
def: "Any fluid which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000340 ! solution
created_by: mshimoyama
creation_date: 2012-01-09T01:29:00Z

[Term]
id: XCO:0000116
name: Kreb's solution perfusate
def: "A buffered, aqueous solution usually containing the cations sodium, potassium, calcium and magnesium, and anions chloride, sulfate, bicarbonate and phosphate and often including glucose as an energy source which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://www.sigmaaldrich.com/etc/medialib/docs/Sigma/Product_Information_Sheet/1/k3753pis.Par.0001.File.tmp/k3753pis.pdf "Sigma-Aldrich", ISBN:978-1416049982]
synonym: "Krebs-Henseleit buffer perfusate" RELATED []
synonym: "Krebs-Henseleit solution perfusate" RELATED []
synonym: "Krebs-Ringer buffer perfusate" RELATED []
synonym: "Krebs-Ringer solution perfusate" RELATED []
is_a: XCO:0000115 ! perfusate
created_by: mshimoyama
creation_date: 2012-01-09T01:29:11Z

[Term]
id: XCO:0000117
name: saline solution perfusate
def: "A fluid containing a specified amount of a chemical salt, for example sodium chloride, which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel." [Collins:Collins_Online_English_Dictionary, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000115 ! perfusate
created_by: mshimoyama
creation_date: 2012-01-09T01:29:28Z

[Term]
id: XCO:0000118
name: perfusate suspended
def: "A condition in which a fluid which has been injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel, remains in but is no longer actively passed through the organ or tissue for a specified period of time." [Collins:Collins_Online_English_Dictionary, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000115 ! perfusate
created_by: mshimoyama
creation_date: 2012-01-09T01:29:47Z

[Term]
id: XCO:0000119
name: amino acid
def: "This is any condition in which the main influencing factor is an amino acid, any naturally occurring or synthetic organic compound containing an amino group, a carboxylic acid group and a side chain. An amino acid may be administered as a nutritional supplement or as a drug." [https://en.wikipedia.org/wiki/Amino_acid "Wikipedia", https://www.merriam-webster.com/]
synonym: "amino acids" EXACT []
xref: CHEBI:33709
xref: MESH:D000596
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2012-02-16T12:55:34Z

[Term]
id: XCO:0000120
name: inhibitor
def: "A substance or compound which interferes with a chemical reaction or a molecular or physiological process or activity." [http://medical-dictionary.thefreedictionary.com/inhibitor "Multiple_Dictionaries", RGD:JRS]
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-02-16T01:09:21Z

[Term]
id: XCO:0000121
name: NG-nitroarginine methyl ester
def: "A basic amino acid, commonly known as L-NAME, used as a non-selective inhibitor of nitric oxide synthase." [MESH:D019331]
synonym: "L-NAME" EXACT []
xref: CAS:51298-62-5
xref: chembl.compound:CHEMBL7890
xref: MESH:D019331
xref: pubchem.compound:39836
is_a: XCO:0000119 ! amino acid
is_a: XCO:0000523 ! enzyme inhibitor
created_by: JSmith
creation_date: 2012-02-16T01:15:20Z

[Term]
id: XCO:0000122
name: diuretic
def: "A chemical which tends to increase the excretion of urine." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-02-16T01:51:41Z

[Term]
id: XCO:0000123
name: sulfonamide
def: "A compound containing a sulfonamide functional group. A sulfonamide functional group contains sulfonyl connected to an amine group and has the general structure R-S(=O)2-NH2. Sulfonamide also refers to several classes of drugs which include antimicrobial 'sulfa drugs', anticonvulsants and the sulfonylureas and thiazide diuretics." [http://en.eikipedia.org/wiki/ "Wikipedia"]
xref: CHEBI:35358
is_a: XCO:0000342 ! chemical with specified structure
is_a: XCO:0000950 ! anticonvulsant
created_by: JSmith
creation_date: 2012-02-16T01:52:39Z

[Term]
id: XCO:0000124
name: furosemide
def: "This is any condition whose main influencing factor is furosemide, a diuretic drug which inhibits Nkcc2 (Slc12a1), one of the Na-K symporters and reduces the reabsorption of sodium chloride. Furosemide is used experimentally for sodium depletion." [http://en.eikipedia.org/wiki/ "Wikipedia"]
synonym: "4-chloro-2-{[(furan-2-yl)methyl]amino}-5-sulfamoylbenzoic acid" EXACT []
synonym: "Frusemide" RELATED []
synonym: "Lasix" RELATED []
xref: CHEBI:47426
xref: CID:3440
is_a: XCO:0000122 ! diuretic
is_a: XCO:0000123 ! sulfonamide
created_by: JSmith
creation_date: 2012-02-16T01:53:25Z

[Term]
id: XCO:0000125
name: hormone
def: "A chemical substance which in its endogenous state is produced by an organ, cells of an organ or scattered cells, having a specific regulatory affect on the activity of an organ or tissue." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-02-16T02:54:55Z

[Term]
id: XCO:0000126
name: angiotensin
def: "A peptide hormone which increases blood pressure by causing blood vessel constriction. Part of the renin-angiotensin system." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000141 ! vasoconstrictor
is_a: XCO:0000228 ! peptide hormone
created_by: JSmith
creation_date: 2012-02-16T03:00:38Z

[Term]
id: XCO:0000127
name: norepinephrine
def: "A catecholamine neurotransmitter and stress hormone with multiple physiological roles including affects on heart rate, blood pressure and vascular tone." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "noradrenaline" EXACT []
is_a: XCO:0000141 ! vasoconstrictor
is_a: XCO:0000144 ! neurotransmitter
is_a: XCO:0000230 ! monoamine hormone
created_by: JSmith
creation_date: 2012-02-16T03:01:05Z

[Term]
id: XCO:0000128
name: drink with chemical additive
is_obsolete: true
created_by: JSmith
creation_date: 2012-02-16T03:23:23Z

[Term]
id: XCO:0000129
name: water with NG-Nitroarginine Methyl Ester
def: "Drinking water with a specified concentration of NG-Nitroarginine Methyl Ester (L-NAME) added to it. L-NAME is used as a non-selective inhibitor of nitric oxide synthase." [PGA:Renal_protocol]
synonym: "water with L-NAME" EXACT []
is_obsolete: true
created_by: JSmith
creation_date: 2012-02-16T03:23:57Z

[Term]
id: XCO:0000130
name: ketamine
def: "An analgesic and anesthetic which functions as a noncompetitive NMDA receptor (NMDAR) antagonist, binding to the allosteric site of the NMDA receptor and effectively inhibiting its channel." [http://en.wikipedia.org/wiki/Ketamine "Wikipedia"]
xref: CHEBI:6121
xref: pubchem.compound:3821
is_a: XCO:0000947 ! NMDA receptor antagonist
created_by: JSmith
creation_date: 2012-03-15T07:33:06Z

[Term]
id: XCO:0000131
name: xylazine
def: "An alpha2-adrenergic receptor agonist used for sedation, anesthesia, muscle relaxation, and analgesia in animals." [http://en.wikipedia.org/wiki/Xylazine "Wikipedia"]
xref: CHEBI:165540
xref: chembl.compound:CHEMBL297362
xref: pubchem.compound:5707
is_a: XCO:0000106 ! anesthetic/analgesic
created_by: JSmith
creation_date: 2012-03-15T07:34:39Z

[Term]
id: XCO:0000132
name: acepromazine
def: "A phenothiazine-derivative antipsychotic drug used in animals as a sedative and antiemetic and which can also cause peripheral vasodilation." [http://en.wikipedia.org/wiki/Acepromazine "Wikipedia"]
xref: CHEBI:44932
xref: CID:6077
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0001245 ! antiemetic
created_by: JSmith
creation_date: 2012-03-15T07:39:01Z

[Term]
id: XCO:0000133
name: antigen
def: "A condition in which the major influencing factor is a chemical compound to which the body can mount a specific localized or systemic immune reaction, e.g. a T cell or B cell response." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed, RGD:JRS]
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-03-15T07:42:13Z

[Term]
id: XCO:0000134
name: methacholine
def: "A synthetic choline ester that acts as a non-selective muscarinic receptor agonist, that is, a chemical which when bound to the receptor produces a physiologic reaction typical of the naturally occurring ligand, in the parasympathetic nervous system." [http://en.wikipedia.org/wiki/Methacholine "Wikipedia"]
xref: CHEBI:6804
is_a: XCO:0000135 ! receptor agonist
created_by: JSmith
creation_date: 2012-03-15T07:45:00Z

[Term]
id: XCO:0000135
name: receptor agonist
def: "A drug or other chemical that can combine with a receptor to produce a physiologic reaction typical of a naturally occurring substance. A receptor is a molecule on the surface or within a cell that recognizes and binds with specific molecules, producing a specific effect in the cell." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000214 ! activator
created_by: JSmith
creation_date: 2012-03-15T07:46:38Z

[Term]
id: XCO:0000136
name: enzyme substrate
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-03-15T07:48:19Z

[Term]
id: XCO:0000137
name: FAPGG
def: "An oligopeptide substrate for continuous spectrophotometric assay of angiotensin converting enzyme (ACE) which hydrolyzes FAPGG to furylacryloylphenylalanine (FAP) and glycylglycine with a resulting decrease in absorbance at 340 nm." [http://www.sigmaaldrich.com/catalog/product/sigma/f7131?lang=en&region=US "Website", http://www.trinitybiotech.com/Product%20Documents/305-10-29%20EN.pdf "Website"]
synonym: "3-(2-FurylAcryloyl)-L-PHE-GLY-GLY" EXACT []
synonym: "FurylAcrylolPhenylalanylGlycylGlycine" EXACT []
xref: CAS:64566-61-6
xref: pubchem.compound:6438387
is_a: XCO:0000136 ! enzyme substrate
created_by: JSmith
creation_date: 2012-03-15T07:48:41Z

[Term]
id: XCO:0000138
name: methylene blue
def: "Methylene blue is monoamine oxidase inhibitor and nitric oxide synthase inhibitor, as well as a cationic dye used as a redox indicator." [RGD:SL]
synonym: "methylthioninium chloride" EXACT []
xref: CHEBI:6872
xref: pubchem.compound:6099
is_a: XCO:0000199 ! oxidation-reduction indicator
is_a: XCO:0000523 ! enzyme inhibitor
created_by: JSmith
creation_date: 2012-03-15T07:51:22Z

[Term]
id: XCO:0000139
name: vasoactive chemical
def: "A condition in which the main influencing factor is a molecule that directly or indirectly acts upon blood vessels to cause constriction or dilation." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-03-15T07:53:30Z

[Term]
id: XCO:0000140
name: vasodilator
def: "A condition in which the main influencing factor is a molecule that functions to dilate or increase the interior diameter of blood vessels." [Gale:Gale_Encyclopedia_of_Medicine]
is_a: XCO:0000139 ! vasoactive chemical
created_by: JSmith
creation_date: 2012-03-15T07:55:13Z

[Term]
id: XCO:0000141
name: vasoconstrictor
def: "A condition in which the main influencing factor is a molecule that acts to constrict or reduce the interior diameter of blood vessels." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "vasopressor" RELATED []
is_a: XCO:0000139 ! vasoactive chemical
created_by: JSmith
creation_date: 2012-03-15T07:56:15Z

[Term]
id: XCO:0000142
name: sodium nitroprusside
def: "This is any condition in which the main influencing factor is sodium nitroprusside, the red-colored inorganic salt with the formula Na2[Fe(CN)5NO]?2H2O used as a potent vasodilator." [http://en.wikipedia.org/wiki/Sodium_nitroprusside "Wikipedia"]
synonym: "disodium pentacyanonitrosylferrate(2-) dehydrate" EXACT []
synonym: "nitroprusside" EXACT []
synonym: "nitroprusside disodium dihydrate" EXACT []
synonym: "SNP" EXACT []
synonym: "sodium nitroferricyanide(III) dihydrate" EXACT []
synonym: "sodium pentacyanidonitrosylferrate(2-)" EXACT []
synonym: "sodium pentacyanidonitrosylferrate(III)" EXACT []
xref: CHEBI:29321
xref: CID:11953895
xref: MESH:D009599
is_a: XCO:0000140 ! vasodilator
created_by: JSmith
creation_date: 2012-03-15T07:58:24Z

[Term]
id: XCO:0000143
name: acetylcholine
def: "An organic, polyatomic cation, formed as an ester of acetic acid and choline, that acts as a neurotransmitter in both the peripheral nervous system (PNS) and central nervous system (CNS) in many organisms." [http://en.wikipedia.org/wiki/Acetylcholine "Wikipedia"]
xref: CHEBI:15355
xref: pubchem.compound:187
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000144 ! neurotransmitter
created_by: JSmith
creation_date: 2012-03-15T08:00:34Z

[Term]
id: XCO:0000144
name: neurotransmitter
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-03-15T08:01:41Z

[Term]
id: XCO:0000145
name: phenylephrine
def: "A selective alpha1-adrenergic receptor agonist used primarily as a decongestant, as an agent to dilate the pupil, and as a vasoconstrictor." [http://en.wikipedia.org/wiki/Phenylephrine "Wikipedia"]
xref: CHEBI:8093
xref: pubchem.compound:6041
is_a: XCO:0000141 ! vasoconstrictor
is_a: XCO:0000673 ! alpha-adrenergic agonist
created_by: JSmith
creation_date: 2012-03-15T08:02:39Z

[Term]
id: XCO:0000146
name: controlled oxygen content Kreb's solution perfusate
def: "A buffered, aqueous solution usually containing the cations sodium, potassium, calcium and magnesium, and anions chloride, sulfate, bicarbonate and phosphate and often including glucose as an energy source in which a specified amount of the tasteless, odorless, colorless gas essential for aerobic respiration with atomic number 8 has been dissolved, which is injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://www.sigmaaldrich.com/etc/medialib/docs/Sigma/Product_Information_Sheet/1/k3753pis.Par.0001.File.tmp/k3753pis.pdf "Sigma-Aldrich", ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled oxygen content Krebs-Henseleit buffer perfusate" RELATED []
synonym: "controlled oxygen content Krebs-Henseleit solution perfusate" RELATED []
synonym: "controlled oxygen content Krebs-Ringer buffer perfusate" RELATED []
synonym: "controlled oxygen content Krebs-Ringer solution perfusate" RELATED []
is_a: XCO:0000116 ! Kreb's solution perfusate
created_by: JSmith
creation_date: 2012-03-21T02:07:15Z

[Term]
id: XCO:0000147
name: physiological salt solution perfusate
def: "A fluid which is injected or pumped into an organ or tissue, usually via blood vessels, composed of a solution of sodium chloride at a concentration which closely approximates the osmolarity of salt in blood." [http://en.wikipedia.org/wiki/Saline_%28medicine%29#Normal "Wikipedia"]
synonym: "normal saline perfusate" RELATED []
synonym: "PSS" EXACT []
is_a: XCO:0000117 ! saline solution perfusate
created_by: JSmith
creation_date: 2012-03-21T02:18:12Z

[Term]
id: XCO:0000148
name: controlled oxygen content physiological salt solution perfusate
def: "A fluid which is injected or pumped into an organ or tissue, usually via blood vessels, composed of a solution of sodium chloride at a concentration which closely approximates the osmolarity of salt in blood, and which contains a specific, controlled concentration of oxygen gas, the tasteless, odorless, colorless gas with atomic number 8 essential for aerobic respiration, dissolved in it." [http://en.wikipedia.org/wiki/Saline_%28medicine%29#Normal "Wikipedia", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "oxygenated PSS" EXACT []
is_a: XCO:0000147 ! physiological salt solution perfusate
created_by: JSmith
creation_date: 2012-03-21T02:19:03Z

[Term]
id: XCO:0000149
name: ion/salt
def: "Any condition in which the main influencing factor is an atom or molecule that has gained or lost one or more electrons and thereby acquired a charge, or is any of a large class of chemical compounds formed when a positively charged ion (a cation) bonds with a negatively charged ion (an anion)." [American_Heritage:The_American_Heritage_Science_Dictionary_2005, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2012-03-23T07:25:49Z

[Term]
id: XCO:0000150
name: potassium ion
def: "A condition in which the main influencing factor is an atom of potassium, the chemical element with atomic number 19, that has lost one electron, forming a cation with a charge of +1. Potassium is the chief cation of intracellular fluid." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
comment: Not used for potassium salt in animal feed. For that application  XCO:0000032, "controlled potassium content diet" is used.
synonym: "K+ ion" EXACT []
xref: CHEBI:29103
is_a: XCO:0000149 ! ion/salt
created_by: JSmith
creation_date: 2012-03-23T07:31:29Z

[Term]
id: XCO:0000151
name: chemical time series
is_a: XCO:0000088 ! chemical
created_by: JSmith
creation_date: 2012-03-23T08:10:45Z

[Term]
id: XCO:0000152
name: drug dose time series
def: "The condition of exposing an organism, organ or tissue to a series of increasing or decreasing doses of a drug or other chemical from which a single measurement value is obtained." [RGD:JRS]
is_a: XCO:0000151 ! chemical time series
created_by: JSmith
creation_date: 2012-03-23T08:11:18Z

[Term]
id: XCO:0000153
name: sample resting period
def: "A predetermined and specified amount of time during which an experimental specimen sits undisturbed, for example to allow a chemical reaction to proceed." [RGD:JRS]
synonym: "sample room temperature incubation" NARROW []
is_a: XCO:0000000 ! experimental condition
created_by: JSmith
creation_date: 2012-03-26T10:46:30Z

[Term]
id: XCO:0000154
name: ion/salt solution
def: "This is any condition in which the main influencing factor is a homogeneous mixture of one or more ions, i.e. atoms or molecules that have gained or lost electron(s) and thereby acquired a charge, or one or more salts, i.e. members of the large class of chemical compounds formed when a positively charged ion (a cation) bonds with a negatively charged ion (an anion), dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [American_Heritage:The_American_Heritage_Science_Dictionary_2005, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000340 ! solution
relationship: has_component XCO:0000149 ! ion/salt
created_by: JSmith
creation_date: 2012-03-26T04:34:54Z

[Term]
id: XCO:0000155
name: sodium chloride solution
def: "A condition in which the main influencing factor is a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "saline solution" RELATED []
synonym: "salt solution" EXACT []
xref: CHEBI:26710
is_a: XCO:0000254 ! sodium ion solution
created_by: JSmith
creation_date: 2012-03-26T04:36:15Z

[Term]
id: XCO:0000156
name: 0.9% sodium chloride solution
def: "This is any condition in which the main influencing factor is a solution of sodium chloride (NaCl) and water in which the level of NaCl is maintained at a mass concentration of 9 grams per liter (0.9 grams per 100 mls of solution, or 0.9 % m/v). The osmolarity of normal saline is a close approximation to the osmolarity of NaCl in blood." [http://en.wikipedia.org/wiki/Saline_%28medicine%29 "Wikipedia"]
synonym: "0.9% Sodium Chloride Injection" RELATED []
synonym: "isotonic saline" EXACT []
synonym: "normal saline" EXACT []
synonym: "physiological saline" EXACT []
synonym: "physiological salt solution" EXACT []
synonym: "PSS" EXACT []
xref: CHEBI:26710
is_a: XCO:0000155 ! sodium chloride solution
created_by: JSmith
creation_date: 2012-03-26T04:56:10Z

[Term]
id: XCO:0000157
name: physical restraint
def: "The use of manual or mechanical means to limit some or all of an animal's normal movement for the purpose of examination, collection of samples, drug administration, therapy, or experimental manipulation." [http://grants.nih.gov/grants/olaw/Guide-for-the-care-and-use-of-Laboratory-animals.pdf "NIH"]
is_a: XCO:0001100 ! physical manipulation
relationship: part_of XCO:0001275 ! unpredictable chronic mild stress
created_by: JSmith
creation_date: 2012-06-07T12:30:41Z

[Term]
id: XCO:0000158
name: physical restraint in mechanical restrainer
def: "The use of mechanical means, i.e. a manufactured apparatus or machine, to limit some or all of an animal's normal movements." [http://grants.nih.gov/grants/olaw/Guide-for-the-care-and-use-of-Laboratory-animals.pdf "NIH", RGD:JRS]
is_a: XCO:0000157 ! physical restraint
created_by: JSmith
creation_date: 2012-06-07T12:42:46Z

[Term]
id: XCO:0000159
name: physical restraint in tube type rodent restrainer
def: "The use of a tube type rodent restrainer, that is, a hollow cylinder usually made of a rigid clear material in a size that approximates the size of the animal and can be capped at one or both ends to prevent escape, to limit some or all of an animal's normal movements." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, http://grants.nih.gov/grants/olaw/Guide-for-the-care-and-use-of-Laboratory-animals.pdf "NIH"]
is_a: XCO:0000158 ! physical restraint in mechanical restrainer
created_by: JSmith
creation_date: 2012-06-07T12:43:33Z

[Term]
id: XCO:0000160
name: receptor antagonist
def: "A substance that binds to a receptor without eliciting a biological response, blocking binding of substances that could elicit such responses." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000120 ! inhibitor
created_by: JSmith
creation_date: 2012-07-03T03:15:44Z

[Term]
id: XCO:0000161
name: losartan
def: "This is any condition whose main influencing factor is losartan, an angiotensin II receptor antagonist and vasodilator which consists of a biphenylyltetrazole where a 1,1'-biphenyl group is attached at the 5-position. Losartan also has an additional trisubstituted imidazol-1-ylmethyl group at the 4'-position." []
xref: CHEBI:6541
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000536 ! angiotensin II receptor antagonist
created_by: JSmith
creation_date: 2012-07-09T10:53:01Z

[Term]
id: XCO:0000162
name: pentolinium
def: "Nicotinic acetylcholine receptor antagonist, ganglionic blocking agent and vasodilator which consists of a dication whose structure comprises a pentane backbone linking two 1-methylpyrrolidinium groups." []
xref: CHEBI:347401
xref: CHEBI:55326
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000160 ! receptor antagonist
created_by: JSmith
creation_date: 2012-07-09T10:58:54Z

[Term]
id: XCO:0000163
name: controlled content drinking water
def: "This is any condition in which the main influencing factor is drinking water in which the amount of one or more solutes are adjusted to a requirement." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed]
is_a: XCO:0000021 ! water
created_by: JSmith
creation_date: 2012-07-09T11:14:14Z

[Term]
id: XCO:0000164
name: controlled sodium content drinking water
def: "A drink made up of water and a specified amount of sodium, i.e. sodium ions, consumed by an organism as part of an experiment. A sodium ion is an atom of sodium, the chemical element with atomic number 11, that has lost one electron, forming a cation with a charge of +1." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000163 ! controlled content drinking water
is_a: XCO:0000254 ! sodium ion solution
created_by: JSmith
creation_date: 2012-07-09T11:19:29Z

[Term]
id: XCO:0000165
name: surgical manipulation
def: "This is any process involving manual and instrumental techniques for incision or excision of a part of an organism to investigate and/or treat a pathological condition." [http://en.wikipedia.org/wiki/Surgery "Wikipedia"]
synonym: "Not4Curation" RELATED []
is_a: XCO:0000000 ! experimental condition
created_by: JSmith
creation_date: 2012-07-11T01:38:55Z

[Term]
id: XCO:0000166
name: controlled in situ organ condition
def: "Any experimental condition in which the internal or external environment of an organ, that is, a differentiated, structural part of a system of the body that performs a specific function, is experimentally manipulated, for example through perfusion, increased or decreased blood flow, etc. without removal from the body." [http://www.thefreedictionary.com/ "Multiple_Dictionaries", RGD:JRS, RGD:MRD]
is_a: XCO:0000165 ! surgical manipulation
created_by: JSmith
creation_date: 2012-07-11T02:55:03Z

[Term]
id: XCO:0000167
name: controlled in situ kidney condition
def: "Any experimental condition in which the internal or external environment of one or both kidneys, the organ which functions to maintain proper water and electrolyte balance, regulate acid-base concentration, and filter the blood of metabolic wastes, is experimentally manipulated, for example through perfusion, increased or decreased blood flow, etc. without removal from the body." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, RGD:JRS]
is_a: XCO:0000166 ! controlled in situ organ condition
created_by: JSmith
creation_date: 2012-07-11T03:01:51Z

[Term]
id: XCO:0000168
name: controlled in situ renal perfusion pressure
def: "Condition in which the difference in pressure between the arteries and veins in the kidney, the organ which functions to maintain proper water and electrolyte balance, regulate acid-base concentration, and filter the blood of metabolic wastes, is experimentally regulated, for example by injecting or pumping a fluid into the kidney at a specified pressure or by regulating the blood flow through the kidney, without removal of the organ from the body." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000167 ! controlled in situ kidney condition
created_by: JSmith
creation_date: 2012-07-11T03:07:44Z

[Term]
id: XCO:0000169
name: labeled chemical
def: "Any chemical to which a tracer has been added such as the addition of a fluorescent tag or inclusion of a radioactive element during synthesis." [RGD:JRS]
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2012-07-11T03:39:04Z

[Term]
id: XCO:0000170
name: fluorescently labeled chemical
def: "Chemical to which a fluorescent tag has been added as a tracer." [RGD:JRS]
is_a: XCO:0000169 ! labeled chemical
created_by: JSmith
creation_date: 2012-07-11T03:51:55Z

[Term]
id: XCO:0000171
name: radioactively labeled chemical
def: "Chemical into which a radioactive element has been incorporated as a tracer." [RGD:JRS]
is_a: XCO:0000169 ! labeled chemical
created_by: JSmith
creation_date: 2012-07-11T03:53:33Z

[Term]
id: XCO:0000172
name: carbohydrate
def: "Any of a group of organic compounds that includes sugars, starches, celluloses, and gums and serves as a major energy source in the diet of animals." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
xref: CHEBI:16646
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2012-07-11T04:09:48Z

[Term]
id: XCO:0000173
name: polysaccharide
def: "This is any condition whose main influencing factor is a polysaccharide, a macromolecule consisting of large numbers (>10) of monosaccharide residues, that is, simple carbohydrate residues each consisting of a single basic sugar unit with the general formula (CH2O)n, linked glycosidically." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "polysaccharides" EXACT []
xref: CHEBI:18154
is_a: XCO:0000172 ! carbohydrate
created_by: JSmith
creation_date: 2012-07-11T04:13:15Z

[Term]
id: XCO:0000174
name: inulin
def: "A fructose-based starch derived from rhizomes of plants from the Compositae family and used as a diagnostic aid in tests of kidney function, specifically glomerular filtration." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
xref: CHEBI:15443
is_a: XCO:0000173 ! polysaccharide
created_by: JSmith
creation_date: 2012-07-11T04:15:22Z

[Term]
id: XCO:0000175
name: tritiated inulin
def: "Inulin, a fructose-based starch derived from rhizomes of plants from the Compositae family and used as a diagnostic aid in tests of kidney function, specifically glomerular filtration, into which the mass 3 radioactive isotope of hydrogen has been incorporated as a tracer." [Mosby:Mosbys_Medical_Dictionary--8th_Ed, Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
synonym: "3H-inulin" EXACT []
is_a: XCO:0000171 ! radioactively labeled chemical
is_a: XCO:0000174 ! inulin
created_by: JSmith
creation_date: 2012-07-11T04:18:17Z

[Term]
id: XCO:0000176
name: enzyme
def: "Any of numerous proteins or conjugated proteins produced by living organisms and functioning as specialized catalysts for biochemical reactions." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
is_a: XCO:0000193 ! peptide/protein
created_by: JSmith
creation_date: 2012-07-12T05:06:15Z

[Term]
id: XCO:0000177
name: thrombin
def: "An enzyme in blood formed from prothrombin that facilitates blood clotting by reacting with fibrinogen to form fibrin, as well as participating in additional steps in the coagulation pathway." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, http://en.wikipedia.org/wiki/Thrombin "Wikipedia"]
xref: EC:3.4.21.5
is_a: XCO:0000176 ! enzyme
created_by: JSmith
creation_date: 2012-07-12T05:13:12Z

[Term]
id: XCO:0000178
name: thapsigargin
def: "A non-competitive inhibitor of the sarco / endoplasmic reticulum Ca2+ ATPase (SERCA) class of enzymes. Acts as a non-phorbol-ester-type tumor promoter and acts as an inhibitor of calcium ATPase of endoplasmic reticulum, leading to an increase in cytoplasmic calcium ions." [http://en.wikipedia.org/wiki/Thapsigargin "Wikipedia", Mondofacto:Mondofacto_Online_Medical_Dictionary]
xref: CHEBI:9516
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000892 ! tumor promoter
created_by: JSmith
creation_date: 2012-07-12T05:24:18Z

[Term]
id: XCO:0000179
name: ionizing ultraviolet radiation exposure
def: "The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths between 10 and 120 nm. Radiation (i.e. ultraviolet light) at this wavelength is considered  ionizing, that is, composed of photons that individually carry enough energy to liberate an electron from an atom or molecule without raising the bulk material to ionization temperature." [http://en.wikipedia.org/wiki/Electromagnetic_Radiation "Wikipedia", http://en.wikipedia.org/wiki/Ionizing_radiation "Wikipedia"]
synonym: "extreme ultraviolet ray exposure" RELATED []
synonym: "extreme UV ray exposure" RELATED []
synonym: "ionizing UV radiation exposure" EXACT []
is_a: XCO:0000039 ! ionizing radiation exposure
is_a: XCO:0000042 ! ultraviolet ray exposure
created_by: JSmith
creation_date: 2012-07-13T12:39:17Z

[Term]
id: XCO:0000180
name: non-ionizing ultraviolet radiation exposure
def: "The condition of being subjected to electromagnetic radiation, that is, energy emitted and absorbed by charged particles, which exhibits wave-like behavior as it travels and has both electric and magnetic field components, with wavelengths between 120 and 400 nm. Radiation (i.e. ultraviolet light) at this wavelength does not have sufficient energy to liberate electrons from atoms or molecules although it can induce photochemical reactions, or accelerate radical reactions." [http://en.wikipedia.org/wiki/Electromagnetic_Radiation "Wikipedia", http://en.wikipedia.org/wiki/Ultraviolet "Wikipedia"]
synonym: "near ultraviolet radiation exposure" NARROW []
synonym: "non-ionizing UV radiation exposure" EXACT []
is_a: XCO:0000042 ! ultraviolet ray exposure
is_a: XCO:0000044 ! non-ionizing radiation exposure
created_by: JSmith
creation_date: 2012-07-13T01:00:12Z

[Term]
id: XCO:0000181
name: controlled visible light condition
def: "Condition in which the presence or absence of visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, is constrained." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
is_a: XCO:0000000 ! experimental condition
created_by: JSmith
creation_date: 2012-07-13T02:59:55Z

[Term]
id: XCO:0000182
name: controlled exposure to ambient light
def: "Condition in which the natural, usual or environmental level and/or time of exposure to visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, is controlled." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
synonym: "diurnal condition" RELATED []
is_a: XCO:0000284 ! controlled visible light exposure
created_by: JSmith
creation_date: 2012-07-13T03:09:31Z

[Term]
id: XCO:0000183
name: controlled exposure to darkness
def: "Condition during which visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, is removed." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
synonym: "nocturnal condition" RELATED []
is_a: XCO:0000181 ! controlled visible light condition
created_by: JSmith
creation_date: 2012-07-13T03:12:34Z

[Term]
id: XCO:0000184
name: calcium ion
def: "The divalent cation of calcium, the chemical element with symbol Ca and atomic number 20." [http://en.wikipedia.org/wiki/Calcium "Wikipedia"]
xref: CHEBI:29108
is_a: XCO:0000149 ! ion/salt
created_by: JSmith
creation_date: 2012-07-13T03:19:56Z

[Term]
id: XCO:0000185
name: calcium ion solution
def: "A solution of the divalent cation of calcium, the chemical element with symbol Ca and atomic number 20." [http://en.wikipedia.org/wiki/Calcium "Wikipedia"]
xref: CHEBI:29108
is_a: XCO:0000154 ! ion/salt solution
relationship: has_component XCO:0000184 ! calcium ion
created_by: JSmith
creation_date: 2012-07-13T03:25:32Z

[Term]
id: XCO:0000186
name: cytisine
def: "A toxic selective nicotinic cholinergic alkaloid from the seed of Laburnum anagyroides and other Leguminosae. Used in pharmacological studies of nicotinic cholinergic receptors in the brain." [Mondofacto:Mondofacto_Online_Medical_Dictionary]
synonym: "baptitoxine" RELATED []
synonym: "sophorine" RELATED []
xref: CAS:485-35-8
is_a: XCO:0000693 ! cholinergic agonist
created_by: JSmith
creation_date: 2012-07-30T08:40:00Z

[Term]
id: XCO:0000187
name: trimethaphan camsylate
def: "A drug that counteracts cholinergic transmission at the ganglion type of nicotinic receptors of the autonomic ganglia by acting as a non-depolarizing competitive antagonist at the nicotinic acetylcholine receptor." [http://en.wikipedia.org/wiki/Trimethaphan_camsylate "Wikipedia"]
synonym: "Arfonad" RELATED []
synonym: "trimetaphan camsilate" EXACT []
xref: CAS:7187-66-8
xref: CHEBI:9729
is_a: XCO:0000842 ! nicotinic antagonist
created_by: JSmith
creation_date: 2012-07-30T08:54:30Z

[Term]
id: XCO:0000188
name: darodipine
def: "Calcium channel blocker." [http://en.wikipedia.org/wiki/Darodipine "Wikipedia"]
synonym: "PY 108-068" RELATED []
xref: CAS:72803-02-2
is_a: XCO:0000269 ! calcium channel inhibitor
created_by: JSmith
creation_date: 2012-07-30T09:01:57Z

[Term]
id: XCO:0000189
name: physical restraint on immobilization board
def: "Immobilization of a subject on a frame or platform by securing all four limbs to it, e.g. by taping them to mounts attached to the frame, thereby eliminating the subject's ability to move at will." [Fink:Encyclopedia_of_Stress]
is_a: XCO:0000158 ! physical restraint in mechanical restrainer
created_by: JSmith
creation_date: 2012-08-01T04:38:43Z

[Term]
id: XCO:0000190
name: angiotensin I
def: "The 10 amino acid cleavage product produced by the action of renin on angiotensinogen.  Ang I is apparently inactive unless further cleaved by angiotensin-converting enzyme (ACE) into Ang II." [PMID:18793332]
is_a: XCO:0000126 ! angiotensin
created_by: JSmith
creation_date: 2012-08-09T01:48:44Z

[Term]
id: XCO:0000191
name: angiotensin II
def: "The 8 amino acid cleavage product produced by the action of angiotensin-converting enzyme (ACE) on Ang I.  Ang II is considered to be the main effector of the renin-angiotensin system (RAS), has endocrine, autocrine/paracrine, and intracrine hormone activities in the body and acts as a powerful vasoconstrictor." [PMID:18793332]
xref: CHEBI:48432
is_a: XCO:0000126 ! angiotensin
created_by: JSmith
creation_date: 2012-08-09T01:58:29Z

[Term]
id: XCO:0000192
name: deoxycorticosterone acetate
def: "The acetate ester of 11-deoxycorticosterone, a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone." [http://en.wikipedia.org/wiki/11-Deoxycorticosterone "Wikipedia"]
synonym: "21-hydroxyprogesterone acetate" RELATED []
synonym: "desoxycorticosterone acetate" RELATED []
synonym: "DOCA" RELATED []
xref: CHEBI:16973
is_a: XCO:0000330 ! deoxycorticosterone
created_by: JSmith
creation_date: 2012-08-09T02:19:10Z

[Term]
id: XCO:0000193
name: peptide/protein
def: "Any natural or synthetic complex organic macromolecule composed of chain(s) of amino acids. A peptide can be contain as few as two amino acids; a protein can contain multiple chains composed of hundreds of amino acids." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "polypeptide" RELATED []
is_a: XCO:0000342 ! chemical with specified structure
created_by: jsmith
creation_date: 2012-08-27T04:50:37Z

[Term]
id: XCO:0000194
name: antibody
def: "An immunoglobulin molecule having a specific amino acid sequence that gives each antibody the ability to adhere to and interact only with the antigen that induced its synthesis and with molecules containing structures similar to that antigen.  An antigen is any substance capable of inducing a specific immune response, including but not limited to toxins, bacterial proteins and viruses." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
synonym: "immunoglobulin" RELATED []
is_a: XCO:0000193 ! peptide/protein
created_by: jsmith
creation_date: 2012-08-27T05:01:08Z

[Term]
id: XCO:0000195
name: myelin oligodendrocyte glycoprotein
def: "A membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is considered a primary target antigen involved in immune-mediated demyelination." [NCBI_Gene:4340]
synonym: "Mog" RELATED []
synonym: "RGD:3102" NARROW []
synonym: "rMog (recombinant Mog)" RELATED []
is_a: XCO:0000193 ! peptide/protein
created_by: jsmith
creation_date: 2012-08-27T05:05:03Z

[Term]
id: XCO:0000196
name: glybenclamide
def: "ATP-sensitive potassium channel inhibitor used as an anti-arrhythmia drug and a hypoglycemic/anti-diabetes drug. In the latter case, the drug causes beta cell membrane depolarization, which in turn results in opening of voltage-dependent calcium channels and subsequent insulin release." [http://en.wikipedia.org/wiki/Glibenclamide "Wikipedia"]
synonym: "glyburide" EXACT []
xref: CHEBI:5441
is_a: XCO:0000225 ! potassium channel inhibitor
created_by: JSmith
creation_date: 2012-09-10T11:39:12Z

[Term]
id: XCO:0000197
name: indicator
def: "Any substance that indicates the presence, absence, or concentration of another substance or the degree of reaction between substances by means of a characteristic change, especially in color." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-09-10T12:25:59Z

[Term]
id: XCO:0000198
name: pH indicator
def: "Any substance that indicates the concentration of hydrogen ions, that is the acidity level, of a solution by means of a characteristic change, especially in color." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
is_a: XCO:0000197 ! indicator
created_by: JSmith
creation_date: 2012-09-10T12:30:07Z

[Term]
id: XCO:0000199
name: oxidation-reduction indicator
def: "Any substance which indicates the oxidation status of another substance or of a reaction by means of a characteristic change, especially in color." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
synonym: "redox indicator" EXACT []
is_a: XCO:0000197 ! indicator
created_by: JSmith
creation_date: 2012-09-10T12:34:38Z

[Term]
id: XCO:0000200
name: 4-methyl-2-oxopentanoic acid
def: "A monocarboxylic acid that serves as an intermediate in the metabolism of leucine and a substrate for NADPH-dependent dehydrogenases." [http://en.wikipedia.org/wiki/Alpha-Ketoisocaproic_acid "Wikipedia"]
synonym: "2-Oxoisocaproate" EXACT []
synonym: "4-methyl-2-oxovaleric acid" EXACT []
synonym: "alpha-ketoisocaproic acid" EXACT []
synonym: "alpha-KIC" RELATED []
synonym: "Ketoleucine" RELATED []
xref: CHEBI:48430
xref: pubchem.compound:70
is_a: XCO:0000136 ! enzyme substrate
created_by: JSmith
creation_date: 2012-09-10T12:50:31Z

[Term]
id: XCO:0000201
name: orchiectomy
def: "Surgical removal of one or both testes." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
synonym: "orchidectomy" EXACT []
synonym: "testectomy" EXACT []
is_a: XCO:0000026 ! surgical removal
created_by: JSmith
creation_date: 2012-09-10T01:13:58Z

[Term]
id: XCO:0000202
name: unilateral orchiectomy
def: "Surgical removal of a single testis." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
synonym: "unilateral orchidectomy" EXACT []
synonym: "unilateral testectomy" RELATED []
is_a: XCO:0000201 ! orchiectomy
created_by: JSmith
creation_date: 2012-09-10T01:18:15Z

[Term]
id: XCO:0000203
name: bilateral orchiectomy
def: "Surgical removal of both testes." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
synonym: "bilateral orchidectomy" EXACT []
synonym: "bilateral testectomy" EXACT []
synonym: "castration" RELATED []
is_a: XCO:0000201 ! orchiectomy
created_by: JSmith
creation_date: 2012-09-10T01:20:16Z

[Term]
id: XCO:0000204
name: testosterone
def: "The principal androgenic, that is, male sex hormone. Responsible for regulation of gonadotropic secretion, spermatogenesis and control of other male characteristics." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000229 ! steroid hormone
created_by: JSmith
creation_date: 2012-09-10T01:41:13Z

[Term]
id: XCO:0000205
name: mutation inducing chemical
def: "An agent that causes or increases the frequency of permanent, heritable changes in the DNA sequence or chromosomal structure of a cell or organism." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "mutagen" EXACT []
synonym: "mutation inducing agent" RELATED []
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-09-11T04:39:32Z

[Term]
id: XCO:0000206
name: N-nitrosodiethylamine
def: "A component of tobacco smoke which has been shown to be mutagenic and carcinogenic in animal studies." [PMID:8910949]
synonym: "diethylnitrosamine" RELATED []
synonym: "NDEA" RELATED []
synonym: "N,N-diethylnitrosamine" RELATED []
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000205 ! mutation inducing chemical
created_by: JSmith
creation_date: 2012-09-11T05:01:10Z

[Term]
id: XCO:0000207
name: 3-methyl-4'-dimethylaminoazobenzene
def: "A condition in which the main influencing factor is 3-methyl-4'-dimethylaminoazobenzene (MDAB), an azobenzene in which one of the phenyl groups is substituted at position 3 by a methyl group, while the other is substituted at position 4 by a dimethylamino group. MDAB is a potent liver carcinogen." [http://potency.berkeley.edu/chempages/3%27-METHYL-4-DIMETHYLAMINOAZOBENZENE.html "Website"]
synonym: "3'-Me-DAB" RELATED []
synonym: "3'-methyl-4-(dimethylamino)azobenzene" RELATED []
synonym: "4-Dimethylamino-3'-methylazobenzene" EXACT []
synonym: "MDAB" RELATED []
synonym: "methyldimethylaminoazobenzene" EXACT []
xref: CAS:55-80-1
xref: CHEBI:76329
xref: pubchem.compound:5934
is_a: XCO:0000089 ! neoplasm-inducing chemical
created_by: JSmith
creation_date: 2012-09-11T05:33:14Z

[Term]
id: XCO:0000208
name: 2-acetamidofluorene
def: "A condition in which the main influencing factor is 2-acetamidofluorene (2-AAF) an ortho-fused polycyclic arene that consists of 9H-fluorene bearing an acetamido substituent at position 2. 2-AAF and a number of its metabolites are both carcinogenic and mutagenic." [http://en.wikipedia.org/wiki/Acetylaminofluorene "Wikipedia"]
synonym: "2-AAF" RELATED []
synonym: "2-acetylaminofluorene" RELATED []
xref: CHEBI:17356
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000205 ! mutation inducing chemical
created_by: JSmith
creation_date: 2012-09-13T06:33:44Z

[Term]
id: XCO:0000209
name: hepatectomy
is_a: XCO:0000026 ! surgical removal
created_by: JSmith
creation_date: 2012-09-13T06:34:26Z

[Term]
id: XCO:0000210
name: partial hepatectomy
def: "A condition involving the surgical excision of part of the liver, the large abdominal organ/gland which functions in the storage and filtration of blood, secretion of bile, and other processes. The partial liver removal may be minor (< 50%) or major (> 50%)." [ISBN-13:9780781733908, PMID:32156510]
synonym: "major hepatectomy" NARROW []
synonym: "minor hepatectomy" NARROW []
xref: PMID:32156510
is_a: XCO:0000209 ! hepatectomy
created_by: JSmith
creation_date: 2012-09-13T06:34:52Z

[Term]
id: XCO:0000211
name: controlled sucrose content diet
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000432 ! sucrose
created_by: JSmith
creation_date: 2012-09-13T06:36:13Z

[Term]
id: XCO:0000212
name: controlled copper content diet
def: "A regimen of solid food in which the amount of copper consumed is controlled." [https://www.merriam-webster.com, ISBN-13:9780781733908]
synonym: "controlled Cu content diet" EXACT []
is_a: XCO:0000920 ! controlled mineral content diet
created_by: JSmith
creation_date: 2012-09-13T06:36:56Z

[Term]
id: XCO:0000213
name: arginine
def: "Any condition in which the main influencing factor is arginine (L-arginine), an alpha-amino acid that is glycine in which the alpha-is substituted by a 3-guanidinopropyl group." [CHEBI:29016, https://en.wikipedia.org/wiki/Arginine]
synonym: "2-amino-5-guanidinopentanoic acid" EXACT []
synonym: "ARG" EXACT []
synonym: "L-arginine" EXACT []
synonym: "R" EXACT []
xref: CHEBI:29016
xref: MESH:D001120
is_a: XCO:0000119 ! amino acid
created_by: JSmith
creation_date: 2012-09-13T06:45:59Z

[Term]
id: XCO:0000214
name: activator
def: "Any substance that makes another substance active or reactive, induces a chemical reaction, or combines with an enzyme to increase its catalytic activity." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
synonym: "Not4Curation" RELATED []
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-10-04T05:09:16Z

[Term]
id: XCO:0000215
name: controlled calcium ion content physiological salt solution perfusate
def: "A fluid which is injected or pumped into an organ or tissue, usually via blood vessels, composed of a solution of sodium chloride at a concentration which closely approximates the osmolarity of salt in blood, and which contains a specific, controlled concentration of calcium ions, divalent cations of the metallic chemical element with atomic number 20, dissolved in it." [American_Heritage:The_American_Heritage_Science_Dictionary_2005, http://en.wikipedia.org/wiki/Saline_%28medicine%29#Normal "Wikipedia"]
is_a: XCO:0000147 ! physiological salt solution perfusate
created_by: JSmith
creation_date: 2012-10-05T11:11:47Z

[Term]
id: XCO:0000216
name: ion channel activator
def: "Any chemical substance which increases the activity of an ion channel, one or more membrane-bound globular proteins that allow diffusion of specific ions across a cell membrane." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "ion channel agonist" RELATED []
is_a: XCO:0000214 ! activator
created_by: JSmith
creation_date: 2012-10-04T05:16:39Z

[Term]
id: XCO:0000217
name: cation channel activator
def: "Any chemical substance which increases the activity of a cation channel, one or more membrane-bound globular proteins that allow diffusion of positively charged ions across a cell membrane." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000216 ! ion channel activator
created_by: JSmith
creation_date: 2012-10-04T05:40:42Z

[Term]
id: XCO:0000218
name: 4-alpha-phorbol 12,13-didecanoate
def: "A phorbol ester analog that is an activator of TRPV4 (transient receptor potential cation channel, subfamily V, member 4) channels." [http://www.lclabs.com/PRODFILE/P-R/P-2170.php4 "Website"]
synonym: "4-alpha-PDD" EXACT []
xref: CHEBI:295732
xref: pubchem.compound:452544
is_a: XCO:0000217 ! cation channel activator
created_by: JSmith
creation_date: 2012-10-04T05:41:38Z

[Term]
id: XCO:0000219
name: dihydrocapsaicin
def: "A capsaicinoid which is an irritant and a selective TRPV1 (transient receptor potential cation channel, subfamily V, member 1) agonist." [http://datasheets.scbt.com/sc-202578.pdf "Website"]
synonym: "8-Methyl-N-vanillylnonanamide" EXACT []
synonym: "DHC" RELATED []
synonym: "N-(4-Hydroxy-3-methoxybenzyl)-8-methylnonanamide" EXACT []
xref: CHEBI:46932
is_a: XCO:0000217 ! cation channel activator
created_by: JSmith
creation_date: 2012-10-04T06:08:13Z

[Term]
id: XCO:0000220
name: anion channel agonist
def: "Any chemical substance which increases the activity of an anion channel, one or more membrane-bound globular proteins that allow diffusion of negatively charged ions across a cell membrane." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000216 ! ion channel activator
created_by: JSmith
creation_date: 2012-10-04T06:11:24Z

[Term]
id: XCO:0000221
name: ion channel inhibitor
def: "Any chemical substance which decreases or interferes with the activity of an ion channel, one or more membrane-bound globular proteins that allow diffusion of specific ions across a cell membrane." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "ion channel antagonist" RELATED []
is_a: XCO:0000120 ! inhibitor
created_by: JSmith
creation_date: 2012-10-04T06:13:42Z

[Term]
id: XCO:0000222
name: cation channel inhibitor
def: "Any chemical substance which decreases or interferes with the activity of a cation channel, one or more membrane-bound globular proteins that allow diffusion of positively charged ions across a cell membrane." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "cation channel antagonist" RELATED []
is_a: XCO:0000221 ! ion channel inhibitor
created_by: JSmith
creation_date: 2012-10-05T10:45:01Z

[Term]
id: XCO:0000223
name: anion channel inhibitor
def: "Any chemical substance which decreases or interferes with the activity of an anion channel, one or more membrane-bound globular proteins that allow diffusion of negatively charged ions across a cell membrane." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "anion channel antagonist" RELATED []
is_a: XCO:0000221 ! ion channel inhibitor
created_by: JSmith
creation_date: 2012-10-05T10:48:12Z

[Term]
id: XCO:0000224
name: ruthenium red
def: "An inorganic dye which also intereacts with many types of proteins including ion channels and enzymes." [http://en.wikipedia.org/wiki/Ruthenium_red "Wikipedia"]
synonym: "ammoniated ruthenium oxychloride" EXACT []
synonym: "RuR" RELATED []
xref: CHEBI:34956
is_a: XCO:0000222 ! cation channel inhibitor
created_by: JSmith
creation_date: 2012-10-05T11:03:00Z

[Term]
id: XCO:0000225
name: potassium channel inhibitor
def: "Any chemical substance which decreases or interferes with the activity of a potassium ion channel, that is, a complex of membrane-bound and membrane-spanning proteins that specifically allow diffusion of positively charged potassium ions across a cell membrane." [http://en.wikipedia.org/wiki/Potassium_channel "Wikipedia"]
is_a: XCO:0000222 ! cation channel inhibitor
created_by: JSmith
creation_date: 2012-10-05T11:29:50Z

[Term]
id: XCO:0000226
name: apamin
def: "An 18 amino acid peptide neurotoxin from bee venom which blocks small-conductance Ca2+-activated K+ channels." [http://en.wikipedia.org/wiki/Apamin "Wikipedia"]
synonym: "apamine" EXACT []
xref: pubchem.compound:16129677
xref: UniProtKB:P01500
is_a: XCO:0000225 ! potassium channel inhibitor
created_by: JSmith
creation_date: 2012-10-05T11:41:19Z

[Term]
id: XCO:0000227
name: charybdotoxin
def: "A 37 amino acid peptide neurotoxin from scorpion venom that is a blocker of large- and intermediate-conductance Ca2+-activated K+ channels." [http://en.wikipedia.org/wiki/Charybdotoxin "Wikipedia"]
synonym: "ChTX" RELATED []
synonym: "ChTx-a" RELATED []
synonym: "ChTX-Lq1" RELATED []
xref: UniProtKB:P13487
is_a: XCO:0000225 ! potassium channel inhibitor
created_by: JSmith
creation_date: 2012-10-05T11:53:12Z

[Term]
id: XCO:0000228
name: peptide hormone
def: "A molecular chain compound composed of two or more amino acids joined by peptide bonds that in its endogenous state is produced in one part or organ of the body and initiates or regulates the activity of an organ or a group of cells in another part of the body." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000125 ! hormone
is_a: XCO:0000193 ! peptide/protein
created_by: JSmith
creation_date: 2012-10-15T04:30:11Z

[Term]
id: XCO:0000229
name: steroid hormone
def: "A condition in which the main influencing factor is a chemical substance the structure of which is based on the basic 17-carbon-atom ring system steroid nucleus but may or may not have the characteristic arrangement of four fused cycloalkane rings, and which is produced in its endogenous state by an organ, cells of an organ or scattered cells, having a specific regulatory affect on the activity of an organ or tissue." [CHEBI:35341, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
xref: CHEBI:26764
is_a: XCO:0000091 ! steroid
is_a: XCO:0000125 ! hormone
created_by: JSmith
creation_date: 2012-10-15T04:36:54Z

[Term]
id: XCO:0000230
name: monoamine hormone
def: "A chemical substance consisting of an amine compound which contains one amino group and was derived from an aromatic amino acid, that in its endogenous state is produced in one part or organ of the body and initiates or regulates the activity of an organ or a group of cells in another part of the body." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000125 ! hormone
created_by: JSmith
creation_date: 2012-10-15T04:51:18Z

[Term]
id: XCO:0000231
name: anti-RT6.1 antibody
def: "Antibody directed against the RT6.1 cell surface alloantigen (also known as ART2, Pta.A2, and Ag-F1). RT6.1 is an allelic form of the RT6 antigen which is expressed on most peripheral T cells but not on thymocytes." [PMID:7559400]
synonym: "anti-ADP-ribosyltransferase 2 antibody" EXACT []
synonym: "anti-Art2.1 mAb" RELATED []
synonym: "Art2 antibody" EXACT []
synonym: "DS4.23 mAb" RELATED []
is_a: XCO:0000194 ! antibody
created_by: JSmith
creation_date: 2012-10-16T12:39:20Z

[Term]
id: XCO:0000232
name: nucleic acid
def: "A high-molecular-weight polymeric compound composed of nucleotides, each consisting of a purine or pyrimidine base, a ribose or deoxyribose sugar, and a phosphate group." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0001107 ! polymer
created_by: JSmith
creation_date: 2012-10-16T01:26:26Z

[Term]
id: XCO:0000233
name: ribonucleic acid
def: "A long, polymeric chain of alternating phosphate and ribose units with the bases adenine, guanine, cytosine, and uracil bonded to the ribose. Although RNA is usually single-stranded it can also exist as RNA:RNA or RNA:DNA double-stranded molecules." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed]
synonym: "RNA" EXACT []
is_a: XCO:0000232 ! nucleic acid
created_by: JSmith
creation_date: 2012-10-16T02:15:23Z

[Term]
id: XCO:0000234
name: deoxyribonucleic acid
def: "A long, polymeric chain of alternating phosphate and deoxyribose units with the bases adenine, guanine, cytosine, and thymine bonded to the deoxyribose. DNA can be single stranded or double stranded, that is, composed of either a single polymer or a pair of antiparallel polymers joined by hydrogen bonding between complementary bases." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
synonym: "DNA" EXACT []
is_a: XCO:0000232 ! nucleic acid
created_by: JSmith
creation_date: 2012-10-16T02:22:54Z

[Term]
id: XCO:0000235
name: poly I:C
def: "This is any condition in which the main influencing factor is poly I:C, a synthetic dsRNA composed of a strand of poly(I) annealed to a strand of poly(C). Poly(I:C) is acts as an immunostimulant and mimics a viral infection by interacting with Toll-like receptor 3 (TLR3)." [http://www.invivogen.com/tlr3-ligands?gclid=CLDYv5u4wLICFahaMgod_H8AGg "Website"]
synonym: "dsRNA poly(I:C)" EXACT []
synonym: "poly(I:C)" EXACT []
synonym: "Poly(I:C) dsRNA" EXACT []
synonym: "polyinosine-polycytidylic acid" EXACT []
synonym: "Polyinosinic:polycytidylic acid" EXACT []
is_a: XCO:0000233 ! ribonucleic acid
created_by: JSmith
creation_date: 2012-10-16T02:34:34Z

[Term]
id: XCO:0000236
name: pathogen
def: "An biological agent that causes disease, especially a living microorganism such as a bacterium, virus, or fungus." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
is_a: XCO:0000258 ! disease-inducing agent
created_by: JSmith
creation_date: 2012-10-16T03:04:11Z

[Term]
id: XCO:0000237
name: viral pathogen
def: "A virus which has the potential to cause disease. A virus is one of a group of heterogeneous infective agents characterized by their lack of independent metabolism, their inability to replicate outside a host cell, their simple organization and their unique mode of replication. A virus consists of genetic material--either DNA or RNA--surrounded by a protein coat and, in some cases, by a membranous envelope." [Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
synonym: "virus" EXACT []
is_a: XCO:0000236 ! pathogen
created_by: JSmith
creation_date: 2012-10-16T03:06:55Z

[Term]
id: XCO:0000238
name: Kilham rat virus
def: "A common parvovirus pathogen which causes largely asymptomatic infections in rats. KRV can be used to model environmental influences in the development of type 1 diabetes mellitus." [http://www.criver.com/SiteCollectionDocuments/rm_ld_r_Rat_Parvoviruses.pdf "Website", PMID:19720792]
synonym: "KRV" RELATED []
is_a: XCO:0000237 ! viral pathogen
created_by: JSmith
creation_date: 2012-10-16T03:20:45Z

[Term]
id: XCO:0000239
name: toxic substance
def: "A chemical or biological substance which is capable of causing illness, debilitation or death, to living organisms, tissues or cells." [Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed]
synonym: "poison" RELATED []
synonym: "toxic chemical" RELATED []
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2012-10-16T03:57:33Z

[Term]
id: XCO:0000240
name: toxin
def: "This is any condition in which the main influencing factor is a toxin, a noxious or poisonous substance produced by a biological organism such as a microbe, animal or plant." [https://www.merriam-webster.com/, ISBN:978-1416049982]
synonym: "biotoxin" EXACT []
is_a: XCO:0000239 ! toxic substance
created_by: JSmith
creation_date: 2012-10-16T04:07:55Z

[Term]
id: XCO:0000241
name: streptozotocin
def: "This is any condition in which the main influencing factor is streptozotocin, a naturally occurring chemical that is particularly toxic to the insulin-producing beta cells of the pancreas in mammals. STZ can be used to treat pancreatic islet cell cancers and to model type 1 diabetes mellitus in animals via destruction of the insulin-producing beta cells of the islets of Langerhans." [http://en.wikipedia.org/wiki/Streptozotocin "Wikipedia"]
synonym: "streptozocin" EXACT []
synonym: "STZ" EXACT []
xref: CHEBI:9288
is_a: XCO:0000240 ! toxin
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000482 ! antimicrobial agent
is_a: XCO:0000885 ! diabetes-inducing chemical
created_by: JSmith
creation_date: 2012-10-16T04:09:16Z

[Term]
id: XCO:0000242
name: alloxan
def: "A condition in which the main influencing factor is alloxan, an oxygenated pyrimidine derivative which is toxic to the pancreatic insulin-producing beta cells of the islets of Langerhans in rodents and other animals and can therefore be used for modeling type 1 diabetes mellitus through destruction of the beta cells." [http://en.wikipedia.org/wiki/Alloxan "Wikipedia"]
synonym: "2,4,5,6-pyrimidinetetrone" EXACT []
synonym: "5-Oxobarbituric acid" EXACT []
synonym: "alloxane" EXACT []
synonym: "mesoxalylurea" EXACT []
xref: pubchem.compound:5781
is_a: XCO:0000239 ! toxic substance
is_a: XCO:0000885 ! diabetes-inducing chemical
created_by: JSmith
creation_date: 2012-10-16T04:29:35Z

[Term]
id: XCO:0000243
name: partial pancreatectomy
def: "Surgical removal of a portion of the pancreas, resulting in reduction but not elimination of the physiological functions of the pancreas." [Gale:Gale_Encyclopedia_of_Medicine]
synonym: "subtotal pancreatectomy" RELATED []
is_a: XCO:0000105 ! pancreatectomy
created_by: JSmith
creation_date: 2012-10-16T04:49:10Z

[Term]
id: XCO:0000244
name: controlled fructose content diet
def: "A solid diet in which the amount of fructose, the monosaccharide found in honey and many sweet fruits which chemically combines with glucose to form the disaccharide sucrose, is maintained at a specified level." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000428 ! fructose
created_by: JSmith
creation_date: 2012-10-16T05:00:17Z

[Term]
id: XCO:0000245
name: insulin
def: "A protein hormone formed from proinsulin in the beta cells of the pancreatic islets of Langerhans. The major fuel-regulating hormone, it is secreted into the blood in response to a rise in concentration of blood glucose or amino acids. Insulin promotes the storage of glucose and the uptake of amino acids, increases protein and lipid synthesis, and inhibits lipolysis and gluconeogenesis." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000228 ! peptide hormone
created_by: JSmith
creation_date: 2012-10-16T05:04:48Z

[Term]
id: XCO:0000246
name: controlled cholesterol content diet
def: "A regimen of solid food in which the amount of cholesterol, a steroid alcohol found in animal fats and oils, is controlled." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
is_a: XCO:0000014 ! controlled content diet
created_by: JSmith
creation_date: 2012-11-30T15:42:17Z

[Term]
id: XCO:0000247
name: controlled olive oil content diet
def: "A regimen of solid food to which a specified amount of olive oil has been added." [RGD:JRS]
is_a: XCO:0000454 ! controlled oil content diet
created_by: JSmith
creation_date: 2012-11-30T15:44:29Z

[Term]
id: XCO:0000248
name: kidney transplant
def: "A surgical procedure in which one or both kidneys from a donor organism are implanted into a recipient organism." [Gale:Gale_Encyclopedia_of_Medicine]
synonym: "kidney transplantation" EXACT []
is_a: XCO:0000027 ! surgical implantation
created_by: JSmith
creation_date: 2012-11-30T15:46:26Z

[Term]
id: XCO:0000249
name: left kidney transplant
def: "A surgical procedure in which the left kidney from a donor organism is implanted into a recipient organism." [Gale:Gale_Encyclopedia_of_Medicine]
is_a: XCO:0000248 ! kidney transplant
created_by: JSmith
creation_date: 2012-11-30T15:51:17Z

[Term]
id: XCO:0000250
name: right kidney transplant
def: "A surgical procedure in which the right kidney from a donor organism is implanted into a recipient organism." [Gale:Gale_Encyclopedia_of_Medicine]
is_a: XCO:0000248 ! kidney transplant
created_by: JSmith
creation_date: 2012-11-30T15:53:04Z

[Term]
id: XCO:0000251
name: secretagogue
def: "Any agent that induces exocrine, endocrine, or paracrine secretion." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000214 ! activator
created_by: JSmith
creation_date: 2012-11-30T15:55:11Z

[Term]
id: XCO:0000252
name: tolbutamide
def: "A first generation potassium channel blocker and sulfonylurea oral hypoglycemic drug which stimulates the secretion of insulin by the pancreas." [http://en.wikipedia.org/wiki/Tolbutamide "Wikipedia"]
is_a: XCO:0000225 ! potassium channel inhibitor
is_a: XCO:0000251 ! secretagogue
is_a: XCO:0000407 ! hypoglycemic agent
created_by: JSmith
creation_date: 2012-11-30T15:56:41Z

[Term]
id: XCO:0000253
name: sodium ion
def: "This is any condition in which the main influencing factor is an ion of sodium, the chemical element with atomic number 11, that has lost one electron, forming a cation with a charge of +1." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
comment: Not used for sodium salt in animal feed. For that application XCO:0000022, "controlled sodium content diet" is used.
synonym: "Na+ ion" EXACT []
xref: CHEBI:29101
is_a: XCO:0000149 ! ion/salt
created_by: JSmith
creation_date: 2013-02-28T13:11:25Z

[Term]
id: XCO:0000254
name: sodium ion solution
def: "A condition in which the main influencing factor is a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron, forming a cation with a charge of +1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "Na+ ion solution" EXACT []
xref: CHEBI:29101
is_a: XCO:0000154 ! ion/salt solution
relationship: has_component XCO:0000253 ! sodium ion
created_by: JSmith
creation_date: 2013-02-28T18:54:08Z

[Term]
id: XCO:0000255
name: anti-glomerular basement membrane antibody
def: "An immunoglobulin molecule or a preparation of multiple antibody molecules having specific amino acid sequences with the ability to adhere to and interact specifically with one or more components of the structure located between endothelial cells of renal capillaries and the visceral epithelial cells of the kidney glomerulus." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed, Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
synonym: "anti-GBM antibody" RELATED []
synonym: "nephritogenic monoclonal antibody b35" RELATED []
is_a: XCO:0000194 ! antibody
created_by: JSmith
creation_date: 2013-03-01T11:49:57Z

[Term]
id: XCO:0000256
name: isoproterenol
def: "A drug which is structurally similar to epinephrine and that binds to beta-adrenergic receptors to produce a physiologic reaction similar to or the same as that of epinephrine." [http://en.wikipedia.org/wiki/Isoprenaline#Chemistry "Wikipedia"]
synonym: "isoprenaline" EXACT []
xref: CHEBI:64317
is_a: XCO:0000665 ! beta-adrenergic agonist
created_by: JSmith
creation_date: 2013-03-01T12:37:50Z

[Term]
id: XCO:0000257
name: controlled hydrogen ion content drinking water
def: "A drink made up of water containing a specified amount of hydrogen ions, the chemical element with atomic number 1 that have lost one electron forming a cation with a charge of +1, for consumption by an organism in an experiment. Adjusting the amount of hydrogen ions adjusts the acidity, i.e. the pH of the drinking water." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed]
synonym: "controlled acidity water" RELATED []
synonym: "controlled pH water" RELATED []
synonym: "water with adjusted pH" RELATED []
is_a: XCO:0000163 ! controlled content drinking water
created_by: JSmith
creation_date: 2013-03-01T16:10:48Z

[Term]
id: XCO:0000258
name: disease-inducing agent
def: "Any phenomenon, chemical or biologic substance, or organism that exerts some force or effect resulting in a deviation from or interruption of the normal structure or function of any body part, organ, or system that is manifested by a characteristic set of symptoms and signs." [Collins:Collins_Online_English_Dictionary, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "disease inducing agent" EXACT []
is_a: XCO:0000000 ! experimental condition
created_by: JSmith
creation_date: 2013-03-01T16:24:26Z

[Term]
id: XCO:0000259
name: disease-inducing chemical
def: "A substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules that exerts some force or effect resulting in a deviation from or interruption of the normal structure or function of any body part, organ, or system that is manifested by a characteristic set of symptoms and signs." [American_Heritage:The_American_Heritage_Science_Dictionary_2005, Collins:Collins_Online_English_Dictionary, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "disease inducing chemical" EXACT []
is_a: XCO:0000258 ! disease-inducing agent
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2013-03-01T16:30:57Z

[Term]
id: XCO:0000260
name: peptide/protein antigen
def: "A condition in which the major influencing factor is a peptide or protein, that is, any of a group of complex organic compounds containing carbon, hydrogen, oxygen, nitrogen, and sulfur consisting of alpha-amino acids joined by peptide linkages, capable of inducing a specific localized and/or systemic immune response." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
synonym: "antigenic protein" EXACT []
is_a: XCO:0000133 ! antigen
is_a: XCO:0000193 ! peptide/protein
created_by: JSmith
creation_date: 2013-03-01T16:46:02Z

[Term]
id: XCO:0000261
name: arthritis inducing chemical
def: "A substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules that, when administered, results in the inflammation of one or more joints, the sites of junction or union between bones, especially those that allow motion of the bones." [Collins:Collins_Online_English_Dictionary, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000259 ! disease-inducing chemical
is_a: XCO:0000349 ! arthritis-inducing agent
created_by: JSmith
creation_date: 2013-03-01T17:07:13Z

[Term]
id: XCO:0000262
name: collagen
def: "A condition in which the major influencing factor is any of a family of extracellular, closely related proteins occurring as a major component of connective tissue, giving it strength and flexibility; composed of molecules of tropocollagen." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000260 ! peptide/protein antigen
is_a: XCO:0000261 ! arthritis inducing chemical
created_by: JSmith
creation_date: 2013-03-01T17:35:20Z

[Term]
id: XCO:0000263
name: pristane
def: "This is any condition in which the main influencing factor is pristane, an acyclic saturated hydrocarbon derived from phytane by loss of its C-16 terminal methyl group. Pristane has a role as a biomarker and an immunological adjuvant. It is a norterpene and a long-chain alkane." []
synonym: "2,6,10,14-tetramethylpentadecane" EXACT []
xref: CHEBI:53181
xref: MESH:C009042
is_a: XCO:0000133 ! antigen
is_a: XCO:0000261 ! arthritis inducing chemical
created_by: JSmith
creation_date: 2013-03-01T17:39:39Z

[Term]
id: XCO:0000264
name: Freund's adjuvant
def: "A nonspecific stimulator of the immune response consisting of non-metabolizable oils used to make water-in-oil emulsions with specific antigens. The adjuvant increases the strength of the immune response." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, https://www.invivogen.com/ifa "InvivoGen", ISBN:978-1416049982]
is_a: XCO:0000133 ! antigen
created_by: JSmith
creation_date: 2013-03-01T18:05:06Z

[Term]
id: XCO:0000265
name: Freund's incomplete adjuvant
def: "IFA is used to make a water-in-oil antigen-containing emulsion that lacks the Mycobacteria found in Complete Freund&#8242;s Adjuvant so it minimizes the side-effects. It is routinely used for boosting immunizations subsequent to use of Freund's complete adjuvant." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, https://www.sigmaaldrich.com/catalog/product/sigma/f5506?lang=en&region=US "Sigma-Aldrich", ISBN:978-1416049982]
synonym: "FIA" RELATED []
synonym: "IFA" RELATED []
is_a: XCO:0000264 ! Freund's adjuvant
created_by: JSmith
creation_date: 2013-03-01T18:07:25Z

[Term]
id: XCO:0000266
name: Freund's complete adjuvant
def: "A water-in-oil emulsion incorporating antigen in the aqueous phase, and killed, dried mycobacteria, e.g., Mycobacterium butyricum in lightweight paraffin oil. A suspension is achieved with the aid of an emulsifying agent. The mixture induces both cell-mediated immunity (delayed hypersensitivity), and humoral antibody formation." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "CFA" RELATED []
synonym: "FCA" RELATED []
is_a: XCO:0000264 ! Freund's adjuvant
created_by: JSmith
creation_date: 2013-03-01T18:10:14Z

[Term]
id: XCO:0000267
name: peptidoglycan-polysaccharide
def: "A condition in which the major influencing factor is a polymer found in the cell walls of prokaryotes that consists of polysaccharide and peptide chains in a strong molecular network." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
synonym: "PG-PS" RELATED []
xref: CHEBI:8005
is_a: XCO:0000133 ! antigen
is_a: XCO:0000173 ! polysaccharide
is_a: XCO:0000261 ! arthritis inducing chemical
created_by: JSmith
creation_date: 2013-03-11T15:53:57Z

[Term]
id: XCO:0000268
name: balloon angioplasty
def: "A technique of mechanically widening narrowed or obstructed arteries by use of a soft catheter with an inflatable tip." [http://en.wikipedia.org/wiki/Balloon_angioplasty "Wikipedia"]
is_a: XCO:0000595 ! surgical manipulation of blood vessels
created_by: JSmith
creation_date: 2013-03-11T16:14:44Z

[Term]
id: XCO:0000269
name: calcium channel inhibitor
def: "This is any condition in which the main influencing factor is any chemical substance which decreases or interferes with the activity of a calcium channel, one or more membrane-bound globular proteins that display selective permeability to calcium ions, the chemical element with atomic number 20 that has lost two electrons forming a cation with a charge of +2, and allow diffusion of these ions across a cell membrane." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "calcium channel blocker" EXACT []
is_a: XCO:0000222 ! cation channel inhibitor
created_by: JSmith
creation_date: 2013-03-11T16:37:02Z

[Term]
id: XCO:0000270
name: captopril
def: "A sulfur-containing carboxylic acid with a pyrrolidine substituent at C-1, which decreases or interferes with the activity of angiotensin converting enzyme (ACE) inhibitor, used as an anti-hypertensive drug." [http://en.wikipedia.org/wiki/Captopril "Wikipedia"]
xref: CHEBI:3380
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: JSmith
creation_date: 2013-03-11T16:51:57Z

[Term]
id: XCO:0000271
name: antioxidant
def: "A substance that opposes oxidation, a reaction in which the atoms in an element lose electrons, and/or inhibits reactions brought about by dioxygen or peroxides." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, CHEBI:22586]
synonym: "antioxydant" EXACT []
synonym: "antoxidant" EXACT []
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2013-03-12T11:01:04Z

[Term]
id: XCO:0000272
name: tempol
def: "A heterocyclic compound used as an agent for detoxifying reactive oxygen species. It catalyses the disproportionation of superoxide." [http://en.wikipedia.org/wiki/4-Hydroxy-TEMPO "Wikipedia"]
synonym: "4-hydroxy-2,2,6,6-tetramethylpiperidin-1-oxyl" RELATED []
synonym: "4-Oxypiperidol" RELATED []
synonym: "HyTEMPO" RELATED []
synonym: "Nitroxyl-2" RELATED []
synonym: "Tanol" RELATED []
synonym: "TMPN" RELATED []
xref: pubchem.compound:137994
is_a: XCO:0000271 ! antioxidant
created_by: JSmith
creation_date: 2013-03-12T11:09:12Z

[Term]
id: XCO:0000273
name: carrageenan
def: "A family of linear, sulfated, high-molecular-weight polysaccharides made up of repeating galactose and 3,6-anhydrogalactose units with alternating alpha 1-3 and beta 1-4 glycosidic linkages." [http://en.wikipedia.org/wiki/Carrageenan "Wikipedia"]
xref: CHEBI:3435
is_a: XCO:0000173 ! polysaccharide
created_by: JSmith
creation_date: 2013-03-12T13:07:06Z

[Term]
id: XCO:0000274
name: monosaccharide
def: "Any simple carbohydrate consisting of a single basic sugar unit with the general formula Cn(H2O)n, with n ranging from 3 to 8." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000172 ! carbohydrate
created_by: JSmith
creation_date: 2013-03-12T13:10:01Z

[Term]
id: XCO:0000275
name: glucose
def: "A monosaccharide sugar, C6H12O6, occurring widely in plant and animal tissues. It is one of the three dietary monosaccharides, along with fructose and galactose, that are absorbed directly into the bloodstream during digestion, is the end product of carbohydrate metabolism, and is the chief source of energy for living organisms." [http://www.thefreedictionary.com/ "Multiple_Dictionaries"]
synonym: "dextrose" EXACT []
is_a: XCO:0000274 ! monosaccharide
created_by: JSmith
creation_date: 2013-03-12T13:28:39Z

[Term]
id: XCO:0000276
name: hydrocarbon
def: "Any of a large group of organic compounds whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2013-03-12T16:18:50Z

[Term]
id: XCO:0000277
name: cyclic hydrocarbon
def: "Any organic compound whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, and whose carbon atoms form a continuous or closed chain linked by bonds that may be represented graphically by one or more circular or triangular forms." [http://www.thefreedictionary.com/ "Multiple_Dictionaries"]
is_a: XCO:0000276 ! hydrocarbon
created_by: JSmith
creation_date: 2013-03-12T17:18:43Z

[Term]
id: XCO:0000278
name: polycyclic hydrocarbon
def: "Any organic compound whose molecules are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, and whose carbon atoms form continuous or closed chains linked by bonds that may be represented graphically by multiple interlinking circular or triangular forms." [http://www.thefreedictionary.com/ "Multiple_Dictionaries"]
is_a: XCO:0000277 ! cyclic hydrocarbon
created_by: JSmith
creation_date: 2013-03-12T17:20:06Z

[Term]
id: XCO:0000279
name: terpene
def: "Any of a large and diverse class of organic compounds which are composed only of hydrogen, the element with atomic number 1, and carbon, the element with atomic number 12, which are derived biosynthetically from units of isoprene and which have the general molecular formula (CH2=C(CH3)CH=CH2)n where n is the number of linked isoprene units." [http://en.wikipedia.org/wiki/Terpene "Wikipedia"]
is_a: XCO:0000276 ! hydrocarbon
created_by: JSmith
creation_date: 2013-03-12T17:24:22Z

[Term]
id: XCO:0000280
name: squalene
def: "A triterpene, that is a terpine containing six isoprene units, consisting of 2,6,10,15,19,23-hexamethyltetracosane having six double bonds at the 2-, 6-, 10-, 14-, 18- and 22-positions with (all-E)-configuration. Squalene is the biochemical precursor to steroids." [http://en.wikipedia.org/wiki/Squalene "Wikipedia"]
synonym: "Spinacene" RELATED []
synonym: "Supraene" RELATED []
xref: CHEBI:15440
xref: MESH:D013185
is_a: XCO:0000279 ! terpene
created_by: JSmith
creation_date: 2013-03-12T17:25:17Z

[Term]
id: XCO:0000281
name: type II collagen
def: "A condition in which the major influencing factor is the fibrillar collagen which comprises the main component of cartilage and is also found in the vitreous humor of the eye.  Collagens are a family of extracellular, closely related proteins occurring as a major component of connective tissue, giving it strength and flexibility." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Collagen "Wikipedia", ISBN:978-1416049982]
synonym: "type 2 collagen" EXACT []
is_a: XCO:0000262 ! collagen
created_by: JSmith
creation_date: 2013-03-12T17:41:57Z

[Term]
id: XCO:0000282
name: anti-Thy1 antibody
def: "An immunoglobulin molecule having a specific amino acid sequence that gives it the ability to adhere to and interact only with Thy1, i.e. Thymocyte antigen 1, and molecules containing structures similar to that antigen.  Thy1, also known as CD90, is a 25-37 kDa, heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored, conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen and now known to be the smallest member of the immunoglobulin superfamily of proteins." [http://en.wikipedia.org/wiki/CD90 "Wikipedia", Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
synonym: "anti-CD90 antibody" EXACT []
is_a: XCO:0000194 ! antibody
created_by: JSmith
creation_date: 2013-03-12T18:06:13Z

[Term]
id: XCO:0000283
name: visible light stimulus
def: "Exposure to visible light in a manner, such as for a length of time or at a level, which would not be considered natural, usual or environmental and which is designed to elicit or evoke an action or response in a cell, an excitable tissue, or an organism." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
synonym: "light therapy" EXACT []
synonym: "phototherapy" EXACT []
is_a: XCO:0000049 ! visual stimulus
is_a: XCO:0000284 ! controlled visible light exposure
created_by: JSmith
creation_date: 2013-03-13T12:03:39Z

[Term]
id: XCO:0000284
name: controlled visible light exposure
def: "Condition during which a subject or sample is directly in the presence of or influenced by visible light, that is, electromagnetic radiation with wavelengths between approximately 390 (violet) and 770 (red) nanometers, capable of stimulating the subjective sensation of sight, at a constrained level and/or for a constrained period of time." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
is_a: XCO:0000045 ! electromagnetic radiation exposure
is_a: XCO:0000181 ! controlled visible light condition
created_by: JSmith
creation_date: 2013-03-13T12:12:45Z

[Term]
id: XCO:0000285
name: controlled NG-nitroarginine methyl ester content drinking water
def: "A drink made up of water and a specified amount of the basic amino acid commonly known as L-NAME and used as a non-selective inhibitor of nitric oxide synthase, consumed by an organism as part of an experiment." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, MESH:D019331]
synonym: "controlled L-NAME content drinking water" EXACT []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000121 ! NG-nitroarginine methyl ester
created_by: JSmith
creation_date: 2013-03-13T14:48:31Z

[Term]
id: XCO:0000286
name: retinal S-antigen
def: "A condition in which the major influencing factor is a highly antigenic, soluble photoreceptor protein expressed in the retina and the pineal gland and involved in desensitization of the photoactivated transduction cascade." [NCBI_GeneID:6295]
synonym: "arrestin" BROAD []
synonym: "HSAg" RELATED []
synonym: "retinal soluble antigen" RELATED []
synonym: "SAG" RELATED []
synonym: "S-antigen" RELATED []
synonym: "S-antigen peptide" RELATED []
synonym: "S-arrestin" RELATED []
is_a: XCO:0000260 ! peptide/protein antigen
created_by: JSmith
creation_date: 2013-03-13T17:02:20Z

[Term]
id: XCO:0000287
name: interphotoreceptor retinoid-binding protein
def: "A condition in which the major influencing factor is a large glycoprotein, found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells, which is known to bind retinoids and thought to transport them between the retinal pigment epithelium and the photoreceptors." [NCBI_GeneID:5949]
synonym: "interphotoreceptor retinol-binding protein" EXACT []
synonym: "IRBP" RELATED []
synonym: "Rbp3" RELATED []
synonym: "retinol binding protein 3, interstitial" EXACT []
is_a: XCO:0000260 ! peptide/protein antigen
created_by: JSmith
creation_date: 2013-03-13T17:19:56Z

[Term]
id: XCO:0000288
name: R16 peptide of interphotoreceptor retinoid-binding protein
def: "A condition in which the major influencing factor is a 15 amino acid peptide (aa 1177-1191) derived from the interphotoreceptor retinoid-binding protein, a large glycoprotein, found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells, which is known to bind retinoids and thought to transport them between the retinal pigment epithelium and the photoreceptors." [NCBI_GeneID:5949]
synonym: "R16 peptide of IRBP" RELATED []
xref: PMID:10323205
relationship: part_of XCO:0000287 ! interphotoreceptor retinoid-binding protein
created_by: JSmith
creation_date: 2013-03-13T17:55:10Z

[Term]
id: XCO:0000289
name: R14 peptide of interphotoreceptor retinoid-binding protein
def: "A condition in which the major influencing factor is a 23 amino acid peptide (aa 1169-1191) derived from the interphotoreceptor retinoid-binding protein, a large glycoprotein, found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells, which is known to bind retinoids and thought to transport them between the retinal pigment epithelium and the photoreceptors." [NCBI_GeneID:5949]
synonym: "R14 peptide of IRBP" RELATED []
xref: PMID:18203685
relationship: part_of XCO:0000287 ! interphotoreceptor retinoid-binding protein
created_by: JSmith
creation_date: 2013-03-13T17:56:51Z

[Term]
id: XCO:0000290
name: peripheral myelin protein 2
def: "A condition in which the major influencing factor is a fatty acid and cholesterol binding protein which together with myelin basic protein constitutes a major fraction of the peripheral nervous system myelin proteins." [UniProtKB:P02689]
synonym: "myelin P2 protein" EXACT []
synonym: "Pmp2" RELATED []
xref: RGD:1585218
is_a: XCO:0000260 ! peptide/protein antigen
relationship: part_of XCO:0000292 ! peripheral nerve myelin
created_by: JSmith
creation_date: 2013-03-13T18:21:29Z

[Term]
id: XCO:0000291
name: peripheral myelin protein 2 peptide 58-81
def: "A condition in which the major influencing factor is the peptide (KNTEISFKLGQEFEETTADNRKTK) representing residues 58 to 81 of peripheral myelin protein 2, a fatty acid and cholesterol binding protein which together with myelin basic protein constitutes a major fraction of the peripheral nervous system myelin proteins." [RGD:2306736, UniProtKB:P02689]
synonym: "P2 58-81" RELATED []
synonym: "P2 peptide 58-81" RELATED []
relationship: part_of XCO:0000290 ! peripheral myelin protein 2
created_by: JSmith
creation_date: 2013-03-13T18:44:21Z

[Term]
id: XCO:0000292
name: peripheral nerve myelin
def: "A condition in which the major influencing factor is peripheral nerve myelin, a lipoproteinaceous substance largely composed of phospholipids and proteins, which forms the sheaths surrounding the axons of peripheral nerves, that is, nerves that are not part of either the brain or spinal cord of the organism." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "peripheral nervous system myelin" RELATED []
synonym: "PNM" RELATED []
synonym: "PNS myelin" RELATED []
is_a: XCO:0000352 ! myelin
created_by: JSmith
creation_date: 2013-03-13T19:18:05Z

[Term]
id: XCO:0000293
name: 99mTc-sestamibi
def: "A coordination complex of technetium-99m, a radioisotope of the chemical element technetium, atomic number 43, a gamma emitter having a half-life of approximately 6 hours, and methoxyisobutylisonitrile (MIBI), a lipophilic cation, used as an agent in nuclear medicine imaging." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Technetium_%2899mTc%29_sestamibi "Wikipedia", ISBN:978-1416049982]
synonym: "99mTc-hexakis-2-methoxy-2-methylpropyl isonitrile" RELATED []
synonym: "Cardiolite" RELATED []
synonym: "MIBI" RELATED []
xref: CHEBI:33371
is_a: XCO:0000171 ! radioactively labeled chemical
created_by: JSmith
creation_date: 2013-03-13T20:07:09Z

[Term]
id: XCO:0000294
name: estrogen/estrogen analog
def: "Any of the  naturally-occuring, primary female sex hormones or  related synthetic molecules with the capacity to perform the same function(s), i.e. to bind to  estrogen receptors and stimulate or control the development and maintenance of female sex characteristics." [http://en.wikipedia.org/wiki/Estrogen "Wikipedia"]
synonym: "Not4Curation" RELATED []
xref: CHEBI:50114
is_a: XCO:0000229 ! steroid hormone
created_by: JSmith
creation_date: 2013-05-07T15:32:52Z

[Term]
id: XCO:0000295
name: diethylstilbestrol
def: "A synthetic estrogen analog with chemical formula C18H20O2.  The structure is similar to that of estrogen but lacks the complete four ring structure. As a drug it is used to treat prostatic and sometimes breast carcinomas. It is an epigenetic carcinogen." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Diethylstilbestrol "Wikipedia", ISBN:978-1416049982]
synonym: "DES" RELATED []
xref: CHEBI:41922
is_a: XCO:0000294 ! estrogen/estrogen analog
is_a: XCO:0000435 ! antineoplastic agent
created_by: JSmith
creation_date: 2013-05-07T16:01:13Z

[Term]
id: XCO:0000296
name: running on inclined treadmill
def: "The act of rapidly moving the feet on an exercise apparatus with an endless belt that allows the user to perform the action of running in place and that is maintained at an angle which deviates from the horozontal by a specified amount." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, Encarta:Encarta_World_English_Dictionary]
synonym: "running on sloped treadmill" EXACT []
is_a: XCO:0000005 ! running on treadmill
created_by: JSmith
creation_date: 2013-06-07T16:08:44Z

[Term]
id: XCO:0000297
name: fluid deprivation
def: "Condition in which liquids for drinking (bringing a liquid into the mouth and swallowing it to quench thirst, for nourishment, etc.), such as water, are withheld for a specified period of time." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, http://www.yourdictionary.com/drink "YourDictionary"]
synonym: "water deprivation" NARROW []
is_a: XCO:0000013 ! diet
relationship: part_of XCO:0001275 ! unpredictable chronic mild stress
created_by: JSmith
creation_date: 2013-06-11T09:50:38Z

[Term]
id: XCO:0000298
name: controlled saccharin content drinking water
def: "Water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O) supplied as a drink, that is, as a liquid to be brought into the mouth and swallowed to quench thirst, for nourishment, etc., in which the amount of saccharin, a cyclic imine of 2-sulfobenzoic acid which is 500 times sweeter than sugar and used as a nonnutritive sweetener, is adjusted to a requirement." [http://www.thefreedictionary.com/ "Multiple_Dictionaries"]
is_a: XCO:0000163 ! controlled content drinking water
created_by: JSmith
creation_date: 2013-06-11T10:05:25Z

[Term]
id: XCO:0000299
name: controlled ethanol content drinking water with no other optional drink source
def: "Condition in which a drink, that is, a liquid to be brought into the mouth and swallowed to quench thirst, for nourishment, etc., made up of water and a specified amount of ethanol, the alcohol with chemical formula CH3-CH2-OH obtained from the fermentation of sugars and starches or by chemical synthesis which is the intoxicating ingredient of alcoholic beverages, is supplied as the only available drink option for consumption by an organism in an experiment." [http://www.thefreedictionary.com/ "Multiple_Dictionaries"]
is_a: XCO:0000023 ! controlled ethanol content drinking water
created_by: JSmith
creation_date: 2013-06-11T10:06:43Z

[Term]
id: XCO:0000300
name: controlled ethanol content drinking water with water as an optional drink source
def: "Condition in which a drink, that is, a liquid to be brought into the mouth and swallowed to quench thirst, for nourishment, etc., made up of water and a specified amount of ethanol, the alcohol with chemical formula CH3-CH2-OH obtained from the fermentation of sugars and starches or by chemical synthesis which is the intoxicating ingredient of alcoholic beverages, is supplied along with additive-free water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O), as an additional drink option for consumption by an organism in an experiment." [http://www.thefreedictionary.com/ "Multiple_Dictionaries"]
is_a: XCO:0000023 ! controlled ethanol content drinking water
created_by: JSmith
creation_date: 2013-06-11T10:07:22Z

[Term]
id: XCO:0000301
name: lithium ion solution
def: "A condition in which the main influencing factor is a homogeneous mixture of atoms of lithium, the chemical element with atomic number 3, that have lost one electron, forming a cation with a charge of +1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
xref: CHEBI:49713
is_a: XCO:0000154 ! ion/salt solution
relationship: has_component XCO:0000313 ! lithium ion
created_by: JSmith
creation_date: 2013-06-11T10:08:36Z

[Term]
id: XCO:0000302
name: lithium chloride solution
def: "A condition in which the main influencing factor is a homogeneous mixture of atoms of lithium, the chemical element with atomic number 3, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
xref: CHEBI:48607
is_a: XCO:0000301 ! lithium ion solution
created_by: JSmith
creation_date: 2013-06-11T10:09:05Z

[Term]
id: XCO:0000303
name: adrenalectomy
def: "The surgical excision of one or both of the adrenal glands, two small, dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
synonym: "suprarenalectomy" EXACT []
is_a: XCO:0000026 ! surgical removal
created_by: JSmith
creation_date: 2013-06-20T17:37:01Z

[Term]
id: XCO:0000304
name: bilateral adrenalectomy
def: "The surgical excision of both adrenal glands, two small, dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
synonym: "bilateral suprarenalectomy" EXACT []
is_a: XCO:0000303 ! adrenalectomy
created_by: JSmith
creation_date: 2013-06-20T17:49:29Z

[Term]
id: XCO:0000305
name: unilateral adrenalectomy
def: "The surgical excision of only one of the adrenal glands, two small, dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
synonym: "unilateral suprarenalectomy" EXACT []
is_a: XCO:0000303 ! adrenalectomy
created_by: JSmith
creation_date: 2013-06-20T17:50:15Z

[Term]
id: XCO:0000306
name: cold exposure
def: "An activity or condition which involves subjecting all or part of an organism to a relatively low, i.e., lower than considered normal, temperature." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed]
is_a: XCO:0000111 ! temperature exposure
created_by: JSmith
creation_date: 2013-06-21T16:31:04Z

[Term]
id: XCO:0000307
name: cold ambient air exposure
def: "An activity or condition in which the air surrounding or encircling the organism has a relatively low, or lower than considered normal, temperature, i.e., air in which the molecules possess a lower than normal amount of random kinetic energy." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed]
synonym: "cold exposure, ambient air" EXACT []
synonym: "cold stress" RELATED []
is_a: XCO:0000011 ! air temperature
is_a: XCO:0000306 ! cold exposure
created_by: JSmith
creation_date: 2013-06-21T16:52:48Z

[Term]
id: XCO:0000308
name: heat exposure
def: "An activity or condition which involves subjecting all or part of an organism to a relatively high, or higher than considered normal, temperature, that is, possessing a higher than normal level of random kinetic energy of atoms, molecules, or ions." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed]
is_a: XCO:0000111 ! temperature exposure
created_by: JSmith
creation_date: 2013-06-21T17:12:21Z

[Term]
id: XCO:0000309
name: heated ambient air exposure
def: "An activity or condition in which the air surrounding or encircling the organism or isolated organ has a relatively high, or higher than considered normal, temperature, i.e., air in which the molecules possess a higher than normal amount of random kinetic energy." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed]
synonym: "heat exposure, ambient air" EXACT []
synonym: "hot ambient air exposure" RELATED []
synonym: "warm ambient air exposure" RELATED []
is_a: XCO:0000011 ! air temperature
is_a: XCO:0000308 ! heat exposure
created_by: JSmith
creation_date: 2013-06-21T17:21:42Z

[Term]
id: XCO:0000310
name: guanethidine
def: "An antihypertensive agent that acts by selectively inhibiting transmission in post-ganglionic adrenergic nerves. It is believed to act mainly by preventing the release of norepinephrine at nerve endings and causes depletion of norepinephrine in peripheral sympathetic nerve terminals as well as in tissues. It does not appear to act at the level of the adrenergic receptors." [http://www.drugbank.ca/drugs/DB01170#pharmacology "Website"]
xref: CHEBI:5557
xref: MESH:D006145
is_a: XCO:0000120 ! inhibitor
created_by: JSmith
creation_date: 2013-06-21T18:45:16Z

[Term]
id: XCO:0000311
name: potassium ion solution
def: "A condition in which the main influencing factor is a homogeneous mixture of atoms of potassium, the chemical element with atomic number 19, that have lost one electron, forming a cation with a charge of +1 dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "K+ ion solution" EXACT []
xref: CHEBI:29103
is_a: XCO:0000154 ! ion/salt solution
relationship: has_component XCO:0000150 ! potassium ion
created_by: JSmith
creation_date: 2013-06-25T14:02:51Z

[Term]
id: XCO:0000312
name: potassium chloride solution
def: "A condition in which the main influencing factor is a homogeneous mixture of atoms of potassium, the chemical element with atomic number 19, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "KCl solution" EXACT []
xref: CHEBI:32588
is_a: XCO:0000311 ! potassium ion solution
created_by: JSmith
creation_date: 2013-06-25T14:06:24Z

[Term]
id: XCO:0000313
name: lithium ion
def: "A condition in which the main influencing factor is an atom of lithium, the chemical element with atomic number 3, that has lost one electron, forming a cation with a charge of +1." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "Li+ ion" EXACT []
xref: CHEBI:49713
is_a: XCO:0000149 ! ion/salt
created_by: JSmith
creation_date: 2013-06-25T14:24:21Z

[Term]
id: XCO:0000314
name: buffer
def: "Any substance or mixture of substances that, in solution (typically aqueous), resists change in pH upon addition of small amounts of acid or base." []
xref: CHEBI:35225
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2013-06-25T14:52:26Z

[Term]
id: XCO:0000315
name: buffer solution
def: "A homogeneous mixture of molecules, atoms and/or ions,  one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
xref: CHEBI:35225
is_a: XCO:0000314 ! buffer
is_a: XCO:0000340 ! solution
created_by: JSmith
creation_date: 2013-06-25T14:58:18Z

[Term]
id: XCO:0000316
name: calcium-free buffer solution
def: "A homogeneous mixture which does not contain calcium, the chemical element with atomic number 20, but does contain molecules, atoms and/or ions one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
xref: CHEBI:35225
is_a: XCO:0000315 ! buffer solution
created_by: JSmith
creation_date: 2013-06-25T15:06:57Z

[Term]
id: XCO:0000317
name: buffered calcium ion solution
def: "A homogeneous mixture of calcium, the chemical element with atomic number 20, with other molecules, atoms and/or ions one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "calcium-containing buffer solution" EXACT []
xref: CHEBI:29108
xref: CHEBI:35225
is_a: XCO:0000185 ! calcium ion solution
is_a: XCO:0000315 ! buffer solution
created_by: JSmith
creation_date: 2013-06-25T15:13:18Z

[Term]
id: XCO:0000318
name: surgical construction
def: "A process in which manual and instrumental techniques are used to assemble or combine parts or substances, especially in order to create something new." [Cambridge:Cambridge_Online_Dictionary_of_American_English, Collins:Collins_Online_English_Dictionary, http://en.wikipedia.org/wiki/Surgery "Wikipedia"]
synonym: "Not4Curation" RELATED []
is_a: XCO:0000165 ! surgical manipulation
created_by: JSmith
creation_date: 2013-06-25T16:06:11Z

[Term]
id: XCO:0000319
name: artificial aortocaval fistula
def: "A surgically created passageway between the abdominal aorta and inferior vena cava." [ISBN-13:978-0781733908]
synonym: "ACF" RELATED []
xref: PMID:2142618
is_a: XCO:0000595 ! surgical manipulation of blood vessels
created_by: JSmith
creation_date: 2013-06-25T16:08:47Z

[Term]
id: XCO:0000320
name: hexamethonium
def: "Either of two compounds (C12H30Br2N2 or C12H30Cl2N2) used in the treatment of hypertension. Hexamethonium is a depolarising ganglionic blocker, a nicotinic acetylcholine receptor antagonist that acts in autonomic ganglia by binding in or on the receptor but not the acetylcholine binding site itself." [http://en.wikipedia.org/wiki/Hexamethonium "Wikipedia", Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed]
synonym: "Benzohexamethonium" EXACT []
synonym: "hexamethone" EXACT []
synonym: "hexathonide" EXACT []
xref: CHEBI:5700
xref: CID:3604
xref: MESH:D018738
is_a: XCO:0000842 ! nicotinic antagonist
created_by: JSmith
creation_date: 2013-06-25T17:12:45Z

[Term]
id: XCO:0000321
name: hexamethonium bromide
def: "The compound C12H30Br2N2, consisting of a hexamethonium cation and dibromide anion, used in the treatment of hypertension. Hexamethonium is a depolarising ganglionic blocker, a nicotinic acetylcholine receptor antagonist that acts in autonomic ganglia by binding in or on the receptor but not the acetylcholine binding site itself." [http://en.wikipedia.org/wiki/Hexamethonium "Wikipedia", Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed]
synonym: "hexamethonium dibromide" RELATED []
xref: chembl.compound:CHEMBL105608
xref: pubchem.compound:5938
is_a: XCO:0000320 ! hexamethonium
created_by: JSmith
creation_date: 2013-06-25T17:17:10Z

[Term]
id: XCO:0000322
name: hexamethonium chloride
def: "The compound C12H30Cl2N2, consisting of a hexamethonium cation and dichloride anion, used in the treatment of hypertension. Hexamethonium is a depolarising ganglionic blocker, a nicotinic acetylcholine receptor antagonist that acts in autonomic ganglia by binding in or on the receptor but not the acetylcholine binding site itself." [http://en.wikipedia.org/wiki/Hexamethonium "Wikipedia", Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed]
synonym: "hexamethonium dichloride" RELATED []
xref: CHEMBL:105608
xref: CID:93550
is_a: XCO:0000320 ! hexamethonium
created_by: JSmith
creation_date: 2013-06-25T17:19:38Z

[Term]
id: XCO:0000323
name: alcohol
def: "Any condition in which the main influencing factor is an alcohol, a compound in which a hydroxy group, -OH, is attached to a saturated carbon atom." []
xref: CHEBI:30879
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2013-08-07T16:27:07Z

[Term]
id: XCO:0000324
name: primary alcohol
def: "Any condition in which the main influencing factor is a primary alcohol, a compound in which a hydroxy group, -OH, is attached to a saturated carbon atom which has either three hydrogen atoms attached to it or only one other carbon atom and two hydrogen atoms attached to it." []
xref: CHEBI:15734
is_a: XCO:0000323 ! alcohol
created_by: JSmith
creation_date: 2013-08-07T16:35:17Z

[Term]
id: XCO:0000325
name: ethanol
def: "Any condition in which the main influencing factor is ethanol, a primary alcohol with chemical formula CH3-CH2-OH, that is ethane in which one of the hydrogens is substituted by a hydroxy group." []
synonym: "ethyl alcohol" EXACT []
synonym: "EtOH" RELATED []
xref: CHEBI:16236
is_a: XCO:0000324 ! primary alcohol
created_by: JSmith
creation_date: 2013-08-07T16:39:26Z

[Term]
id: XCO:0000326
name: controlled ethanol content saline
def: "Any condition in which the main influencing factor is ethanol, the colorless, volatile, flammable liquid, CH3CH2OH, produced by yeast fermentation of carbohydrates or synthesized by hydration of ethylene, suspended in a saline solution, a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient quantity of water." [Webster:Random_House_Kernerman_Websters_College_Dictionary_2010]
synonym: "ethanol in 0.9 % saline" NARROW []
synonym: "ethanol in 0.9 % saline solution" NARROW []
synonym: "ethanol in saline" EXACT []
is_a: XCO:0000156 ! 0.9% sodium chloride solution
relationship: has_component XCO:0000325 ! ethanol
created_by: JSmith
creation_date: 2013-08-07T16:45:26Z

[Term]
id: XCO:0000327
name: controlled quinine content drinking water
def: "A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of quinine, and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Quinine is a bitter alkaloid of cinchona that has antimalarial, analgesic, antipyretic, mild oxytocic, cardiac depressant, and sclerosing properties, and that decreases the excitability of the motor end plate." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://www.yourdictionary.com/drink "YourDictionary", ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000163 ! controlled content drinking water
created_by: JSmith
creation_date: 2013-08-07T17:05:17Z

[Term]
id: XCO:0000328
name: controlled deoxycorticosterone content drinking water
def: "A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of deoxycorticosterone, and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Deoxycorticosterone is a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/11-Deoxycorticosterone "Wikipedia", http://www.yourdictionary.com/drink "YourDictionary", ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled DOC content drinking water" RELATED []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000330 ! deoxycorticosterone
created_by: jsmith
creation_date: 2013-08-22T12:58:04Z

[Term]
id: XCO:0000329
name: controlled deoxycorticosterone content saline drink
def: "A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of saline and a specified amount of deoxycorticosterone, and consumed by an organism as part of an experiment. Saline is a homogeneous mixture of sodium chloride (i.e. atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1) dispersed molecularly in a sufficient and specified quantity of dissolving medium (solvent) such as water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). Deoxycorticosterone is a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/11-Deoxycorticosterone "Wikipedia", http://www.yourdictionary.com/drink "YourDictionary", ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled deoxycorticosterone and sodium content drinking water" RELATED []
synonym: "controlled DOC and sodium chloride content drinking water" RELATED []
synonym: "controlled DOC content saline drink" RELATED []
xref: CHEBI:16973
is_a: XCO:0000164 ! controlled sodium content drinking water
is_a: XCO:0000328 ! controlled deoxycorticosterone content drinking water
created_by: jsmith
creation_date: 2013-08-22T13:00:11Z

[Term]
id: XCO:0000330
name: deoxycorticosterone
def: "Any condition in which the main influencing factor is deoxycorticosterone, a steroid hormone produced by the adrenal gland that possesses mineralocorticoid activity and acts as a precursor to aldosterone, or a derivative of that hormone." [http://en.wikipedia.org/wiki/11-Deoxycorticosterone "Wikipedia"]
synonym: "DOC" RELATED []
is_a: XCO:0000229 ! steroid hormone
created_by: jsmith
creation_date: 2013-08-22T14:38:17Z

[Term]
id: XCO:0000331
name: RU28362
def: "Any condition in which the main influencing factor is RU28362, a highly selective neuroactive agonist of the glucocorticoid (Corticoid Type II) receptor, but not of the mineralocorticoid (Corticoid Type I) receptor." [http://en.wikipedia.org/wiki/RU28362 "Wikipedia", http://www.nursa.org/molecule.cfm?molType=ligand&molId=1123 "Website"]
synonym: "11,17-dihydroxy-6-methyl-17-(1-propynyl)androsta-1,4,6-triene-3-one" EXACT []
xref: pubchem.compound:123790
is_a: XCO:0000135 ! receptor agonist
created_by: jsmith
creation_date: 2013-08-22T14:49:55Z

[Term]
id: XCO:0000332
name: controlled RU28362 content drinking water
def: "A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of RU28362, and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). RU28362 is a highly selective neuroactive agonist of the glucocorticoid (Corticoid Type II) receptor, but not of the mineralocorticoid (Corticoid Type I) receptor." [http://en.wikipedia.org/wiki/RU28362 "Wikipedia", http://www.nursa.org/molecule.cfm?molType=ligand&molId=1123 "Website", http://www.thefreedictionary.com/ "Multiple_Dictionaries", ISBN:978-1416049982]
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000331 ! RU28362
created_by: jsmith
creation_date: 2013-08-22T15:03:35Z

[Term]
id: XCO:0000333
name: controlled RU28362 content saline drink
def: "A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of saline and a specified amount of RU28362, and consumed by an organism as part of an experiment. Saline is a homogeneous mixture of atoms of sodium, the chemical element with atomic number 11, that have lost one electron forming a cation with a charge of +1, and an equivalent number of atoms of chlorine, the chemical element with atomic number 17, that have gained one electron forming an anion with a charge of -1 dispersed molecularly in a sufficient and specified quantity of dissolving medium (solvent) such as water, the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). RU28362 is a highly selective neuroactive agonist of the glucocorticoid (Corticoid Type II) receptor, but not of the mineralocorticoid (Corticoid Type I) receptor." [http://en.wikipedia.org/wiki/RU28362 "Wikipedia", http://www.nursa.org/molecule.cfm?molType=ligand&molId=1123 "Website", http://www.thefreedictionary.com/ "Multiple_Dictionaries", ISBN:978-1416049982]
synonym: "controlled RU28362 and sodium chloride content drinking water" RELATED []
is_a: XCO:0000164 ! controlled sodium content drinking water
is_a: XCO:0000332 ! controlled RU28362 content drinking water
created_by: jsmith
creation_date: 2013-08-22T15:06:01Z

[Term]
id: XCO:0000334
name: left adrenalectomy
def: "The surgical excision of only the adrenal gland on the left side of the body. The left adrenal gland is generally the larger of the two dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, http://en.wikipedia.org/wiki/Adrenal_gland "Wikipedia"]
comment: Note that "left" in this context refers to the perspective of the organism, not that of the observer. (Wikipedia:  Anatomical_terms_of_location).
synonym: "left suprarenalectomy" EXACT []
synonym: "left unilateral adrenalectomy" EXACT []
synonym: "left unilateral suprarenalectomy" EXACT []
is_a: XCO:0000305 ! unilateral adrenalectomy
created_by: jsmith
creation_date: 2013-08-22T15:48:28Z

[Term]
id: XCO:0000335
name: right adrenalectomy
def: "The surgical excision of only the adrenal gland on the right side of the body. The right adrenal gland is generally the smaller of the two dissimilarly shaped endocrine glands, one located above each kidney, consisting of the cortex, which secretes several steroid hormones, and the medulla, which secretes epinephrine." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, http://en.wikipedia.org/wiki/Adrenal_gland "Wikipedia"]
comment: Note that "right" in this context refers to the perspective of the organism, not that of the observer. (Wikipedia:  Anatomical_terms_of_location).
synonym: "right suprarenalectomy" EXACT []
synonym: "right unilateral adrenalectomy" EXACT []
synonym: "right unilateral suprarenalectomy" EXACT []
is_a: XCO:0000305 ! unilateral adrenalectomy
created_by: jsmith
creation_date: 2013-08-22T15:50:50Z

[Term]
id: XCO:0000336
name: adrenergic antagonist
def: "Any condition in which the main influencing factor is an agent that binds to but does not activate adrenergic receptors thereby blocking the actions of endogenous or exogenous adrenergic agonists, substances that have an affinity for and stimulate physiologic activity at adrenergic receptors. Adrenergic receptors are a class of G protein-coupled receptors that are targets of catecholamines, especially norepinephrine and epinephrine." [CHEBI:37887, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Adrenergic_receptors "Wikipedia", ISBN:978-1416049982]
synonym: "adrenergic receptor antagonist" EXACT []
is_a: XCO:0000160 ! receptor antagonist
created_by: jsmith
creation_date: 2013-08-22T16:22:29Z

[Term]
id: XCO:0000337
name: air-jet exposure
def: "A condition in which an air jet, i.e. a rapid stream of air (the colorless, odorless, tasteless mixture of gases, mainly nitrogen, oxygen and lesser gases, plus water vapor and particulates, that surrounds the earth) forced under pressure through a small opening or nozzle, is directed toward the body or a part of the body of an organism." [American_Heritage:The_American_Heritage_Science_Dictionary_2005]
synonym: "air-jet stress" RELATED []
synonym: "forced air exposure" RELATED []
is_a: XCO:0000052 ! tactile stimulus
created_by: jsmith
creation_date: 2013-08-22T17:01:21Z

[Term]
id: XCO:0000338
name: chemical nanoparticle
def: "This is any condition in which the main influencing factor is a particle with a size between 1 and 100 nanometers composed of any substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, American_Heritage:The_American_Heritage_Science_Dictionary_2005, Collins:Collins_Online_English_Dictionary, http://en.wikipedia.org/wiki/Nanoparticle "Wikipedia"]
synonym: "ultrafine chemical particle" EXACT []
is_a: XCO:0000342 ! chemical with specified structure
created_by: jsmith
creation_date: 2013-08-23T12:19:49Z

[Term]
id: XCO:0000339
name: titanium dioxide nanoparticle
def: "This is any condition in which the main influencing factor is a nanoparticle with a size between 1 and 100 nanometers composed of titanium dioxide. Titanium dioxide is a white insoluble powder that is the naturally occurring oxide of titanium, chemical formula TiO2, i.e. composed of one atom of titanium, the strong, low-density, highly corrosion-resistant metallic element with atomic number 22, and two atoms of oxygen, the highly reactive chemical element with atomic number 8 that is essential for plant and animal respiration and is required for nearly all combustion." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, http://en.wikipedia.org/wiki/Nanoparticle "Wikipedia", http://en.wikipedia.org/wiki/Titanium_dioxide "Wikipedia"]
synonym: "titania nanoparticle" NARROW []
synonym: "titanium(IV) oxide nanoparticle" EXACT []
synonym: "ultrafine TiO2 powder" EXACT []
synonym: "ultrafine titanium dioxide powder" EXACT []
xref: CHEBI:51050
is_a: XCO:0000338 ! chemical nanoparticle
created_by: jsmith
creation_date: 2013-08-23T15:14:06Z

[Term]
id: XCO:0000340
name: solution
def: "Any condition in which the main influencing factor is a homogeneous mixture of molecules, atoms and/or ions dispersed molecularly in a sufficient quantity of dissolving medium (solvent) such as water." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000000 ! experimental condition
created_by: jsmith
creation_date: 2013-08-23T15:45:06Z

[Term]
id: XCO:0000341
name: chemical with specified function
def: "This is any condition in which the main influencing factor is a substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules and which has the capacity to perform a particular role or initiate or participate in a particular activity or process." [American_Heritage:The_American_Heritage_Science_Dictionary_2005, Collins:Collins_Online_English_Dictionary, Mosby:Mosbys_Dental_Dictionary--2nd_Ed]
synonym: "chemical with specified role" EXACT []
xref: CHEBI:50906
is_a: XCO:0000088 ! chemical
created_by: JSmith
creation_date: 2013-09-03T16:26:49Z

[Term]
id: XCO:0000342
name: chemical with specified structure
def: "This is any condition in which the main influencing factor is a substance having a specific molecular composition obtained by or used in a reaction involving changes to atoms or molecules, where that molecular composition explicitly contains one or more particular parts or groups that are held or put together in a particular way." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, American_Heritage:The_American_Heritage_Science_Dictionary_2005, Collins:Collins_Online_English_Dictionary]
synonym: "Not4Curation" RELATED []
xref: CHEBI:24431
is_a: XCO:0000088 ! chemical
created_by: JSmith
creation_date: 2013-09-03T16:30:12Z

[Term]
id: XCO:0000343
name: nitrosourea
def: "Any condition in which the main influencing factor is a chemical having a nitroso (R-N=O) and a urea moiety.  A urea moiety consists of  two -NH2 groups joined by a carbonyl (C=O) group." [http://en.wikipedia.org/wiki/Nitrosourea "Wikipedia"]
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2013-09-04T13:12:02Z

[Term]
id: XCO:0000344
name: N-propyl-N-nitrosourea
def: "Any condition in which the main influencing factor is a chemical with three major moieties, a propyl group (a linear three-carbon alkyl substituent with chemical formula -C3H7), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group)." [http://en.wikipedia.org/wiki/Nitrosourea "Wikipedia", http://en.wikipedia.org/wiki/Propyl "Wikipedia", pubchem.compound:13157]
synonym: "1-nitroso-1-propylurea" EXACT []
synonym: "1-propyl-1-nitrosourea" RELATED []
synonym: "PNU" RELATED []
synonym: "propylnitrosourea" EXACT []
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000205 ! mutation inducing chemical
is_a: XCO:0000343 ! nitrosourea
created_by: JSmith
creation_date: 2013-09-04T13:25:28Z

[Term]
id: XCO:0000345
name: N-ethyl-N-nitrosourea
def: "Any condition in which the main influencing factor is a chemical with three major moieties, an ethyl group (a two-carbon alkyl substituent with chemical formula -C2H5), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group)." [http://en.wikipedia.org/wiki/Ethyl_group "Wikipedia", http://en.wikipedia.org/wiki/Nitrosourea "Wikipedia"]
synonym: "1-ethyl-1-nitrosourea" RELATED []
synonym: "ENU" RELATED []
synonym: "ethylnitrosourea" EXACT []
synonym: "N-ethyl-N-nitroso carbamide" EXACT []
xref: CHEBI:23995
xref: pubchem.compound:12967
is_a: XCO:0000205 ! mutation inducing chemical
is_a: XCO:0000343 ! nitrosourea
created_by: JSmith
creation_date: 2013-09-04T13:34:43Z

[Term]
id: XCO:0000346
name: N-methyl-N-nitrosourea
def: "Any condition in which the main influencing factor is a chemical with three major moieties, a methyl group (a one-carbon alkyl substituent with chemical formula -CH3), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group)." [http://en.wikipedia.org/wiki/Methyl_group "Wikipedia", http://en.wikipedia.org/wiki/N-Methyl-N-nitrosourea "Wikipedia", http://en.wikipedia.org/wiki/Nitrosourea "Wikipedia"]
synonym: "1-methyl-1-nitrosourea" RELATED []
synonym: "methylnitrosourea" EXACT []
synonym: "MNU" RELATED []
synonym: "N-methyl-N-nitrosocarbamide" EXACT []
xref: CHEBI:50102
xref: pubchem.compound:12967
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000205 ! mutation inducing chemical
is_a: XCO:0000343 ! nitrosourea
created_by: JSmith
creation_date: 2013-09-20T16:27:41Z

[Term]
id: XCO:0000347
name: blood vessel occlusion
def: "This is any condition in which the main influencing factor is surgical manipulation causing blockage of a blood vessel, any one of the network of muscular tubes that carry blood through the body." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000596 ! blood vessel constriction
created_by: JSmith
creation_date: 2013-11-11T10:32:17Z

[Term]
id: XCO:0000348
name: middle cerebral artery occlusion
def: "A surgical manipulation causing blockage of the middle cerebral artery (MCA), one of the three major paired arteries that supply blood to the cerebrum. The MCA arises from the internal carotid and continues into the lateral sulcus where it branches and projects into the lateral cerebral cortex." [http://en.wikipedia.org/wiki/Middle_Cerebral_Artery "Wikipedia", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "MCA occlusion" RELATED []
is_a: XCO:0000347 ! blood vessel occlusion
created_by: JSmith
creation_date: 2013-11-11T10:46:10Z

[Term]
id: XCO:0000349
name: arthritis-inducing agent
def: "Any phenomenon, chemical or biologic substance, or organism that, when administered, results in the inflammation of one or more joints, the sites of junction or union between bones, especially those that allow motion of the bones." [Collins:Collins_Online_English_Dictionary, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000258 ! disease-inducing agent
created_by: JSmith
creation_date: 2013-11-11T12:01:59Z

[Term]
id: XCO:0000350
name: streptococcal cell wall
def: "A biologic agent consisting of a more or less purified preparation of cell walls from streptococcus bacteria. Streptococcus is a genus of spherical Gram-positive bacteria belonging to the phylum Firmicutes and the lactic acid bacteria group. The cell wall is the rigid structure that lies just outside of and is joined to the plasma membrane of plant cells and most prokaryotic cells, which protects the cell and maintains its shape." [Collins:Collins_Online_English_Dictionary, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Streptococcus "Wikipedia", ISBN:978-1416049982]
synonym: "SCW" RELATED []
is_a: XCO:0000349 ! arthritis-inducing agent
created_by: JSmith
creation_date: 2013-11-11T12:03:50Z

[Term]
id: XCO:0000351
name: 4-nitroquinoline N-oxide
alt_id: XCO:0000366
def: "A condition in which the major influencing factor is 4-nitroquinoline N-oxide, a tumorigenic derivative of quinoline N-oxide containing a nitro functional group (-NO2) at the 4 position of the quinoline bicyclic structure. Quinoline is a heterocyclic aromatic organic compound with the chemical formula C9H7N. 4-nitroquinoline 1-oxide and its metabolite 4-hydroxyaminoquinoline-1-oxide bind to nucleic acids and cause lesions usually corrected by nucleotide excision repair." [http://en.wikipedia.org/wiki/4-Nitroquinoline_1-oxide "Wikipedia", http://en.wikipedia.org/wiki/Quinoline "Wikipedia"]
synonym: "4-Nitroquinoline 1-oxide" EXACT []
synonym: "4NQO" RELATED []
xref: CHEBI:16907
xref: MESH:D015112
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000205 ! mutation inducing chemical
created_by: JSmith
creation_date: 2013-11-11T13:00:15Z

[Term]
id: XCO:0000352
name: myelin
def: "A condition in which the major influencing factor is myelin, a lipoproteinaceous substance largely composed of phospholipids and proteins, which forms the sheaths surrounding the myelinated nerve fibers." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000133 ! antigen
created_by: JSmith
creation_date: 2013-11-11T13:10:37Z

[Term]
id: XCO:0000353
name: central nervous system myelin
def: "A condition in which the major influencing factor is the lipoproteinaceous substance largely composed of phospholipids and proteins, which forms the sheaths surrounding the myelinated nerve fibers of the central nervous system, i.e., the brain and spinal cord." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "CNS myelin" RELATED []
is_a: XCO:0000352 ! myelin
created_by: JSmith
creation_date: 2013-11-11T13:26:36Z

[Term]
id: XCO:0000354
name: N-methyl-N'-nitro-N-nitrosoguanidine
def: "A guanidine derivative with a nitro group (-NO2) on the nitrogen at position 3 and a methyl group (-CH3) and nitroso group (-NO) on the nitrogen at position 1. MNNG acts by adding alkyl groups to the O6 of guanine and O4 of thymine of DNA, giving it potent mutagenic and carcinogenic properties." [http://en.wikipedia.org/wiki/Methylnitronitrosoguanidine "Wikipedia", MESH:D008769]
synonym: "1-methyl-3-nitro-1-nitrosoguanidine" EXACT []
synonym: "methylnitronitrosoguanidine" EXACT []
synonym: "MNNG" RELATED []
xref: CHEBI:21759
xref: pubchem.compound:9562060
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000205 ! mutation inducing chemical
created_by: JSmith
creation_date: 2013-11-11T14:50:46Z

[Term]
id: XCO:0000355
name: controlled N-methyl-N'-nitro-N-nitrosoguanidine content drinking water
def: "A drink, that is, a liquid that is brought into the mouth and swallowed to quench thirst and/or for nourishment, made up of water and a specified amount of N-methyl-N'-nitro-N-nitrosoguanidine (MNNG), and consumed by an organism as part of an experiment. Water is the clear, colorless, odorless, tasteless liquid each molecule of which contains one atom of oxygen and two atoms of hydrogen (H2O). MNNG is a guanidine derivative with a nitro group (-NO2) on the nitrogen at position 3 and a methyl group (-CH3) and nitroso group (-NO) on the nitrogen at position 1. MNNG acts by adding alkyl groups to the O6 of guanine and O4 of thymine of DNA, giving it potent mutagenic and carcinogenic properties." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Methylnitronitrosoguanidine "Wikipedia", http://www.yourdictionary.com/drink "YourDictionary", ISBN:978-1416049982, MESH:D008769]
synonym: "controlled 1-methyl-3-nitro-1-nitrosoguanidine content drinking water" EXACT []
synonym: "controlled methylnitronitrosoguanidine content drinking water" EXACT []
synonym: "controlled MNNG content drinking water" RELATED []
xref: CHEBI:21759
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000354 ! N-methyl-N'-nitro-N-nitrosoguanidine
created_by: JSmith
creation_date: 2013-11-11T15:17:46Z

[Term]
id: XCO:0000356
name: spinal cord homogenate
def: "A condition in which the major contributing factor is a preparation of spinal cord which has been rendered uniform in structure and/or composition throughout, for example by grinding the tissue until it has been reduced to particles which are evenly distributed thoughout a fluid.  Spinal cord is the long, flexible, nearly cylindric structure of nerve tissue that extends from the medulla oblongata down through the vertebral canal and from which the spinal nerves branch off to various parts of the body." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000133 ! antigen
created_by: JSmith
creation_date: 2013-11-11T15:35:41Z

[Term]
id: XCO:0000357
name: walking on inclined treadmill
def: "The action of ambulation on an exercise apparatus with an endless belt that allows the user to perform the action of running in place and that is maintained at an angle which deviates from the horozontal by a specified amount." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, Encarta:Encarta_World_English_Dictionary]
synonym: "walking on sloped treadmill" EXACT []
is_a: XCO:0000004 ! walking on treadmill
created_by: JSmith
creation_date: 2013-11-11T15:50:46Z

[Term]
id: XCO:0000358
name: diagnostic agent
def: "A substance administered specifically to aid diagnosis of a disease or condition." [CHEBI:33295, Webster:Random_House_Kernerman_Websters_College_Dictionary_2010]
synonym: "diagnostic aid" RELATED []
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2013-11-11T16:04:05Z

[Term]
id: XCO:0000359
name: sodium p-aminohippurate
def: "A condition in which the main influencing factor is an organic sodium salt that is the monosodium salt of p-aminohippuric acid, an amide derivative of the amino acid glycine and para-aminobenzoic acid. Sodium p-aminohippurate is used as a diagnostic agent in the measurement of renal plasma flow." [CHEBI:104011, CHEBI:31204, http://en.wikipedia.org/wiki/Aminohippuric_acid "Wikipedia"]
synonym: "PAH" RELATED []
synonym: "sodium para-aminohippurate" EXACT []
is_a: XCO:0000358 ! diagnostic agent
created_by: JSmith
creation_date: 2013-11-11T16:10:30Z

[Term]
id: XCO:0000360
name: arterial catheter implantation
def: "The insertion of a tubular, flexible surgical instrument into an artery to withdraw or introduce fluid. An artery is a vessel in which blood flows away from the heart." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000027 ! surgical implantation
is_a: XCO:0000595 ! surgical manipulation of blood vessels
created_by: JSmith
creation_date: 2013-12-20T12:41:32Z

[Term]
id: XCO:0000361
name: left L3-L5 ventral root avulsion
def: "The forcible surgical separation from the spine of the motor root of a left side spinal nerve between the #3 and #5 lumbar vertebrae." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Gale:Gale_Encyclopedia_of_Medicine_2008]
is_a: XCO:0000401 ! nerve root avulsion
created_by: JSmith
creation_date: 2013-12-20T13:05:25Z

[Term]
id: XCO:0000362
name: physical restraint in plastic bag
def: "The use of a pouch made from a very thin flexible plastic (any of various organic compounds produced by polymerization, capable of being molded, extruded, cast into various shapes and films) to limit some or all of an animal's normal movements." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, Collins:Collins_Online_English_Dictionary, http://grants.nih.gov/grants/olaw/Guide-for-the-care-and-use-of-Laboratory-animals.pdf "NIH"]
is_a: XCO:0000158 ! physical restraint in mechanical restrainer
created_by: JSmith
creation_date: 2013-12-20T13:13:08Z

[Term]
id: XCO:0000363
name: eukaryotic pathogen
def: "A condition in which the main influencing factor is a single-celled or multicellular organism that has the capacity to cause disease, and the cell(s) of which individually have a true nucleus, that is, one  that is bounded by a nuclear membrane, contains one or more chromosomes, and divides by mitosis." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
is_a: XCO:0000236 ! pathogen
created_by: JSmith
creation_date: 2013-12-20T13:28:29Z

[Term]
id: XCO:0000364
name: Toxoplasma gondii
def: "A condition  in which the main influencing factor is a sporozoan species that is an intracellular parasite in a variety of vertebrates and is the causative agent of toxoplasmosis." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
is_a: XCO:0000363 ! eukaryotic pathogen
created_by: JSmith
creation_date: 2013-12-20T13:29:36Z

[Term]
id: XCO:0000365
name: Toxoplasma gondii cysts
def: "A condition in which the main influencing factor is Toxoplasma gondii cysts. Toxoplasma gondii is a sporozoan species that is an intracellular parasite in a variety of vertebrates and is the causative agent of toxoplasmosis. Cyst refers to the larval stage in the life cycle during which individual organisms are enveloped in a protective wall." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000364 ! Toxoplasma gondii
created_by: JSmith
creation_date: 2013-12-20T13:30:01Z

[Term]
id: XCO:0000367
name: surgical device implantation sham procedure
def: "This is any condition in which the main influencing factor is surgical control device implantation in which the control device does not dispense the chemical, drug, or electrical stimulation dispensed by the experimental device." [PMID:15687265]
synonym: "control surgical device implantation" EXACT []
synonym: "sham surgical device implantation" EXACT []
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0000027 ! surgical implantation
created_by: JSmith
creation_date: 2013-12-20T14:06:20Z

[Term]
id: XCO:0000368
name: autoimmune disease-inducing chemical
def: "Any condition in which the main influencing factor is a chemical that causes an anti-self reaction by the immune system of the treated individual." [RGD:JRS]
is_a: XCO:0000259 ! disease-inducing chemical
created_by: JSmith
creation_date: 2013-12-20T14:29:13Z

[Term]
id: XCO:0000369
name: aurothiopropanol sulfonate
def: "An antirheumatic of slow action that, in certain susceptible individuals, causes a gold-induced, Th2-dependent autoimmunity." [PMID:15128826]
synonym: "allochrysine" RELATED []
synonym: "Atps" RELATED []
synonym: "aurotioprol" RELATED []
is_a: XCO:0000368 ! autoimmune disease-inducing chemical
created_by: JSmith
creation_date: 2013-12-20T14:29:49Z

[Term]
id: XCO:0000370
name: Trichinella spiralis
def: "A condition in which the main influencing factor is any form of  Trichinella spiralis, a nematode parasite that occurs in animals such as rodents, pigs, bears, and in humans. The organism, which matures in the intestines, producing larvae that travel through the blood and lymphatic systems to the muscles where they encyst, is responsible for the disease trichinosis." [http://en.wikipedia.org/wiki/Trichinella_spiralis "Wikipedia"]
is_a: XCO:0000363 ! eukaryotic pathogen
created_by: JSmith
creation_date: 2014-01-09T13:19:52Z

[Term]
id: XCO:0000371
name: Trichinella spiralis larvae
def: "A condition in which the main influencing factor is the infective larvae of the nematode parasite Trichinella spiralis." [http://en.wikipedia.org/wiki/Trichinella_spiralis "Wikipedia"]
is_a: XCO:0000370 ! Trichinella spiralis
created_by: JSmith
creation_date: 2014-01-09T13:27:57Z

[Term]
id: XCO:0000372
name: dexamethasone
def: "A condition in which the main influencing factor is dexamethasone, a long-acting synthetic adrenocorticoid, analogous to but more potent than cortisol (a natural hormone produced by the adrenal glands), with anti-inflammatory and immunosuppressant activities." [http://en.wikipedia.org/wiki/Dexamethasone "Wikipedia", http://www.nlm.nih.gov/medlineplus/druginfo/meds/a682792.html "Website", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000091 ! steroid
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000636 ! immunosuppressive agent
created_by: JSmith
creation_date: 2014-01-09T13:51:38Z

[Term]
id: XCO:0000373
name: surgical denervation
def: "This is any condition in which the main influencing factor is surgical denervation, which my involve transection, resection, or complete surgical removal of a nerve, any of the cordlike structures that convey impulses between the central nervous system and one or more parts of the body, and that each consist of an outer connective tissue sheath surrounding a bundle of conductive fibers." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Dental_Dictionary--2nd_Ed]
xref: MESH:D003714
is_a: XCO:0000026 ! surgical removal
created_by: JSmith
creation_date: 2014-01-09T14:52:48Z

[Term]
id: XCO:0000374
name: axotomy
def: "Surgical transection or severing of an axon, the process of a neuron capable of conducting action potentials or self-propagating nerve impulses away from the cell body." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
xref: MESH:D019771
is_a: XCO:0001373 ! surgical nerve transection
created_by: JSmith
creation_date: 2014-01-09T14:56:20Z

[Term]
id: XCO:0000375
name: sciatic nerve axotomy
def: "Surgical transection or severing of one or more axons of the sciatic nerve, the large sensory and motor nerve that in humans arises from the sacral plexus and passes through the greater sciatic foramen to midthigh where it divides into the common peroneal and tibial nerves." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
xref: MA:0001172
xref: MESH:D019771
is_a: XCO:0000374 ! axotomy
created_by: JSmith
creation_date: 2014-01-09T14:57:23Z

[Term]
id: XCO:0000376
name: saphenous nerve axotomy
def: "Surgical transection or severing of one or more axons of the saphenous nerve, a sensory nerve that is a terminal branch of the femoral nerve, in humans extending from the femoral triangle to the foot, becoming subcutaneous on the medial side of the knee." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, Farlex:Farlex_Partner_Medical_Dictionary_2012, ISBN:978-1416049982]
xref: MA:0002761
xref: MESH:D019771
is_a: XCO:0000374 ! axotomy
created_by: JSmith
creation_date: 2014-01-09T14:57:26Z

[Term]
id: XCO:0000377
name: vitamin
def: "A condition in which the main influencing factor is any of a group of unrelated organic substances occurring in many foods in small amounts and necessary in trace amounts for the normal metabolic functioning of the body." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2014-01-09T17:12:36Z

[Term]
id: XCO:0000378
name: vitamin E
def: "A condition in which the main influencing factor is any of a group of at least eight related fat-soluble compounds with similar biological antioxidant activity, particularly alpha-tocopherol but also including other isomers of tocopherol and the related compounds tocotrienol and tocomonoenol." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://www.cyberlipid.org/vite/vite0001.htm "Website", ISBN:978-1416049982]
xref: CHEBI:33234
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000377 ! vitamin
created_by: JSmith
creation_date: 2014-01-09T17:14:02Z

[Term]
id: XCO:0000379
name: alpha-tocopherol
def: "A condition in which the main influencing factor is the most active form of vitamin E, a 6-hydroxychroman derivative (chromene) with methyl groups in position 2,5,7, and 8 and a phytyl side chain attached at carbon 2. May be described chemically as 2R-(4'R,8'R)-5,7,8-trimethyltocol, with the term tocol indicating the 2-ring structure (benzopyran-6-ol) basic to all vitamin E compounds." [http://www.cyberlipid.org/vite/vite0001.htm "Website"]
synonym: "a-tocopherol" RELATED []
xref: CHEBI:22470
relationship: part_of XCO:0000378 ! vitamin E
created_by: JSmith
creation_date: 2014-01-09T17:15:15Z

[Term]
id: XCO:0000380
name: phytyl side chain of alpha-tocopherol
def: "A condition in which the main influencing factor is a hydrophobic 13 carbon saturated chain with methyl side groups at the 4', 8' and 12' positions. In its native form, the molecule is attached to the 2-carbon of the benzopyran-6-ol double ring structure of alpha-tocopherol." [http://www.cyberlipid.org/vite/vite0001.htm "Website"]
synonym: "alpha-tocopherol phytyl side chain" RELATED []
is_a: XCO:0000276 ! hydrocarbon
relationship: part_of XCO:0000379 ! alpha-tocopherol
created_by: JSmith
creation_date: 2014-01-09T17:16:43Z

[Term]
id: XCO:0000381
name: progesterone
def: "Condition in which the main influencing factor is the steroid hormone progesterone, the principal pro-gestational hormone liberated by the corpus luteum, adrenal cortex, and placenta, whose function is to prepare the uterus for the reception and development of the fertilized oocyte by inducing transformation of the endometrium from the proliferative to the secretory stage." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000229 ! steroid hormone
created_by: JSmith
creation_date: 2014-01-09T17:37:07Z

[Term]
id: XCO:0000382
name: controlled captopril content drinking water
def: "A drink made up of water and a specified amount of captopril consumed by an organism as part of an experiment. Captopril is an angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and some types of congestive heart failure." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Captopril "Wikipedia", ISBN:978-1416049982]
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000270 ! captopril
created_by: JSmith
creation_date: 2014-01-09T18:05:23Z

[Term]
id: XCO:0000383
name: controlled losartan content drinking water
def: "A drink made up of water and a specified amount of losartan consumed by an organism as part of an experiment. Losartan is a selective, competitive angiotensin II receptor type 1 (AT1) receptor antagonist, reducing the end organ responses to angiotensin II." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Losartan "Wikipedia", ISBN:978-1416049982]
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000161 ! losartan
created_by: JSmith
creation_date: 2014-01-09T18:07:00Z

[Term]
id: XCO:0000384
name: controlled tempol content drinking water
def: "A drink made up of water and a specified amount of tempol consumed by an organism as part of an experiment. Tempol (4-Hydroxy-TEMPO) is a heterocyclic compound used as an agent for detoxifying reactive oxygen species. It catalyses the disproportionation of superoxide." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/TEMPOL "Wikipedia", ISBN:978-1416049982]
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000272 ! tempol
created_by: JSmith
creation_date: 2014-01-09T18:07:59Z

[Term]
id: XCO:0000385
name: glomerulonephritis-inducing agent
def: "Any substance, such as a chemical, a mix of chemicals or a pathogen, which has the capacity to cause the development of the symptoms of glomerulonephritis, kidney inflammation characterized by inflammation of the capillary loops in the renal glomeruli." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
is_a: XCO:0000258 ! disease-inducing agent
created_by: JSmith
creation_date: 2014-01-10T15:46:03Z

[Term]
id: XCO:0000386
name: collagenase-solubilized glomerular basement membrane
def: "A condition in which the main influencing factor is a relatively undefined mix of macromolecules such as glycoproteins, proteoglycans, and fragmented collagens, derived from the basement membrane of renal glomeruli via treatment with collagenase, an enzyme that catalyzes the hydrolysis of peptide bonds in triple helical regions of collagen, one of the major components of basement membranes. A basement membrane is an organised multi-molecular extracellular matrix which is characteristically found under epithelial and endothelial cells." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Segen:Segens_Medical_Dictionary_2012]
synonym: "collagenase-solubilized GBM" RELATED []
is_a: XCO:0000385 ! glomerulonephritis-inducing agent
created_by: JSmith
creation_date: 2014-01-10T15:47:24Z

[Term]
id: XCO:0000387
name: collagenase-solubilized rat glomerular basement membrane
def: "A condition in which the main influencing factor is a relatively undefined mix of macromolecules such as glycoproteins, proteoglycans, and fragmented collagens, derived from the basement membrane of renal glomeruli from rats (i.e., members of the species Rattus norvegicus) via treatment with collagenase, an enzyme that catalyzes the hydrolysis of peptide bonds in triple helical regions of collagen, one of the major components of basement membranes. A basement membrane is an organised multi-molecular extracellular matrix which is characteristically found under epithelial and endothelial cells." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Segen:Segens_Medical_Dictionary_2012]
synonym: "collagenase-solubilized rat GBM" RELATED []
is_a: XCO:0000386 ! collagenase-solubilized glomerular basement membrane
created_by: JSmith
creation_date: 2014-01-10T15:48:30Z

[Term]
id: XCO:0000388
name: acetaminophen
def: "Condition in which the main influencing factor is acetaminophen, an analgesic and antipyretic with effects similar to aspirin but only weakly antiinflammatory." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "APAP" RELATED []
synonym: "N-acetyl-p-aminophenol" EXACT []
synonym: "para-acetylaminophenol" EXACT []
synonym: "paracetamol" EXACT []
xref: CHEBI:46195
xref: MESH:D000082
is_a: XCO:0000106 ! anesthetic/analgesic
created_by: JSmith
creation_date: 2014-01-21T16:34:04Z

[Term]
id: XCO:0000389
name: controlled cigarette smoke content
def: "A condition in which the air surrounding an organism or breathed by the organism contains a controlled amount of cigarette smoke, the combined gases and particulates given off when tobacco in the form of a cigarette burns or smolders. A cigarette is a cylinder of cut blonde or black tobacco ensheathed in a tube of paper, with or without an incorporated filter to decrease inhaled tars." [McGraw-Hill:McGraw-Hill_Concise_Dictionary_of_Modern_Medicine]
synonym: "exposure to atmospheric cigarette smoke" RELATED []
is_a: XCO:0000009 ! controlled air content
created_by: JSmith
creation_date: 2014-01-21T16:58:06Z

[Term]
id: XCO:0000390
name: antimetabolite
def: "A condition in which the main influencing factor is a substance which competes with or replaces a metabolite (a chemical that is part of the normal metabolism of a cell or body), and so prevents or reduces its normal utilization or activity. Antimetabolites are often structurally similar to the metabolite for which they substitute." [http://en.wikipedia.org/wiki/Antimetabolite "Wikipedia"]
xref: CHEBI:35221
xref: MESH:D000963
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2014-02-07T15:47:34Z

[Term]
id: XCO:0000391
name: 5-bromo-2'-deoxyuridine
def: "A condition in which the main influencing factor is 5-bromo-2'-deoxyuridine (BrdU), a synthetic nucleoside analog and antimetabolite of thymidine. Because BrdU substitutes for thymidine in DNA during replication its incorporation can be used as a marker of cell division." [http://en.wikipedia.org/wiki/Bromodeoxyuridine "Wikipedia"]
synonym: "BrdU" RELATED []
synonym: "bromodeoxyuridine" RELATED []
xref: CHEBI:472552
xref: MESH:D001973
is_a: XCO:0000390 ! antimetabolite
is_a: XCO:0000392 ! nucleoside/nucleotide
is_a: XCO:0000435 ! antineoplastic agent
created_by: JSmith
creation_date: 2014-02-07T15:58:44Z

[Term]
id: XCO:0000392
name: nucleoside/nucleotide
def: "A condition in which the main influencing factor is any of various compounds consisting of a purine or pyrimidine base and a sugar, usually ribose or deoxyribose, with (nucleotide) or without (nucleoside) one or more phosphate groups." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, http://en.wikipedia.org/wiki/Nucleotide "Wikipedia"]
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2014-02-07T16:00:28Z

[Term]
id: XCO:0000393
name: 1,2-dimethylhydrazine
def: "A condition in which the main influencing factor is 1,2-dimethylhydrazine, DNA alkylating agent that is a potent carcinogen; used to induce colon tumours in experimental animals." [http://en.wikipedia.org/wiki/1\,2-dimethylhydrazine "Wikipedia", Mondofacto:Mondofacto_Online_Medical_Dictionary]
synonym: "Hydrazomethane" RELATED []
synonym: "N,N'-dimethylhydrazine" EXACT []
synonym: "SDMH" RELATED []
synonym: "symmetrical dimethylhydrazine" RELATED []
xref: CHEBI:73755
xref: MESH:D019813
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000205 ! mutation inducing chemical
created_by: JSmith
creation_date: 2014-02-07T16:46:23Z

[Term]
id: XCO:0000394
name: controlled bile acid content diet
def: "A regimen of solid food to which a specified amount of bile acid has been added. Bile acids are steroid acids derived from cholesterol in the liver (primary) or produced from primary bile acids by intestinal bacteria (secondary)." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000014 ! controlled content diet
created_by: JSmith
creation_date: 2014-02-07T16:57:51Z

[Term]
id: XCO:0000395
name: controlled 4-nitroquinoline N-oxide content drinking water
def: "A drink made up of water and a specified amount of 4-nitroquinoline N-oxide, a tumorigenic derivative of quinoline N-oxide containing a nitro functional group (-NO2) at the 4 position of the quinoline bicyclic structure. 4-nitroquinoline 1-oxide and its metabolite 4-hydroxyaminoquinoline-1-oxide bind to nucleic acids and cause lesions usually corrected by nucleotide excision repair." [http://en.wikipedia.org/wiki/4-Nitroquinoline_1-oxide "Wikipedia"]
synonym: "controlled 4-Nitroquinoline 1-oxide drinking water" EXACT []
synonym: "controlled 4NQO drinking water" RELATED []
xref: CHEBI:16907
xref: MESH:D015112
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000351 ! 4-nitroquinoline N-oxide
created_by: JSmith
creation_date: 2014-02-07T17:03:31Z

[Term]
id: XCO:0000396
name: phenolic/phenol derivative
def: "Any organic aromatic compound consisting of at least one phenolic group, that is, a group having one or more hydroxy groups attached to a benzene or other arene ring." []
xref: CHEBI:33853
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2014-02-27T13:23:28Z

[Term]
id: XCO:0000397
name: bisphenol A
def: "A synthetic phenolic compound with the chemical formula (CH3)2C(C6H4OH)2, i.e. one in which a central carbon links to two methyl groups and two hydroxyphenyl groups. BPA is similar in structure to estradiol and can bind to and activate the estrogen receptor." [http://en.wikipedia.org/wiki/Bisphenol_A "Wikipedia"]
synonym: "BPA" RELATED []
xref: CHEBI:33216
is_a: XCO:0000396 ! phenolic/phenol derivative
created_by: JSmith
creation_date: 2014-02-27T13:28:43Z

[Term]
id: XCO:0000398
name: cisplatin
def: "A condition in which the main influencing factor is cisplatin, a chemotherapy drug in which two ammine ligands and two chloro ligands are oriented in a cis planar configuration around a central platinum ion. Cisplatin is mutagenic and serves as an anti-cancer drug through its ability to bind to and crosslink DNA, interfering with cell division, triggering DNA repair mechanisms and, in turn, activating apoptosis." [CHEBI:27899, http://en.wikipedia.org/wiki/Cisplatin]
xref: CHEBI:27899
is_a: XCO:0000205 ! mutation inducing chemical
is_a: XCO:0000399 ! complex ion
is_a: XCO:0000435 ! antineoplastic agent
created_by: JSmith
creation_date: 2014-02-27T15:53:25Z

[Term]
id: XCO:0000399
name: complex ion
def: "A metal ion surrounded by, and forming coordinate covalent bonds with, a set of ligands comprised of any combination of other molecules or ions able to donate an electron pair." [http://chemwiki.ucdavis.edu/Inorganic_Chemistry/Coordination_Chemistry/Complex_Ion_Equilibria/Complex-Ion_Equilibria "Website", http://www.chemguide.co.uk/inorganic/complexions/whatis.html#top "Website"]
is_a: XCO:0000149 ! ion/salt
created_by: JSmith
creation_date: 2014-02-27T15:55:56Z

[Term]
id: XCO:0000400
name: surgical avulsion
def: "A surgical manipulation in which one tissue, organ or body part is forcibly torn away from the whole, or in which an attached or anchored tissue is torn away from another tissue or body part." [Mosby:Mosbys_Medical_Dictionary--8th_Ed, Segen:Segens_Medical_Dictionary_2012]
is_a: XCO:0000026 ! surgical removal
created_by: JSmith
creation_date: 2014-02-27T17:28:06Z

[Term]
id: XCO:0000401
name: nerve root avulsion
def: "The surgical tearing apart of the nerve root, the part of a nerve adjacent to the center to which it is connected, from that center, for example, surgical separation of one or both of two bundles of nerve fibers (the posterior and anterior roots) from the spinal cord by tearing rather than cutting." [Farlex:Farlex_Partner_Medical_Dictionary_2012, Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000373 ! surgical denervation
is_a: XCO:0000400 ! surgical avulsion
created_by: JSmith
creation_date: 2014-02-27T17:29:08Z

[Term]
id: XCO:0000402
name: habituation to experimental apparatus
def: "A condition in which an experimental subject is exposed to an experimental apparatus in order to habituate the individual to the apparatus. Habituation is the gradual decrease in behavioral responses to a particular stimulus or environment after repeated exposures have proven to be of no consequence." [http://en.wikipedia.org/wiki/Habituation "Wikipedia", Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
is_a: XCO:0000000 ! experimental condition
created_by: JSmith
creation_date: 2014-02-28T11:38:55Z

[Term]
id: XCO:0000403
name: controlled cisplatin content diet
def: "A solid diet in which the amount of cisplatin, a chemotherapy drug in which two ammine ligands and two chloro ligands are oriented in a cis planar configuration around a central platinum ion, is maintained at a specified level." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
xref: CHEBI:27899
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000398 ! cisplatin
created_by: JSmith
creation_date: 2014-02-28T12:22:58Z

[Term]
id: XCO:0000404
name: controlled bisphenol A content diet
def: "A solid diet in which the amount of bisphenol A is maintained at a specified level. Bisphenol A is a synthetic phenolic compound with the chemical formula (CH3)2C(C6H4OH)2, i.e. one in which a central carbon links to two methyl groups and two hydroxyphenyl groups. BPA is similar in structure to estradiol and can bind to and activate the estrogen receptor." [http://en.wikipedia.org/wiki/Bisphenol_A "Wikipedia", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled BPA content diet" RELATED []
xref: CHEBI:33216
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000397 ! bisphenol A
created_by: JSmith
creation_date: 2014-02-28T12:23:03Z

[Term]
id: XCO:0000405
name: controlled cisplatin content drinking water
def: "A drink made up of water and a specified amount of cisplatin consumed by an organism as part of an experiment. Cisplatin is a chemotherapy drug in which two ammine ligands and two chloro ligands are oriented in a cis planar configuration around a central platinum ion." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Cisplatin "Wikipedia", ISBN:978-1416049982]
xref: CHEBI:27899
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000398 ! cisplatin
created_by: JSmith
creation_date: 2014-02-28T12:48:11Z

[Term]
id: XCO:0000406
name: controlled bisphenol A content drinking water
def: "A drink made up of water and a specified amount of bisphenol A consumed by an organism as part of an experiment. Bisphenol A is a synthetic phenolic compound with the chemical formula (CH3)2C(C6H4OH)2, i.e. one in which a central carbon links to two methyl groups and two hydroxyphenyl groups. BPA is similar in structure to estradiol and can bind to and activate the estrogen receptor." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Bisphenol_A "Wikipedia", ISBN:978-1416049982]
synonym: "controlled BPA content drinking water" RELATED []
xref: CHEBI:33216
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000397 ! bisphenol A
created_by: JSmith
creation_date: 2014-02-28T12:48:15Z

[Term]
id: XCO:0000407
name: hypoglycemic agent
def: "This is any condition in which the main influencing factor is a substance which has the ability to lower the level of glucose, particularly blood glucose, in an organism." []
synonym: "antidiabetic agent" EXACT []
synonym: "antidiabetic  drug" EXACT []
synonym: "antihyperglycemic agent" EXACT []
synonym: "Not4Curation" RELATED []
xref: CHEBI:35526
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: JSmith
creation_date: 2014-02-28T17:14:36Z

[Term]
id: XCO:0000408
name: metformin
def: "A condition in which the main influencing factor is metformin, an oral antidiabetic drug in the biguanide class which functions to supress the production of glucose by the liver (hepatic gluconeogenesis)." [http://en.wikipedia.org/wiki/Metformin "Wikipedia"]
synonym: "Glucophage" NARROW []
xref: CHEBI:6801
is_a: XCO:0000407 ! hypoglycemic agent
created_by: JSmith
creation_date: 2014-02-28T17:17:09Z

[Term]
id: XCO:0000409
name: controlled metformin content drinking water
def: "A drink made up of water and a specified amount of metformin consumed by an organism as part of an experiment. Metformin is an oral antidiabetic drug in the biguanide class which functions to supress the production of glucose by the liver (hepatic gluconeogenesis)." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Metformin "Wikipedia", ISBN:978-1416049982]
xref: CHEBI:6801
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000408 ! metformin
created_by: JSmith
creation_date: 2014-02-28T17:27:21Z

[Term]
id: XCO:0000410
name: controlled metformin content diet
def: "A solid diet in which the amount of metformin, an oral antidiabetic drug in the biguanide class which functions to supress the production of glucose by the liver (hepatic gluconeogenesis), is maintained at a specified level." [http://en.wikipedia.org/wiki/Metformin "Wikipedia", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
xref: CHEBI:6801
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000408 ! metformin
created_by: JSmith
creation_date: 2014-02-28T17:29:02Z

[Term]
id: XCO:0000411
name: reproduction condition
def: "Any experimental condition that is specifically related to the reproduction of the organism, that is, to the cellular, genetic, behavioral and temporal processes by which an organism produces offspring similar to itself so that the species is perpetuated." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000000 ! experimental condition
created_by: JSmith
creation_date: 2014-03-04T12:21:41Z

[Term]
id: XCO:0000412
name: gestation
def: "The state of a female and/or her offspring, and the processes which occur, during the period from conception to birth or termination of the pregnancy." [Farlex:Farlex_Partner_Medical_Dictionary_2012]
synonym: "pregnancy" RELATED []
is_a: XCO:0000411 ! reproduction condition
created_by: JSmith
creation_date: 2014-03-04T12:29:54Z

[Term]
id: XCO:0000413
name: birth
def: "The emergence and separation of offspring from the body of the mother." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
synonym: "parturition" RELATED []
is_a: XCO:0000411 ! reproduction condition
created_by: JSmith
creation_date: 2014-03-04T12:36:04Z

[Term]
id: XCO:0000414
name: lactation
def: "The process of synthesis and secretion of milk from the mammary glands in the nourishment of offspring." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "breast feeding" RELATED []
synonym: "milk production" RELATED []
is_a: XCO:0000411 ! reproduction condition
created_by: JSmith
creation_date: 2014-03-04T12:38:40Z

[Term]
id: XCO:0000415
name: maternal milk
def: "This is any condition in which the main influencing factor is maternal milk, the nutrient fluid produced by the mammary gland of a female mammal for the nourishment of her young and consumed by her offspring or a fosterling of the same species." [Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
synonym: "breast milk" RELATED []
synonym: "mother's milk" RELATED []
is_a: XCO:0000416 ! milk
created_by: JSmith
creation_date: 2014-03-04T12:44:39Z

[Term]
id: XCO:0000416
name: milk
def: "This is any condition in which the main influencing factor is milk, a nutrient fluid containing proteins, fats, lactose, and various vitamins and minerals produced by the mammary gland of a female mammal." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
is_a: XCO:0000020 ! drink
created_by: JSmith
creation_date: 2014-03-04T12:54:50Z

[Term]
id: XCO:0000417
name: controlled phytoestrogen content diet
def: "A solid diet in which the amount of one or more phytoestrogens, any of a group of weakly estrogenic, nonsteroidal compounds widely occurring in plants, is maintained at a specified level." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
xref: CHEBI:76989
is_a: XCO:0000014 ! controlled content diet
created_by: JSmith
creation_date: 2014-03-04T13:32:02Z

[Term]
id: XCO:0000418
name: phytoestrogen-free diet
def: "A solid diet which specifically contains no phytoestrogens, any of a group of weakly estrogenic, nonsteroidal compounds widely occurring in plants." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
xref: CHEBI:76989
is_a: XCO:0000419 ! soy-free diet
created_by: JSmith
creation_date: 2014-03-04T13:35:13Z

[Term]
id: XCO:0000419
name: soy-free diet
def: "A solid diet specifically containing no soy, that is, no derivative of soybeans, the bean of the leguminous plant, Glycine max, which contains little starch but is rich in protein and phytoestrogens." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000417 ! controlled phytoestrogen content diet
created_by: JSmith
creation_date: 2014-03-04T13:38:15Z

[Term]
id: XCO:0000420
name: controlled in utero environment
def: "A condition in which the environment of the offspring within the uterus is controlled during any or all of the period between fertilization and parturition." [Farlex:Farlex_Partner_Medical_Dictionary_2012]
synonym: "controlled gestational environment" RELATED []
is_a: XCO:0000421 ! in utero condition
created_by: JSmith
creation_date: 2014-03-04T13:53:44Z

[Term]
id: XCO:0000421
name: in utero condition
def: "Any condition which occurs while an organism is still within the uterus of its mother during the gestation period." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000000 ! experimental condition
created_by: JSmith
creation_date: 2014-03-04T15:25:32Z

[Term]
id: XCO:0000422
name: quinone
def: "Any condition in which the main influencing factor is a quinone, a member of a class of compounds having a fully conjugated cyclic dione structure, such as that of benzoquinones, derived from aromatic compounds by conversion of an even number of -CH= groups into -C(=O)- groups with any necessary rearrangement of double bonds." []
xref: CHEBI:36141
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2014-03-04T17:35:52Z

[Term]
id: XCO:0000423
name: thymoquinone
def: "A condition in which the main influencing factor is thymoquinone, an antioxidant phytochemical compound found in the plant Nigella sativa. Thymoquinone has the chemical formula C10H12O2 and is a 1,4-benzoquinone substituted at the 2 and 5 position with a methyl and an isopropyl group (2-Isopropyl-5-methyl- or 5-Isopropyl-2-methyl-)." [http://en.wikipedia.org/wiki/Thymoquinone "Wikipedia"]
synonym: "2-isopropyl-5-methylbenzoquinone" EXACT []
synonym: "2-methyl-5-isopropyl-p-benzoquinone" EXACT []
synonym: "2-methyl-5-propan-2-ylcyclohexa-2,5-diene-1,4-dione" EXACT []
synonym: "dihydrothymoquinone" EXACT []
xref: CHEBI:113532
xref: MESH:C003466
xref: pubchem.compound:10281
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000422 ! quinone
created_by: JSmith
creation_date: 2014-03-04T17:36:38Z

[Term]
id: XCO:0000424
name: benfotiamine
def: "A condition in which the main influencing factor is benfotiamine, a synthetic thioester S-acyl derivative and analogue of thiamine (vitamin B1); used as an antioxidant dietary supplement." [http://en.wikipedia.org/wiki/Benfotiamine "Wikipedia"]
synonym: "S-benzoylthiamine O-monophosphate" EXACT []
xref: CHEBI:41039
is_a: XCO:0000271 ! antioxidant
created_by: JSmith
creation_date: 2014-03-04T17:48:57Z

[Term]
id: XCO:0000425
name: lactotransferrin
def: "A condition in which the main influencing factor is lactotransferrin, a multifunctional protein of the transferrin family which is a major iron-binding protein in milk and body secretions, and has antimicrobial activity." [http://en.wikipedia.org/wiki/Lactoferrin "Wikipedia", RGD:1313477]
synonym: "lactoferrin" EXACT []
synonym: "LTF" RELATED []
is_a: XCO:0000193 ! peptide/protein
created_by: JSmith
creation_date: 2014-03-05T09:50:27Z

[Term]
id: XCO:0000426
name: 1H-pyrazole
def: "This is any condition in which the main influencing factor is 1H-pyrazole, a heterocyclic organic compound with the formula C3H3N2H which is a 5-membered ring of three carbon atoms and two adjacent nitrogen centers, i.e., with nitrogens at positions 1 and 2 of the ring. 1H-pyrazole is a tautomer of 3H-pyrazole and 4H-pyrazole. Pyrazole is a core motif in many antioxidant molecules." [http://en.wikipedia.org/wiki/Pyrazole "Wikipedia"]
synonym: "1,2-Diazacyclopenta-2,4-diene" EXACT []
synonym: "1,2-diazole" RELATED []
synonym: "pyrazole" EXACT []
xref: CHEBI:17241
xref: PMID:34355092
relationship: part_of XCO:0000271 ! antioxidant
created_by: JSmith
creation_date: 2014-03-05T09:52:40Z

[Term]
id: XCO:0000427
name: lycopene
def: "A condition in which the main influencing factor is lycopene, a bright red polyunsaturated carotenoid hydrocarbon (i.e. a carotene) with the formula C40H56. Lycopene is a tetraterpene assembled from eight isoprene units and has antioxidant activity." [http://en.wikipedia.org/wiki/Lycopene "Wikipedia"]
xref: CHEBI:15948
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000279 ! terpene
created_by: JSmith
creation_date: 2014-03-05T09:54:44Z

[Term]
id: XCO:0000428
name: fructose
def: "This is any condition in which the main influencing factor is fructose, a monosaccharide isomer of glucose which, although it is a 6-carbon sugar (hexose), generally exists as a 5-member hemiketal ring. Fructose is one of three dietary monosaccharides, along with glucose and galactose, that are absorbed directly into the bloodstream during digestion." [http://en.wikipedia.org/wiki/Fructose "Wikipedia"]
xref: CHEBI:15824
xref: CHEBI:28757
is_a: XCO:0000274 ! monosaccharide
created_by: JSmith
creation_date: 2014-03-05T10:26:45Z

[Term]
id: XCO:0000429
name: controlled fructose content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of fructose consumed by a subject. Fructose is one of three dietary monosaccharides that are absorbed directly into the bloodstream during digestion." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Fructose "Wikipedia", ISBN:978-1416049982]
xref: PMID:33790226
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000428 ! fructose
created_by: JSmith
creation_date: 2014-03-05T10:27:59Z

[Term]
id: XCO:0000430
name: silymarin
def: "This is any condition in which the main influencing factor is silymarin, a strongly antioxidant mixture of flavonolignans extracted from the milk thistle plant (Silybum marianum). The components or silymarin are capable of scavenging both free radicals and reactive oxygen species (ROS)." [PMID:24145092]
is_a: XCO:0000271 ! antioxidant
created_by: JSmith
creation_date: 2014-03-05T10:39:11Z

[Term]
id: XCO:0000431
name: disaccharide
def: "Any condition in which the main influencing factor is a disaccharide, a member of the class of sugars that yield two monosaccharide molecules upon hydrolysis." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000172 ! carbohydrate
created_by: JSmith
creation_date: 2014-03-07T10:28:37Z

[Term]
id: XCO:0000432
name: sucrose
def: "Any condition in which the main influencing factor is sucrose, a nonreducing disaccharide of glucose and fructose used as a food, a sweetener, a preservative and a pharmaceutical aid." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
xref: CHEBI:17992
is_a: XCO:0000431 ! disaccharide
created_by: JSmith
creation_date: 2014-03-07T10:31:32Z

[Term]
id: XCO:0000433
name: controlled sucrose content drinking water
def: "A drink made up of water and a specified amount of sucrose consumed by an organism as part of an experiment. Sucrose is a nonreducing disaccharide of glucose and fructose used as a food, a sweetener, a preservative and a pharmaceutical aid." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
xref: CHEBI:17992
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000432 ! sucrose
created_by: JSmith
creation_date: 2014-03-07T10:33:57Z

[Term]
id: XCO:0000434
name: octylphenol
def: "Condition in which the main influencing factor is octylphenol, a phenolic ring with an 8-carbon side chain." []
xref: CHEBI:34432
is_a: XCO:0000239 ! toxic substance
is_a: XCO:0000396 ! phenolic/phenol derivative
created_by: JSmith
creation_date: 2014-03-07T13:09:25Z

[Term]
id: XCO:0000435
name: antineoplastic agent
def: "This is any condition in which the main influencing factor is any chemical that inhibits or prevents the proliferation of neoplasms." []
synonym: "anticancer agent" RELATED []
synonym: "cancer chemotherapy agent" RELATED []
xref: CHEBI:35610
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: JSmith
creation_date: 2014-03-12T13:30:22Z

[Term]
id: XCO:0000436
name: controlled N-propyl-N-nitrosourea content diet
def: "A solid diet in which the amount of N-propyl-N-nitrosourea (PNU) is maintained at a specified level. PNU is a mutation-inducing chemical with three major moieties, a propyl group (-C3H7), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group)." [http://en.wikipedia.org/wiki/Nitrosourea "Wikipedia", Mosby:Mosbys_Medical_Dictionary--8th_Ed, pubchem.compound:13157]
synonym: "controlled 1-nitroso-1-propylurea content diet" EXACT []
synonym: "controlled 1-propyl-1-nitrosourea content diet" RELATED []
synonym: "controlled PNU content diet" RELATED []
synonym: "controlled propylnitrosourea content diet" EXACT []
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000344 ! N-propyl-N-nitrosourea
created_by: JSMITH
creation_date: 2014-04-17T12:42:14Z

[Term]
id: XCO:0000437
name: controlled N-propyl-N-nitrosourea content drinking water
def: "A drink made up of water and a specified amount of N-propyl-N-nitrosourea (PNU) consumed by an organism as part of an experiment. PNU is a mutation-inducing chemical with three major moieties, a propyl group (-C3H7), a nitroso group (R-N=O) and a urea group (two -NH2 groups joined by a carbonyl (C=O) functional group)." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Nitrosourea "Wikipedia", ISBN:978-1416049982, pubchem.compound:13157]
synonym: "controlled 1-nitroso-1-propylurea content drinking water" EXACT []
synonym: "controlled 1-propyl-1-nitrosourea content drinking water" RELATED []
synonym: "controlled PNU content drinking water" RELATED []
synonym: "controlled propylnitrosourea content drinking water" EXACT []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000344 ! N-propyl-N-nitrosourea
created_by: JSMITH
creation_date: 2014-04-17T12:42:20Z

[Term]
id: XCO:0000438
name: candesartan
def: "A condition in which the main influencing factor is candesartan, the angiotensin II receptor 1 (AT1) antagonist which exhibits antihypertensive effects in animal models." [http://en.wikipedia.org/wiki/Candesartan "Wikipedia"]
synonym: "2-Ethoxy-1-[[2'-(2H-tetrazol-5-yl)[1,1'-biphenyl]-4-yl]methyl]-1H-benzimidazole-7-carboxylic acid 1-[[(cyclohexyloxy)carbonyl]oxy]ethyl ester" EXACT []
synonym: "TCV-116" EXACT []
xref: CHEBI:3348
xref: MESH:C081643
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000536 ! angiotensin II receptor antagonist
created_by: JSMITH
creation_date: 2014-04-17T13:11:54Z

[Term]
id: XCO:0000439
name: controlled 3-methyl-4'-dimethylaminoazobenzene content drinking water
def: "A drink made up of water and a specified amount of 3-methyl-4'-dimethylaminoazobenzene (MDAB), a substituted azobenzene compound that acts as a potent liver carcinogen, consumed by an organism as part of an experiment." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://potency.berkeley.edu/chempages/3%27-METHYL-4-DIMETHYLAMINOAZOBENZENE.html "Website", ISBN:978-1416049982]
synonym: "controlled 3'-Me-DAB content drinking water" RELATED []
synonym: "controlled 3'-methyl-4-(dimethylamino)azobenzene content drinking water" RELATED []
synonym: "controlled 4-Dimethylamino-3'-methylazobenzene content drinking water" EXACT []
synonym: "controlled MDAB content drinking water" RELATED []
synonym: "controlled methyldimethylaminoazobenzene content drinking water" EXACT []
xref: CHEBI:76329
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000207 ! 3-methyl-4'-dimethylaminoazobenzene
created_by: JSMITH
creation_date: 2014-04-17T15:49:17Z

[Term]
id: XCO:0000440
name: controlled 3-methyl-4'-dimethylaminoazobenzene content diet
def: "A solid diet in which the amount of 3'-methyl-4-dimethylaminoazobenzene (MDAB), a substituted azobenzene compound that acts as a potent liver carcinogen, is maintained at a specified level." [http://potency.berkeley.edu/chempages/3%27-METHYL-4-DIMETHYLAMINOAZOBENZENE.html "Website", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled 3'-Me-DAB content diet" RELATED []
synonym: "controlled 3'-methyl-4-(dimethylamino)azobenzene content diet" EXACT []
synonym: "controlled 4-Dimethylamino-3'-methylazobenzene content diet" EXACT []
synonym: "controlled MDAB content diet" RELATED []
synonym: "controlled methyldimethylaminoazobenzene content diet" EXACT []
xref: CHEBI:76329
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000207 ! 3-methyl-4'-dimethylaminoazobenzene
created_by: JSMITH
creation_date: 2014-04-17T15:49:21Z

[Term]
id: XCO:0000441
name: controlled 2-acetamidofluorene content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of 2-acetamidofluorene, a substituted ortho-fused polycyclic arene that is a carcinogenic and mutagenic derivative of fluorene, consumed by a subject." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Acetylaminofluorene "Wikipedia", ISBN:978-1416049982]
synonym: "controlled 2-AAF content drinking water" RELATED []
synonym: "controlled 2-acetylaminofluorene content drinking water" RELATED []
xref: CHEBI:17356
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000208 ! 2-acetamidofluorene
created_by: JSMITH
creation_date: 2014-04-17T16:31:36Z

[Term]
id: XCO:0000442
name: controlled 2-acetamidofluorene content diet
def: "A solid diet in which the amount of 2-acetamidofluorene, a substituted ortho-fused polycyclic arene that is a carcinogenic and mutagenic derivative of fluorene, is maintained at a specified level." [http://en.wikipedia.org/wiki/Acetylaminofluorene "Wikipedia", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled 2-AAF content diet" RELATED []
synonym: "controlled 2-acetylaminofluorene content diet" RELATED []
xref: CHEBI:17356
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000208 ! 2-acetamidofluorene
created_by: JSMITH
creation_date: 2014-04-17T16:31:40Z

[Term]
id: XCO:0000443
name: controlled dexamethasone content diet
def: "A solid diet in which the amount of dexamethasone (DEX) is maintained at a specified level. DEX is a long-acting synthetic adrenocorticoid, analogous to but more potent than cortisol (a natural hormone produced by the adrenal glands), with anti-inflammatory and immunosuppressant activities." [http://en.wikipedia.org/wiki/Dexamethasone "Wikipedia", http://www.nlm.nih.gov/medlineplus/druginfo/meds/a682792.html "Website", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled DEX content diet" RELATED []
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000372 ! dexamethasone
created_by: JSmith
creation_date: 2014-04-24T13:35:39Z

[Term]
id: XCO:0000444
name: controlled dexamethasone content drinking water
def: "A drink made up of water and a specified amount of dexamethasone (DEX) consumed by an organism as part of an experiment. DEX is a long-acting synthetic adrenocorticoid, analogous to but more potent than cortisol (a natural hormone produced by the adrenal glands), with anti-inflammatory and immunosuppressant activities." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://en.wikipedia.org/wiki/Dexamethasone "Wikipedia", http://www.nlm.nih.gov/medlineplus/druginfo/meds/a682792.html "Website", ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled DEX content drinking water" RELATED []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000372 ! dexamethasone
created_by: JSmith
creation_date: 2014-04-24T13:35:46Z

[Term]
id: XCO:0000445
name: phosphate buffered saline
def: "A relatively standardized solution of sodium chloride to which one or more phosphate salts have been added to maintain a neutral pH. PBS is isotonic, that is, the ionic strength of PBS is close to that inside living cells." [http://en.wikipedia.org/wiki/Phosphate_buffered_saline "Wikipedia"]
synonym: "PBS" RELATED []
synonym: "phosphate-buffer sodium chloride solution" RELATED []
xref: CHEBI:26020
xref: CHEBI:26710
xref: CHEBI:35225
is_a: XCO:0000155 ! sodium chloride solution
is_a: XCO:0000315 ! buffer solution
created_by: JSmith
creation_date: 2014-04-24T14:08:08Z

[Term]
id: XCO:0000446
name: estrus cycle
def: "One of the two types of reproductive cycles. Specifically, the correlated phenomena of the endocrine and reproductive systems of a female (especially, non-primate) mammal resulting in regularly occurring periods during which the female is sexually active and receptive, estrus, separated by periods in which there is no sexual receptivity." [Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed, Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
synonym: "estral  cycle" RELATED []
synonym: "estrous cycle" EXACT []
is_a: XCO:0000411 ! reproduction condition
created_by: JSmith
creation_date: 2014-05-15T18:09:42Z

[Term]
id: XCO:0000447
name: estrus
def: "A regularly recurrent state of sexual excitability during which the female of non-primate mammalian species will accept the male and is capable of conceiving." [Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "estrous" RELATED []
synonym: "heat" RELATED []
synonym: "oestrus" EXACT []
relationship: part_of XCO:0000446 ! estrus cycle
created_by: JSmith
creation_date: 2014-05-15T18:16:20Z

[Term]
id: XCO:0000448
name: metestrus
def: "The period of regression and sexual inactivity in females of non-primate mammalian species between estrus and diestrus." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed]
synonym: "metestrous" RELATED []
relationship: part_of XCO:0000446 ! estrus cycle
created_by: JSmith
creation_date: 2014-05-15T18:25:00Z

[Term]
id: XCO:0000449
name: diestrus
def: "A period of sexual quiescence that intervenes between two periods of estrus in females of non-primate mammalian species between. In general during diestrus blood levels of estrogens are minimal, progesterone levels are high and the physiological state in the uterus is most conducive for implantation and growth of the developing fetus." [Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed, Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
synonym: "diestrous" RELATED []
relationship: part_of XCO:0000446 ! estrus cycle
created_by: JSmith
creation_date: 2014-05-15T18:29:26Z

[Term]
id: XCO:0000450
name: proestrus
def: "A preparatory period immediately preceding estrus and characterized by growth of graafian follicles, increased estrogenic activity, and alteration of uterine and vaginal mucosa." [Merriam-Webster:Merriam-Websters_Online_Dictionary--11th_Ed]
synonym: "proestrous" RELATED []
relationship: part_of XCO:0000446 ! estrus cycle
created_by: JSmith
creation_date: 2014-05-15T18:33:04Z

[Term]
id: XCO:0000451
name: Herpes simplex virus type 1
def: "A condition in which the main influencing factor is a neurotropic virus that is a member of the Herpesviridae family and that, once the infection becomes chronic, has the ability to cycle through recurring outbreak periods followed by periods of latency or dormancy in which the virus is inactive but still present in infected nerve cells. HSV1 causes primarily mouth, throat, face, eye, and central nervous system infections." [http://en.wikipedia.org/wiki/Herpes_simplex_virus "Wikipedia"]
synonym: "Herpes simplex virus 1" RELATED []
synonym: "HSV-1" RELATED []
is_a: XCO:0000237 ! viral pathogen
created_by: JSmith
creation_date: 2014-05-15T19:05:50Z

[Term]
id: XCO:0000452
name: controlled casein content diet
def: "A solid diet in which the amount of casein is maintained at a specified level. Casein, a phosphoprotein, is the principle protein component of milk." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled caseinogen content diet" RELATED []
is_a: XCO:0000014 ! controlled content diet
created_by: JSmith
creation_date: 2014-06-12T17:25:24Z

[Term]
id: XCO:0000453
name: controlled butter content diet
def: "This is a solid diet in which the amount of butter is maintained at a specified level. Butter is a soft yellowish or whitish emulsion of milk fat, water and air, churned from milk or cream and processed for use in cooking and as a food." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000014 ! controlled content diet
created_by: JSmith
creation_date: 2014-06-12T17:27:00Z

[Term]
id: XCO:0000454
name: controlled oil content diet
def: "A solid diet in which the amount of a specified oil is maintained at a specified level. An oil is any unctuous, combustible substance that is liquid, or easily liquefiable, on warming, and is soluble in ether but not in water. Oils may be animal, vegetable, or mineral in origin." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000014 ! controlled content diet
created_by: JSmith
creation_date: 2014-06-12T17:27:48Z

[Term]
id: XCO:0000455
name: controlled corn oil content diet
def: "A solid diet in which the amount of corn oil is maintained at a specified level. Corn oil is a refined fixed, that is, nonvolatile, oil obtained from corn, the embryo of Zea mays plant. It is sometimes promoted as a good source of polyunsaturated fatty acids." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000454 ! controlled oil content diet
relationship: has_component XCO:0000829 ! corn oil
created_by: JSmith
creation_date: 2014-06-12T17:28:44Z

[Term]
id: XCO:0000456
name: retinyl palmitate
def: "Any condition in which the primary influencing agent is retinyl palmitate, the synthetic ester of retinol (vitamin A) and palmitic acid, with formula C36H60O2." [http://en.wikipedia.org/wiki/Retinyl_palmitate "Wikipedia"]
synonym: "retinol palmitate" RELATED []
is_a: XCO:0000271 ! antioxidant
created_by: JSmith
creation_date: 2014-06-12T17:56:00Z

[Term]
id: XCO:0000457
name: controlled retinoid content diet
def: "A solid diet in which the amount of any retinoid is maintained at a specified level. Retinoids comprise retinal, retinol and any structurally similar natural derivative or synthetic compound, with or without vitamin A activity." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled vitamin A content diet" EXACT []
is_a: XCO:0000690 ! controlled vitamin content diet
created_by: JSmith
creation_date: 2014-06-12T17:57:57Z

[Term]
id: XCO:0000458
name: controlled retinyl palmitate content diet
def: "A solid diet in which the amount of retinyl palmitate is maintained at a specified level. Retinyl palmitate is the synthetic ester of retinol (vitamin A) and palmitic acid, with formula C36H60O2." [http://en.wikipedia.org/wiki/Retinyl_palmitate "Wikipedia", Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "controlled retinol palmitate content diet" RELATED []
is_a: XCO:0000457 ! controlled retinoid content diet
relationship: has_component XCO:0000456 ! retinyl palmitate
created_by: JSmith
creation_date: 2014-06-12T17:59:02Z

[Term]
id: XCO:0000459
name: controlled light/dark cycle
def: "A recurring series of conditions in which an organism experiences successive periods of exposure to controlled ambient light followed by exposure to darkness, the lack of such light, which is in turn followed by exposure to controlled ambient light and so forth." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000284 ! controlled visible light exposure
created_by: JSmith
creation_date: 2014-06-17T16:30:05Z

[Term]
id: XCO:0000460
name: subcutaneous interscapular air pouch
def: "Induction and/or maintenance of a hollow cavity beneath the skin between the scapulae (the flat triangular bones at the top or back of the shoulder), by injection or other introduction of a specified volume of air. Experimental air pouches are often used to encapsulate foreign cells or other substances." [PMID:17277140, PMID:7019400, Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
is_a: XCO:0000165 ! surgical manipulation
created_by: JSmith
creation_date: 2014-06-17T17:19:15Z

[Term]
id: XCO:0000461
name: restricted feeding
def: "A dietary regimen in which access to food is limited, e.g. to a specified number of hours per day or to a specified part of the light-dark cycle, with or without restrictions in the amount or type of food available when feeding is allowed." [PMID:24739093]
synonym: "food restriction" EXACT []
synonym: "time-restricted feeding" NARROW []
synonym: "TRF" NARROW []
is_a: XCO:0000013 ! diet
created_by: JSmith
creation_date: 2014-06-23T16:24:46Z

[Term]
id: XCO:0000462
name: light phase of controlled light/dark cycle
def: "The portion of a controlled light/dark cycle in which the subject is exposed to ambient light (that is, during which the room is lit). A controlled light/dark cycle is a recurring series of conditions in which an organism experiences successive periods of exposure to controlled ambient light followed by exposure to darkness, the lack of such light, which is in turn followed by exposure to controlled ambient light and so forth." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000459 ! controlled light/dark cycle
created_by: JSmith
creation_date: 2014-08-26T13:10:29Z

[Term]
id: XCO:0000463
name: dark phase of controlled light/dark cycle
def: "The portion of a controlled light/dark cycle in which the subject is not being exposed to ambient light (that is, during which the room is darkened). A controlled light/dark cycle is a recurring series of conditions in which an organism experiences successive periods of exposure to controlled ambient light followed by exposure to darkness, the lack of such light, which is in turn followed by exposure to controlled ambient light and so forth." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000459 ! controlled light/dark cycle
created_by: JSmith
creation_date: 2014-08-26T13:12:48Z

[Term]
id: XCO:0000464
name: controlled ex vivo organ condition
def: "Any experimental condition in which the internal or external environment of an organ, that is, a differentiated, structural part of a system of the body that performs a specific function, is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body." [Farlex:Farlex_Partner_Medical_Dictionary_2012, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000000 ! experimental condition
created_by: JSmith
creation_date: 2015-01-13T12:48:26Z

[Term]
id: XCO:0000465
name: controlled ex vivo artery condition
def: "Any experimental condition in which the internal or external environment of an artery, one of the large blood vessels carrying blood in a direction away from the heart to the tissues, is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body." [Farlex:Farlex_Partner_Medical_Dictionary_2012, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000464 ! controlled ex vivo organ condition
created_by: JSmith
creation_date: 2015-01-13T12:59:22Z

[Term]
id: XCO:0000466
name: controlled ex vivo artery perfusion pressure
def: "A condition in which the pressure, or force per area, exerted by a perfusate against the walls of an artery after removal from the body but while the tissue is still viable, is regulated or maintained at a specified level." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, Farlex:Farlex_Partner_Medical_Dictionary_2012, ISBN:978-1416049982]
synonym: "controlled ex vivo artery intraluminal  pressure" EXACT []
is_a: XCO:0000465 ! controlled ex vivo artery condition
created_by: JSmith
creation_date: 2015-01-13T13:16:48Z

[Term]
id: XCO:0000467
name: retinoid
def: "Condition in which the main influencing factor is a retinoid, any of a group of compounds containing 20 carbon atoms and structurally related to retinal, retinol, and other substances, some of which exhibit vitamin A activity." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
xref: CHEBI:26537
is_a: XCO:0000342 ! chemical with specified structure
created_by: JSmith
creation_date: 2015-03-06T18:09:40Z

[Term]
id: XCO:0000468
name: vitamin A
def: "Condition in which the main influencing factor is vitamin A, a group of fat-soluble retinoids produced via metabolism of provitamin A carotenoids. Vitamin A is involved in immune function, vision, reproduction, and cellular communication." [http://en.wikipedia.org/wiki/Vitamin_A "Wikipedia", https://ods.od.nih.gov/factsheets/VitaminA-Consumer/]
xref: CHEBI:12777
is_a: XCO:0000377 ! vitamin
is_a: XCO:0000467 ! retinoid
created_by: JSmith
creation_date: 2015-03-06T18:11:00Z

[Term]
id: XCO:0000469
name: isotretinoin
def: "Condition in which the main influencing factor is isotretinoin, a synthetic first generation retinoid compound used for the treatment of severe cases of acne and other skin diseases." [http://en.wikipedia.org/wiki/Retinoid "Wikipedia"]
synonym: "13-cis-retinoic acid" EXACT []
synonym: "13cRA" EXACT []
synonym: "Accutane" EXACT []
synonym: "Roaccutane" RELATED []
xref: CHEBI:6067
is_a: XCO:0000467 ! retinoid
created_by: JSmith
creation_date: 2015-03-06T18:13:57Z

[Term]
id: XCO:0000470
name: flavonoid
def: "Condition in which the main influencing factor is a flavonoid, any of a class of plant secondary metabolites that have the general structure of a 15-carbon skeleton, which consists of two phenyl rings (A and B) and a heterocyclic ring (C)." [http://en.wikipedia.org/wiki/Flavonoid "Wikipedia"]
synonym: "bioflavonoid" RELATED []
is_a: XCO:0000341 ! chemical with specified function
created_by: JSmith
creation_date: 2015-03-06T18:16:29Z

[Term]
id: XCO:0000471
name: quercetin
def: "Condition in which the main influencing factor is quercetin, a pentahydroxyflavone having the five hydroxy groups placed at the 3-, 3'-, 4'-, 5- and 7-positions. It is a yellow flavonoid pigment found in oak bark, the juice of lemons, asparagus, and other fruits and vegetables and is used to reduce abnormal capillary fragility." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "meletin" RELATED []
xref: CHEBI:16243
is_a: XCO:0000470 ! flavonoid
created_by: JSmith
creation_date: 2015-03-06T18:17:55Z

[Term]
id: XCO:0000472
name: chrysin
def: "Condition in which the main influencing factor is chrysin, a dihydroxyflavone in which the two hydroxy groups are located at positions 5 and 7." []
synonym: "5,7-dihydroxyflavone" RELATED []
xref: CHEBI:75095
is_a: XCO:0000470 ! flavonoid
created_by: JSmith
creation_date: 2015-03-06T18:19:02Z

[Term]
id: XCO:0000473
name: naringenin
def: "Condition in which the main influencing factor is naringenin, a trihydroxyflavanone that is flavanone substituted by hydroxy groups at positions 5, 6 and 4'.  Naringenin is the predominant flavanone in grapefruit and has demonstrated inhibitory activity against the CYP1A2 cytochrome P450 isoform." [http://en.wikipedia.org/wiki/Naringenin "Wikipedia"]
xref: CHEBI:50202
is_a: XCO:0000470 ! flavonoid
created_by: JSmith
creation_date: 2015-03-06T18:20:06Z

[Term]
id: XCO:0000474
name: alendronate
def: "Condition in which the main influencing factor is alendronate (the anionic form of alendronic acid), a bisphosphonate drug used for osteoporosis and several other bone diseases, because it inhibits osteoclast-mediated bone-resorption." [http://en.wikipedia.org/wiki/Alendronic_acid "Wikipedia"]
synonym: "alendronic acid" RELATED []
synonym: "Binosto" EXACT []
synonym: "Fosamax" EXACT []
synonym: "sodium alendronate" EXACT []
xref: CHEBI:2567
xref: CHEBI:50647
is_a: XCO:0000120 ! inhibitor
created_by: JSmith
creation_date: 2015-03-06T18:29:05Z

[Term]
id: XCO:0000475
name: bacterial pathogen
def: "Any condition in which the primary influencing agent is a bacterial pathogen, a disease-causing unicellular prokaryotic microorganism that commonly multiplies by cell division, lacks a nucleus or membrane-bound organelles, and generally has a cell wall." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "pathogenic bacteria" RELATED []
is_a: XCO:0000236 ! pathogen
is_a: XCO:0001212 ! bacteria
created_by: JSmith
creation_date: 2015-04-29T14:14:39Z

[Term]
id: XCO:0000476
name: Streptococcus pneumoniae
def: "A condition in which the primary influencing factor is Streptococcus pneumoniae, a species of Gram-positive, alpha-hemolytic, facultative anaerobic bacteria commonly found in the nasopharynx of healthy human carriers." [http://en.wikipedia.org/wiki/Streptococcus_pneumoniae "Wikipedia"]
xref: NCBITaxon:1313
is_a: XCO:0000475 ! bacterial pathogen
created_by: JSmith
creation_date: 2015-04-30T13:35:44Z

[Term]
id: XCO:0000477
name: Streptococcus pneumoniae D39
def: "This is any condition in which the main influencing factor is Streptococcus pneumoniae D39, a potentially virulent strain of the S. pneumoniae species of Gram-positive, alpha-hemolytic, facultative anaerobic bacteria commonly found in the nasopharynx of healthy human carriers." [http://en.wikipedia.org/wiki/Streptococcus_pneumoniae "Wikipedia"]
synonym: "Streptococcus pneumoniae serotype 2, strain D39" EXACT []
synonym: "Streptococcus pneumoniae strain D39" EXACT []
xref: NCBITaxon:373153
is_a: XCO:0000476 ! Streptococcus pneumoniae
created_by: JSmith
creation_date: 2015-04-30T13:36:39Z

[Term]
id: XCO:0000478
name: Streptococcus pneumoniae TIGR4
def: "This is any condition in which the main influencing factor is Streptococcus pneumoniae TIGR4, a potentially virulent strain of the S. pneumoniae species of Gram-positive, alpha-hemolytic, facultative anaerobic bacteria commonly found in the nasopharynx of healthy human carriers." [http://en.wikipedia.org/wiki/Streptococcus_pneumoniae "Wikipedia"]
synonym: "Streptococcus pneumoniae strain TIGR4" EXACT []
xref: NCBITaxon:170187
is_a: XCO:0000476 ! Streptococcus pneumoniae
created_by: JSmith
creation_date: 2015-04-30T13:38:57Z

[Term]
id: XCO:0000479
name: Haemophilus influenzae
def: "A condition in which the primary influencing factor is Haemophilus influenzae, a Gram-negative, coccobacillary, facultatively anaerobic bacterium which is considered an opportunistic pathogen, i.e. one that can colonize a host without causing disease unless there are extenuating circumstances which result in susceptibility on the part of the host." [http://en.wikipedia.org/wiki/Haemophilus_influenzae "Wikipedia"]
xref: NCBITaxon:727
is_a: XCO:0000743 ! Haemophilus
created_by: JSmith
creation_date: 2015-04-30T13:41:32Z

[Term]
id: XCO:0000480
name: nontypeable Haemophilus influenzae
def: "A condition in which the primary influencing factor is one or more nontypeable strain(s) of Haemophilus influenzae (NTHi). NTHi refers to any unencapsulated strain of the Gram-negative, coccobacillary, facultatively anaerobic bacterium species Haemophilus influenza. Such bacteria lack the capsular antigens used to serotype strains and therefore cannot be classified by serology. NTHi strains are the important pathogens in chronic and recurrent otitis media in children." [http://en.wikipedia.org/wiki/Haemophilus_influenzae "Wikipedia", PMID:15968074]
synonym: "NTHi" RELATED []
is_a: XCO:0000479 ! Haemophilus influenzae
created_by: JSmith
creation_date: 2015-04-30T13:42:32Z

[Term]
id: XCO:0000481
name: Haemophilus influenzae 86-028NP
def: "A condition in which the primary influencing factor is the 86-028NP strain of Haemophilus influenzae. 86-028NP is a pathogenic, nontypeable H. influenzae strain isolated from the nasopharynx of a child with chronic otitis media." [http://en.wikipedia.org/wiki/Haemophilus_influenzae "Wikipedia", PMID:15968074]
synonym: "86028NP" RELATED []
synonym: "Haemophilus influenzae strain 86-028NP" EXACT []
synonym: "NTHi 86-028NP" RELATED []
xref: NCBITaxon:281310
is_a: XCO:0000480 ! nontypeable Haemophilus influenzae
created_by: JSmith
creation_date: 2015-04-30T13:48:27Z

[Term]
id: XCO:0000482
name: antimicrobial agent
def: "A substance that kills or slows the growth of one or more microorganisms, including bacteria, viruses, fungi and protozoans." []
synonym: "antibiotic" RELATED []
xref: CHEBI:33281
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: JSmith
creation_date: 2015-04-30T14:25:42Z

[Term]
id: XCO:0000483
name: antibacterial agent
def: "This is any condition in which the main influencing factor is an antibacterial agent, a substance that kills or slows the growth of bacteria, unicellular prokaryotic microorganisms that commonly multiply by cell division, lack a nucleus or membrane-bound organelles, and generally have a cell wall." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
xref: CHEBI:33282
is_a: XCO:0000482 ! antimicrobial agent
created_by: JSmith
creation_date: 2015-04-30T14:31:11Z

[Term]
id: XCO:0000484
name: ceftriaxone
def: "This is any condition in which the main influencing factor is ceftriaxone, a third-generation cephalosporin antibacterial agent with broad-spectrum activity against both Gram-positive and Gram-negative bacteria." [http://en.wikipedia.org/wiki/Ceftriaxone "Wikipedia"]
xref: CHEBI:29007
is_a: XCO:0000483 ! antibacterial agent
created_by: JSmith
creation_date: 2015-04-30T14:44:33Z

[Term]
id: XCO:0000485
name: Haemophilus influenzae 86-028NP H2 mutant
def: "A condition in which the primary influencing factor is the H2 mutant of the 86-028NP strain of Haemophilus influenzae." [RGD:JRS]
synonym: "86H2" RELATED []
synonym: "Haemophilus influenzae mutant strain 86-028NP-H2" EXACT []
synonym: "NTHi 86-028NP H2 mutant" RELATED []
xref: NCBITaxon:281310
is_a: XCO:0000481 ! Haemophilus influenzae 86-028NP
created_by: JSmith
creation_date: 2015-05-14T17:54:23Z

[Term]
id: XCO:0000486
name: Haemophilus influenzae 86-028NP C5 mutant
def: "A condition in which the primary influencing factor is the C5 mutant of the 86-028NP strain of Haemophilus influenzae." [RGD:JRS]
synonym: "86C5" RELATED []
synonym: "Haemophilus influenzae mutant strain 86-028NP-C5" EXACT []
synonym: "NTHi 86-028NP C5 mutant" RELATED []
xref: NCBITaxon:281310
is_a: XCO:0000481 ! Haemophilus influenzae 86-028NP
created_by: JSmith
creation_date: 2015-05-14T17:58:28Z

[Term]
id: XCO:0000487
name: Streptococcus pneumoniae TIGR4 LuxS mutant
def: "A condition in which the primary influencing factor is the LuxS mutant of Streptococcus pneumoniae TIGR4." [RGD:JRS]
synonym: "Streptococcus pneumoniae mutant strain TIGR4luxS" EXACT []
synonym: "TIGR4luxS" RELATED []
xref: NCBITaxon:170187
is_a: XCO:0000478 ! Streptococcus pneumoniae TIGR4
created_by: JSmith
creation_date: 2015-05-14T17:59:26Z

[Term]
id: XCO:0000488
name: social environment condition
def: "Any condition related to or affecting the external interactions and relationships of a single organism, between single organisms, or within or between groups of organisms." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed]
synonym: "social context condition" RELATED []
is_a: XCO:0000000 ! experimental condition
created_by: jesmith
creation_date: 2015-12-07T15:12:14Z

[Term]
id: XCO:0000489
name: temporary social environment condition
def: "Any condition in which the social environment of an organism is set or changed for a specified and/or limited period of time." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed]
is_a: XCO:0000488 ! social environment condition
created_by: jesmith
creation_date: 2015-12-07T15:40:22Z

[Term]
id: XCO:0000490
name: ongoing social environment condition
def: "Any condition in which the social environment of an organism is set or changed for an extended period of time or on a continual basis." [Collins:Collins_Online_English_Dictionary]
is_a: XCO:0000488 ! social environment condition
created_by: jesmith
creation_date: 2015-12-07T15:56:22Z

[Term]
id: XCO:0000491
name: controlled exposure to an organism of the same species
def: "This is any condition in which the main influencing factor is controlled social contact with an organism from the same species. A species is a fundamental category of taxonomic classification, ranking below a genus and consisting of related organisms capable of interbreeding." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007]
is_a: XCO:0000489 ! temporary social environment condition
created_by: jesmith
creation_date: 2015-12-07T15:59:02Z

[Term]
id: XCO:0000492
name: controlled exposure to a juvenile of the same species
def: "This is an experimental condition in which a test subject is placed in social contact with a juvenile (young, not yet mature, not fully grown and/or not fully developed) organism from the same species." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, https://www.merriam-webster.com]
synonym: "controlled exposure to an adolescent of the same species" EXACT []
is_a: XCO:0000491 ! controlled exposure to an organism of the same species
created_by: jesmith
creation_date: 2015-12-07T16:11:18Z

[Term]
id: XCO:0000493
name: controlled exposure to an adult of the same species
def: "An experimental condition in which a test subject is placed in social contact with an adult  (an organism that is fully developed and has reached physical and/or sexual maturity) from the same species." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed]
is_a: XCO:0000491 ! controlled exposure to an organism of the same species
created_by: jesmith
creation_date: 2015-12-07T16:18:25Z

[Term]
id: XCO:0000494
name: postmenopause
def: "The physiological period after the natural cessation of estrus or menstruation cycles in an aging female mammal." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, http://www.medicaldictionaryweb.com/Postmenopause-definition/ "Website", ISBN:978-1416049982]
synonym: "postmenopausal" RELATED []
synonym: "post-productive period" RELATED []
is_a: XCO:0000411 ! reproduction condition
created_by: jesmith
creation_date: 2016-02-01T11:00:34Z

[Term]
id: XCO:0000495
name: neurotoxic substance
def: "A condition in which the main influencing factor is any substance that is poisonous or destructive to nerve cells or tissue, or that can be metabolized into a substance that is destructive to nerve cells or tissue." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
comment: Note that, although commonly used to refer to any neurotoxic substance, the term "neurotoxin" is technically restricted to naturally occurring proteins or peptides which are neurotoxic.
synonym: "neurotoxin" NARROW []
is_a: XCO:0000239 ! toxic substance
created_by: jesmith
creation_date: 2016-04-25T13:04:37Z

[Term]
id: XCO:0000496
name: neurotoxin
def: "A condition in which the main influencing factor is a peptide, a protein or a conjugated protein produced by some higher plants, animals, and pathogenic bacteria, that is poisonous or destructive to nerve cells or tissue." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000240 ! toxin
is_a: XCO:0000495 ! neurotoxic substance
created_by: jesmith
creation_date: 2016-04-25T13:25:58Z

[Term]
id: XCO:0000497
name: Parkinson disease-inducing chemical
def: "A condition in which the main influencing factor is a synthetic or naturally derived compound that causes loss of dopaminergic neurons and induces Parkinson-like symptoms (parkinsonism) in animal models and/or Parkinson disease in humans." [PMID:22108613]
synonym: "Parkinson's disease inducing chemical" EXACT []
synonym: "parkinsonism-inducing chemical" RELATED []
xref: MESH:D010300
is_a: XCO:0000259 ! disease-inducing chemical
created_by: jesmith
creation_date: 2016-04-25T13:44:48Z

[Term]
id: XCO:0000498
name: oxidopamine
def: "A condition in which the main influencing factor is oxidopamine, a neurotoxic organic compound used to induce degeneration of dopaminergic neurons in animal models." [PMID:22108613]
synonym: "6-hydoxydopamine" RELATED []
synonym: "6-OHDA" RELATED []
xref: CHEBI:78741
is_a: XCO:0000495 ! neurotoxic substance
is_a: XCO:0000497 ! Parkinson disease-inducing chemical
created_by: jesmith
creation_date: 2016-04-25T15:27:15Z

[Term]
id: XCO:0000499
name: 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine
def: "This is any condition in which the main influencing factor is1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP), the precursor to the toxic metabolite MPP+ (1-methyl-4-phenylpyridinium cation) which promotes degeneration of dopaminergic neurons." [PMID:22108613]
synonym: "MPTP" EXACT []
synonym: "N-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine" EXACT []
synonym: "N-methyl-4-phenylpyridinium" EXACT []
synonym: "Pyridine, 1,2,3,6-tetrahydro-1-methyl-4-phenyl-" EXACT []
xref: CHEBI:17963
is_a: XCO:0000495 ! neurotoxic substance
is_a: XCO:0000497 ! Parkinson disease-inducing chemical
created_by: jesmith
creation_date: 2016-04-25T15:31:31Z

[Term]
id: XCO:0000500
name: paraquat
def: "A condition in which the main influencing factor is paraquat, a herbicidal organic cation used to model Parkinson's disease in mice." [PMID:22108613]
xref: CHEBI:34905
is_a: XCO:0000495 ! neurotoxic substance
is_a: XCO:0000497 ! Parkinson disease-inducing chemical
created_by: jesmith
creation_date: 2016-04-25T15:35:55Z

[Term]
id: XCO:0000501
name: rotenone
def: "A condition in which the main influencing factor is rotenone, an insecticide and piscicide extracted from Leguminosa plants. Rotenone can be used to induce degeneration of dopaminergic neurons in animal models." [PMID:22108613]
xref: CHEBI:28201
is_a: XCO:0000496 ! neurotoxin
is_a: XCO:0000497 ! Parkinson disease-inducing chemical
created_by: jesmith
creation_date: 2016-04-25T15:41:51Z

[Term]
id: XCO:0000502
name: body part position change
def: "A condition characterized by an alteration in the placement, arrangement or orientation of any part of the body of an organism such as an organ or extremity." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--5th_Ed, https://en.wiktionary.org/wiki/body_part "Wiktionary"]
is_a: XCO:0000066 ! body position change
created_by: jesmith
creation_date: 2017-02-22T18:31:25Z

[Term]
id: XCO:0000503
name: head position change
def: "A condition characterized by an alteration in the placement, arrangement or orientation of the head of an organism." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--5th_Ed, https://en.wiktionary.org/wiki/body_part "Wiktionary"]
synonym: "change in position of the head" EXACT []
is_a: XCO:0000502 ! body part position change
created_by: jesmith
creation_date: 2017-02-22T18:33:23Z

[Term]
id: XCO:0000504
name: coronal plane rotational acceleration of the head
def: "A condition characterized by rotation or twisting of the head parallel to the coronal plane of the body (that is, the plane which separates the belly from the back of the organism) at an increasing velocity." [PMID:27188340]
synonym: "coronal plane angular acceleration of the head" RELATED []
is_a: XCO:0000503 ! head position change
created_by: jesmith
creation_date: 2017-02-22T18:34:51Z

[Term]
id: XCO:0000505
name: anti-inflammatory agent
def: "A condition in which the main influencing factor is a chemical which counteracts or suppresses inflammation." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "antiinflammatory agent" EXACT []
synonym: "Not4Curation" RELATED []
xref: CHEBI:67079
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: jesmith
creation_date: 2017-02-22T18:36:33Z

[Term]
id: XCO:0000506
name: non-steroidal anti-inflammatory drug
def: "A condition in which the main influencing factor is a chemical which counteracts or suppresses inflammation but which is not a steroid." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "NSAID" RELATED []
xref: CHEBI:35475
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: jesmith
creation_date: 2017-02-22T18:40:46Z

[Term]
id: XCO:0000507
name: carprofen
def: "Condition in which the main influencing factor is a non-steroidal anti-inflammatory drug with chemical formula C15H12ClNO2, used as a veterinary analgesic." [https://en.wikipedia.org/wiki/Carprofen "Wikipedia"]
xref: CHEBI:364453
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000506 ! non-steroidal anti-inflammatory drug
created_by: jesmith
creation_date: 2017-02-22T18:45:59Z

[Term]
id: XCO:0000508
name: audible tone stimulus
def: "An auditory stimulus consisting of a sound which is at a frequency and level to be perceptible to the ear, especially the human ear." [Farlex:Farlex_Partner_Medical_Dictionary_2012, Mosby:Mosbys_Medical_Dictionary--8th_Ed]
is_a: XCO:0000048 ! auditory stimulus
created_by: jesmith
creation_date: 2017-02-22T18:56:06Z

[Term]
id: XCO:0000509
name: ultrasonic stimulus
def: "An auditory stimulus consisting of sound waves which are beyond the upper limit of perception by the human ear." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000048 ! auditory stimulus
created_by: jesmith
creation_date: 2017-02-22T19:03:06Z

[Term]
id: XCO:0000510
name: coronal plane rotational velocity of the head
def: "An experimental condition characterized by rotation or twisting of the head parallel to the coronal plane of the body (that is, the plane which separates the belly from the back of the organism) at a relatively constant velocity." [PMID:27188340]
synonym: "coronal plane angular velocity of the head" RELATED []
is_a: XCO:0000503 ! head position change
created_by: jesmith
creation_date: 2017-04-21T13:27:10Z

[Term]
id: XCO:0000511
name: ester
def: "Any condition in which the main influencing factor is a substance is a chemical compound derived from the linkage of an organic or inorganic acid and an alcohol, phenol, heteroarenol, or enol with the loss of water (H2O) formed from one hydrogen derived from an acidic hydroxy group of the acid and an -OH (hydroxy) group of the alcohol." [https://en.wikipedia.org/wiki/Ester "Wikipedia"]
xref: CHEBI:35701
is_a: XCO:0000342 ! chemical with specified structure
created_by: jesmith
creation_date: 2017-07-18T12:56:04Z

[Term]
id: XCO:0000512
name: teratogen
def: "Any condition in which the main influencing factor is a substance with adverse or toxic effects on an embryo or fetus resulting in birth defects, specifically, altered development, growth retardation, functional defect and/or embryo death." [https://en.wikipedia.org/wiki/Teratology "Wikipedia"]
synonym: "teratogenic agent" EXACT []
xref: CHEBI:50905
is_a: XCO:0000259 ! disease-inducing chemical
created_by: jesmith
creation_date: 2017-07-18T12:58:04Z

[Term]
id: XCO:0000513
name: dibutyl phthalate
def: "A condition in which the main influencing factor is dibutyl phthalate (DBP), the diester obtained by the formal condensation of the carboxy groups of phthalic acid with two molecules of butan-1-ol. DBP has been used as a plasticizer and as an antiparasitic drug used to treat infestation of parasites on the surface of the body, and is suspected of being an endocrine disruptor and teratogen." [https://en.wikipedia.org/wiki/Dibutyl_phthalate "Wikipedia"]
synonym: "DBP" RELATED []
synonym: "di-n-butyl phthalate" EXACT []
xref: CHEBI:34687
is_a: XCO:0000511 ! ester
is_a: XCO:0000512 ! teratogen
created_by: jesmith
creation_date: 2017-07-18T13:00:07Z

[Term]
id: XCO:0000514
name: metoprolol
def: "A condition in which the main influencing factor is metoprolol, a selective beta-1 adrenergic receptor blocker used to treat hypertension, angina, acute myocardial infarction, tachycardia, and congestive heart failure, and to prevent migraine headaches." [https://en.wikipedia.org/wiki/Metoprolol "Wikipedia", MESH:D008790]
xref: MESH:D008790
is_a: XCO:0000336 ! adrenergic antagonist
is_a: XCO:0000396 ! phenolic/phenol derivative
created_by: jesmith
creation_date: 2017-07-18T13:05:03Z

[Term]
id: XCO:0000515
name: metoprolol tartrate
def: "A condition in which the main influencing factor is metoprolol tartrate, an immediate-release formulation of metoprolol.  Metoprolol is a selective beta-1 adrenergic receptor blocker used to treat hypertension, angina, acute myocardial infarction, tachycardia, and congestive heart failure, and to prevent migraine headaches." [https://en.wikipedia.org/wiki/Metoprolol "Wikipedia", MESH:D008790]
is_a: XCO:0000514 ! metoprolol
created_by: jesmith
creation_date: 2017-07-18T13:06:13Z

[Term]
id: XCO:0000516
name: metoprolol succinate
def: "A condition in which the main influencing factor is metoprolol succinate, an extended-release formulation of metoprolol.  Metoprolol is a selective beta-1 adrenergic receptor blocker used to treat hypertension, angina, acute myocardial infarction, tachycardia, and congestive heart failure, and to prevent migraine headaches." [https://en.wikipedia.org/wiki/Metoprolol "Wikipedia", MESH:D008790]
is_a: XCO:0000514 ! metoprolol
created_by: jesmith
creation_date: 2017-07-18T13:06:16Z

[Term]
id: XCO:0000517
name: anti-transforming growth factor beta antibody
def: "A condition in which the main influencing factor is an immunoglobulin molecule or a preparation of multiple antibody molecules having specific amino acid sequences with the ability to adhere to and interact specifically with any or all of the transforming growth factor beta cytokines." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed, Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
synonym: "1D11 monoclonal antibody" NARROW []
synonym: "anti-TGFbeta antibody" RELATED []
is_a: XCO:0000194 ! antibody
created_by: jesmith
creation_date: 2017-07-18T13:10:24Z

[Term]
id: XCO:0000518
name: anti-Shiga toxin 1 beta antibody
def: "A condition in which the main influencing factor is an immunoglobulin molecule or a preparation of multiple antibody molecules having specific amino acid sequences with the ability to adhere to and interact specifically with the beta subunit of Shiga toxin from Shigella dysenteriae 1." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed, PMID:26904753, Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
synonym: "anti-Shigatoxin 1B antibody" RELATED []
is_a: XCO:0000194 ! antibody
created_by: jesmith
creation_date: 2017-07-18T13:12:49Z

[Term]
id: XCO:0000519
name: anti-Shiga toxin 1 beta monoclonal antibody 13C4
def: "A condition in which the main influencing factor is an immunoglobulin molecule having specific amino acid sequences with the ability to adhere to and interact specifically with the beta subunit of Shiga toxin from Shigella dysenteriae 1. This monoclonal antibody has been used as an IgG1 isotype control." [Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed, PMID:14675041, PMID:26904753, Saunders:Saunders_Comprehensive_Veterinary_Dictionary--3rd_Ed]
synonym: "anti-Shigatoxin 1B monoclonal antibody 13C4" RELATED []
is_a: XCO:0000518 ! anti-Shiga toxin 1 beta antibody
created_by: jesmith
creation_date: 2017-07-18T13:14:54Z

[Term]
id: XCO:0000520
name: neuromodulation
def: "Any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of a stimulus, such as electrical stimulation or chemical agents, to specific neurological sites in the body." [https://en.wikipedia.org/wiki/Neuromodulation_(medicine) "Wikipedia"]
is_a: XCO:0000000 ! experimental condition
created_by: jesmith
creation_date: 2017-07-18T13:25:13Z

[Term]
id: XCO:0000521
name: direct electrical nerve stimulation
def: "This is any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to a specific nerve or nerves, for example through the use of microelectrodes or an implanted device." [https://en.wikipedia.org/wiki/Neurostimulation "Wikipedia"]
synonym: "direct electrical nerve stimulus" RELATED []
is_a: XCO:0000520 ! neuromodulation
created_by: jesmith
creation_date: 2017-07-18T13:25:52Z

[Term]
id: XCO:0000522
name: common peroneal nerve direct electrical stimulation
def: "A condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to the common peroneal nerve(s), for example through the use of microelectrodes or an implanted device. The common peroneal nerve is one of the terminal divisions of the sciatic nerve, diverging from the tibial nerve at the upper end of the popliteal fossa, then coursing with the biceps tendon along the lateral portion of the popliteal space to wind around the neck of the fibula, where it divides into the superficial and deep peroneal nerves." [Farlex:Farlex_Partner_Medical_Dictionary_2012, https://en.wikipedia.org/wiki/Common_peroneal_nerve "Wikipedia", https://en.wikipedia.org/wiki/Neurostimulation "Wikipedia"]
synonym: "direct electrical stimulus of the common peroneal nerve" EXACT []
is_a: XCO:0000521 ! direct electrical nerve stimulation
created_by: jesmith
creation_date: 2017-07-18T13:27:01Z

[Term]
id: XCO:0000523
name: enzyme inhibitor
def: "This is any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of an enzyme, a protein that catalyzes chemical reactions of other substances without itself being destroyed or altered upon completion of the reactions." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
is_a: XCO:0000120 ! inhibitor
created_by: jesmith
creation_date: 2017-07-18T13:31:10Z

[Term]
id: XCO:0000524
name: angiotensin converting enzyme inhibitor
def: "Any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of angiotensin converting enzyme (ACE). ACE is an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. ACE inhibitors are used in the treatment of hypertension, congestive heart failure, acute myocardial infarction and diabetic nephropathy." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, https://en.wikipedia.org/wiki/ACE_inhibitor "Wikipedia", ISBN:978-1416049982]
synonym: "ACE inhibitor" RELATED []
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000863 ! antihypertensive agent
created_by: jesmith
creation_date: 2017-07-18T13:32:02Z

[Term]
id: XCO:0000525
name: benazepril
def: "A condition in which the main influencing factor is benazepril, a benzazepine in which the carboxy group of the 2-amino-4-phenylbutanoic acid moiety of benazeprilat has been converted to the corresponding ethyl ester. Removal of the ester by the liver converts the prodrug back to its active form, benazeprilat.  Benazepril is an angiotensin converting enzyme (ACE) inhibitor used in the treatment of hypertension, congestive heart failure, acute myocardial infarction and diabetic nephropathy." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, https://en.wikipedia.org/wiki/Benazepril "Wikipedia", ISBN:978-1416049982]
xref: CHEBI:3011
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: jesmith
creation_date: 2017-07-18T13:34:04Z

[Term]
id: XCO:0000526
name: swimming with water weights
def: "A condition in which the main influencing factor is the action of moving one's appendages to propel oneself through water while carrying weights (for example, aquatic dumbbells, ankle cuffs, or weighted belt) to increase resistance and/or decrease buoyancy thereby increasing the difficulty of the action." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--5th_Ed, Encarta:Encarta_World_English_Dictionary]
is_a: XCO:0000059 ! physical activity
created_by: jesmith
creation_date: 2017-07-18T13:50:19Z

[Term]
id: XCO:0000527
name: genetic manipulation
def: "A condition in which the genotype or the gene expression of an organism or a cell has been modified." [Farlex:Farlex_Partner_Medical_Dictionary_2009]
is_a: XCO:0000000 ! experimental condition
created_by: jesmith
creation_date: 2017-08-11T16:51:14Z

[Term]
id: XCO:0000528
name: gene transfer
def: "This is any condition in which copies of an exogenous gene have been transiently or stably inserted into a living cell or organism in order to induce synthesis of that gene's product or to block synthesis of some gene product." [Webster:Random_House_Kernerman_Websters_College_Dictionary_2010]
synonym: "horizontal gene transfer" RELATED []
is_a: XCO:0000527 ! genetic manipulation
created_by: jesmith
creation_date: 2017-08-11T16:57:10Z

[Term]
id: XCO:0000529
name: gene transfer using an adenovirus vector
def: "This is any condition in which the main influencing factor is a gene transfer performed using an adenovirus as the carrier of the genetic material. An adenovirus is any of a group of medium-sized (90-100 nm) non-enveloped icosahedral viruses of the family Adenoviridae which are characterized by a nucleocapsid surrounding a double-stranded DNA genome. An adenovirus is a double-stranded DNA virus that can replicate independently." [Segen:Segens_Medical_Dictionary_2012]
synonym: "adenoviral gene transfer" EXACT []
synonym: "adenovirus transfer" EXACT []
synonym: "AdV transfer" EXACT []
is_a: XCO:0000528 ! gene transfer
created_by: jesmith
creation_date: 2017-08-11T16:58:54Z

[Term]
id: XCO:0000530
name: gene transfer of the murine angiotensin I converting enzyme 2 gene using an adenovirus vector
def: "A condition in which the mouse angiotensin I converting enzyme 2 (Ace2) gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [RGD:12879447, Webster:Random_House_Kernerman_Websters_College_Dictionary_2010]
synonym: "Ad-Ace2" RELATED []
synonym: "adenoviral transfer of the murine Ace2 gene" EXACT []
synonym: "transfer of recombinant adenovirus containing the murine Ace2 gene" EXACT []
xref: MGI:1917258
xref: RGD:1550521
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: jesmith
creation_date: 2017-08-11T17:15:29Z

[Term]
id: XCO:0000531
name: gene transfer of the enhanced green fluorescent protein gene using an adenovirus vector
def: "A condition in which the enhanced green fluorescent protein (EGFP) gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [RGD:12879447, Webster:Random_House_Kernerman_Websters_College_Dictionary_2010]
synonym: "Ad-EGFP" RELATED []
synonym: "adenoviral transfer of the EGFP gene" EXACT []
synonym: "transfer of recombinant adenovirus containing the EGFP gene" EXACT []
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: jesmith
creation_date: 2017-08-11T17:17:27Z

[Term]
id: XCO:0000532
name: protein synthesis inhibitor
def: "Any condition in which the main influencing factor is a substance which disrupts one or more of the processes that lead directly to the generation of new proteins, that is, that inhibits the process of translation of mRNAs into proteins." [https://en.wikipedia.org/wiki/Protein_synthesis_inhibitor "Wikipedia"]
is_a: XCO:0000120 ! inhibitor
created_by: jesmith
creation_date: 2017-08-11T17:21:03Z

[Term]
id: XCO:0000533
name: puromycin
def: "Condition in which the main influencing factor is puromycin, an aminonucleoside antibiotic derived from the Streptomyces alboniger bacterium, that causes premature chain termination during translation taking place in the ribosome." [https://en.wikipedia.org/wiki/Puromycin "Wikipedia"]
xref: CHEBI:17939
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000482 ! antimicrobial agent
is_a: XCO:0000532 ! protein synthesis inhibitor
created_by: jesmith
creation_date: 2017-08-11T17:21:54Z

[Term]
id: XCO:0000534
name: sunitinib
def: "A condition in which the main influencing factor is sunitinib, an antineoplastic agent which acts as a receptor tyrosine kinase inhibitor and an antagonist for multiple platelet-derived growth factor and vascular endothelial growth factor receptors. Sunitinib is used as a chemotherapy agent in the treatment of renal cell carcinoma and gastrointestinal stromal tumor." [https://en.wikipedia.org/wiki/Sunitinib "Wikipedia"]
synonym: "sunitinibum" RELATED []
synonym: "Sutent" RELATED []
xref: CHEBI:38940
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: jesmith
creation_date: 2017-08-11T17:28:23Z

[Term]
id: XCO:0000535
name: lisinopril
def: "A condition in which the main influencing factor is lisinopril, an antihypertensive competitive inhibitor of angiotensin-converting enzyme (ACE)." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed, ISBN:978-1416049982]
synonym: "Prinivil" RELATED []
synonym: "Qbrelis" RELATED []
synonym: "Zestril" RELATED []
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: jrsmith
creation_date: 2018-05-11T10:54:07Z

[Term]
id: XCO:0000536
name: angiotensin II receptor antagonist
def: "This is any condition in which the main influencing factor is an angiotensin II receptor antagonist, an agent that blocks angiotensin II receptors and is used to treat high blood pressure and heart failure." [https://en.wikipedia.org/wiki/Angiotensin_II_receptor_blocker "Wikipedia"]
synonym: "angiotensin II receptor blocker" EXACT []
synonym: "angiotensin receptor blocker" EXACT []
synonym: "ARB" EXACT []
synonym: "sartan" EXACT []
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0000863 ! antihypertensive agent
created_by: jrsmith
creation_date: 2018-05-14T18:01:31Z

[Term]
id: XCO:0000537
name: olmesartan medoxomil
def: "This is any condition in which the main influencing factor is olmesartan medoxomil, an angiotensin II receptor blocker which is used as an antihypertensive agent." [https://en.wikipedia.org/wiki/Olmesartan "Wikipedia"]
synonym: "CS-866" RELATED []
is_a: XCO:0000536 ! angiotensin II receptor antagonist
created_by: jrsmith
creation_date: 2018-05-14T18:27:28Z

[Term]
id: XCO:0000538
name: temocapril
def: "An experimental condition in which the main influencing factor is temocapril, an angiotensin-I converting enzyme (ACE) inhibitor consisting of a dipeptide prodrug with a thiazepine ring." [https://en.wikipedia.org/wiki/Temocapril "Wikipedia"]
synonym: "Acecol" RELATED []
synonym: "alpha-((2S,6R)-6-((1S)-1-ethoxycarbonyl-3-phenylpropyl)amino-5-oxo-2-(2-thienyl)perhydro-1,4-thiazepin-4-yl)acetic acid.HCl" EXACT []
synonym: "CS-622" RELATED []
synonym: "CS622" RELATED []
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: jrsmith
creation_date: 2018-05-14T18:34:03Z

[Term]
id: XCO:0000539
name: doxorubicin
def: "An experimental condition in which the main influencing factor is doxorubicin, a cytotoxic anthracycline antibiotic isolated from cultures of Streptomyces peucetius var. caesius and used as a chemotherapy medication. Doxorubicin binds to nucleic acids, presumably by specific intercalation of the planar anthracycline nucleus with the DNA double helix." [drugbank:DB00997, https://en.wikipedia.org/wiki/Doxorubicin "Wikipedia"]
synonym: "ADR" EXACT []
synonym: "Adriablastine" EXACT []
synonym: "adriamycin" EXACT []
synonym: "DXR" EXACT []
xref: CHEBI:28748
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000482 ! antimicrobial agent
created_by: jrsmith
creation_date: 2018-05-15T15:54:18Z

[Term]
id: XCO:0000540
name: delapril
def: "An experimental condition in which the main influencing factor is delapril, an antihypertensive prodrug that, when converted to its active metabolites 5-hydroxy delapril diacid and delapril diacid, acts as an angiotensin-converting enzyme (ACE) inhibitor." [https://en.wikipedia.org/wiki/Delapril "Wikipedia"]
xref: CHEBI:135735
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: jrsmith
creation_date: 2018-05-15T15:58:32Z

[Term]
id: XCO:0000541
name: bosentan
def: "An experimental condition in which the main influencing factor is bosentan, a competitive antagonist of endothelin-1 that blocks the binding of endothelin to both the endothelin-A (ET-A) and endothelin-B (ET-B)receptors. Bosentan is used in the treatment of pulmonary arterial hypertension." [https://en.wikipedia.org/wiki/Bosentan "Wikipedia", https://phassociation.org/patients/treatments/bosentan/ "Website"]
synonym: "bosentanum" RELATED []
synonym: "Tracleer" RELATED []
is_a: XCO:0000730 ! endothelin receptor antagonist
created_by: jrsmith
creation_date: 2018-05-15T16:06:25Z

[Term]
id: XCO:0000542
name: enalapril
def: "This is any condition in which the main influencing factor is enalapril, a prodrug that is rapidly metabolized in the liver to enalaprilat, a potent, competitive inhibitor of angiotensin-converting enzyme (ACE)." [https://en.wikipedia.org/wiki/Enalapril "Wikipedia"]
synonym: "Enacard" RELATED []
synonym: "Renitec" RELATED []
synonym: "Vasotec" RELATED []
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: jrsmith
creation_date: 2018-05-15T16:09:53Z

[Term]
id: XCO:0000543
name: vitamin D
def: "This is any condition in which the main influencing factor is one or more closely related forms (vitamers) of vitamin D, a group of fat-soluble vitamins (when ingested from dietary sources) and/or hormones (when produced by the skin in response to ultraviolet radiation). Vitamin D is involved in intestinal absorption of calcium, magnesium and phosphate, and in calcium homeostasis and metabolism." [https://en.wikipedia.org/wiki/Vitamin_D "Wikipedia"]
is_a: XCO:0000377 ! vitamin
created_by: jrsmith
creation_date: 2018-05-15T16:17:43Z

[Term]
id: XCO:0000544
name: vitamin D2
def: "An experimental condition in which the main influencing factor is vitamin D2, a type of vitamin D found in food and used as a dietary supplement. The D2 vitamer has been found to be less efficiently absorbed in the human intestine and/or less biologically active than the D3 vitamer." [https://en.wikipedia.org/wiki/Ergocalciferol "Wikipedia", PMID:22552031]
synonym: "Calcidol" RELATED []
synonym: "calciferol" EXACT []
synonym: "Drisdol" RELATED []
synonym: "ergocalciferol" EXACT []
is_a: XCO:0000543 ! vitamin D
created_by: jrsmith
creation_date: 2018-05-15T16:22:22Z

[Term]
id: XCO:0000545
name: vitamin D3
def: "An experimental condition in which the main influencing factor is vitamin D3, a form of vitamin D which is naturally synthesized in the skin of animals by the action of ultraviolet B (UVB) radiation on 7-dehydrocholesterol. Vitamin D3 is also found in some foods and can be used as a dietary supplement.  The D3 vitamer has been found to be more efficiently absorbed in the human intestine and/or more biologically active than the D2 vitamer." [https://en.wikipedia.org/wiki/Cholecalciferol "Wikipedia", PMID:22552031]
synonym: "cholecalciferol" EXACT []
synonym: "colecalciferol" EXACT []
is_a: XCO:0000543 ! vitamin D
created_by: jrsmith
creation_date: 2018-05-15T16:35:39Z

[Term]
id: XCO:0000546
name: vitamin analog
def: "A condition in which the main influencing factor is a compound with structural and/or functional similarity to a vitamin and can therefore be substituted for the analogous vitamin." [https://en.wikipedia.org/wiki/Analog "Wikipedia"]
synonym: "vitamin analogue" EXACT []
is_a: XCO:0000377 ! vitamin
created_by: jrsmith
creation_date: 2018-05-15T16:41:42Z

[Term]
id: XCO:0000547
name: paricalcitol
def: "An experimental condition in which the main influencing factor is paricalcitol, an analog of vitamin D2 used for the prevention and treatment of secondary hyperparathyroidism." [https://en.wikipedia.org/wiki/Paricalcitol "Wikipedia"]
synonym: "19-nor-1,25-(OH)2-vitamin D2" EXACT []
synonym: "Zemplar" RELATED []
is_a: XCO:0000546 ! vitamin analog
created_by: jrsmith
creation_date: 2018-05-15T16:44:29Z

[Term]
id: XCO:0000548
name: ramipril
def: "An experimental condition in which the main influencing factor is ramipril, a prodrug that is metabolized in the liver to ramiprilat, a potent, competitive inhibitor of angiotensin-converting enzyme (ACE)." [drugbank:DB00178, MESH:D017257]
synonym: "Altace" EXACT []
synonym: "Tritace" EXACT []
xref: CHEBI:8774
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: jrsmith
creation_date: 2018-05-15T16:51:40Z

[Term]
id: XCO:0000549
name: left anterior descending coronary artery occlusion
def: "A surgical manipulation causing blockage of the left anterior descending coronary artery, the artery supplying blood to approximately half of the left ventricle of the heart including the anterolateral myocardium, apex, and interventricular septum." [https://en.wikipedia.org/wiki/Anterior_interventricular_branch_of_left_coronary_artery "Wikipedia"]
synonym: "interventricular artery occlusion" EXACT []
synonym: "LAD blockage" EXACT []
synonym: "LAD occlusion" EXACT []
synonym: "left anterior descending artery occlusion" EXACT []
synonym: "left coronary artery ligation" NARROW []
synonym: "widow maker occlusion" EXACT []
is_a: XCO:0000347 ! blood vessel occlusion
created_by: jrsmith
creation_date: 2018-05-15T16:57:52Z

[Term]
id: XCO:0000550
name: reserpine
def: "An experimental condition in which the main influencing factor is reserpine, an indole alkaloid which irreversibly blocks the vesicular monoamine transporters (VMATs), SLC18A1 and SLC18A2. Reserpine has been used as both an antihypertensive drug and an antipsychotic drug." [drugbank:DB00206, https://en.wikipedia.org/wiki/Reserpine "Wikipedia", PMID:7905859]
synonym: "methyl (3beta,16beta,17alpha,18beta,20alpha)-11,17-dimethoxy-18-[(3,4,5-trimethoxybenzoyl)oxy]yohimban-16-carboxylate" EXACT []
synonym: "Serpasil" EXACT []
xref: CHEBI:28487
xref: MESH:D012110
is_a: XCO:0000120 ! inhibitor
is_a: XCO:0000863 ! antihypertensive agent
created_by: jrsmith
creation_date: 2018-05-15T17:19:06Z

[Term]
id: XCO:0000551
name: hydralazine
def: "An experimental condition in which the main influencing factor is hydralazine, a vasodilator that appears to have multiple, direct effects on smooth muscles of the arterial vessels, thereby reducing systemic vascular resistance and arterial pressure." [drugbank:DB01275, http://cvpharmacology.com/vasodilator/direct "Website"]
is_a: XCO:0000140 ! vasodilator
created_by: jrsmith
creation_date: 2018-05-15T17:22:47Z

[Term]
id: XCO:0000552
name: controlled hydralazine content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of hydralazine in which the amount of hydralazine consumed is maintained at a specified level." [https://www.merriam-webster.com/, MESH:D006830]
xref: CHEBI:5775
xref: PMID:3611778
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000551 ! hydralazine
created_by: jrsmith
creation_date: 2018-05-15T17:24:24Z

[Term]
id: XCO:0000553
name: everolimus
def: "An experimental condition in which the main influencing factor is everolimus, a mammalian target of rapamycin (mTOR) inhibitor which is selective for the mTORC1 protein complex, with little or no effect on mTORC2.  Everolimus is used as an antineoplastic and immunosuppressive agent." [https://en.wikipedia.org/wiki/Everolimus "Wikipedia"]
xref: CHEBI:68478
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: jrsmith
creation_date: 2018-05-31T13:41:07Z

[Term]
id: XCO:0000554
name: controlled phosphorus content diet
def: "A regimen of solid food in which the amount of phosphorus consumed is controlled." []
is_a: XCO:0000014 ! controlled content diet
created_by: sjwang
creation_date: 2018-11-14T15:58:10Z

[Term]
id: XCO:0000555
name: controlled lisinopril content drinking water
def: "A drink made up of water and a specified amount of lisinopril consumed by an organism as part of an experiment." []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000535 ! lisinopril
created_by: sjwang
creation_date: 2018-11-14T16:04:27Z

[Term]
id: XCO:0000556
name: amino monosaccharide
def: "Any amino sugar that is a monosaccharide in which one alcoholic hydroxy group is replaced by an amino group." []
xref: CHEBI:60926
is_a: XCO:0000274 ! monosaccharide
created_by: sjwang
creation_date: 2018-11-16T10:50:55Z

[Term]
id: XCO:0000557
name: glucosamine
def: "Glucosamine, commonly used as a treatment for osteoarthritis, is an amino sugar and a prominent precursor in the biochemical synthesis of glycosylated proteins and lipids. Since glucosamine is a precursor for glycosaminoglycans, and glycosaminoglycans are a major component of joint cartilage, supplemental glucosamine may help to rebuild cartilage and treat arthritis." [drugbank:DB01296]
synonym: "2-amino-2-deoxyglucose" EXACT []
is_a: XCO:0000556 ! amino monosaccharide
created_by: sjwang
creation_date: 2018-11-16T10:55:31Z

[Term]
id: XCO:0000558
name: taxifolin
def: "Taxifolin is a flavanonol and a non-steroidal anti-inflammatory agent." [https://en.wikipedia.org/wiki/Taxifolin]
synonym: "catechin hydrate" EXACT []
synonym: "DHQ" EXACT []
synonym: "dihydroquercetin" EXACT []
synonym: "Distylin" EXACT []
synonym: "Taxifoliol" EXACT []
xref: CHEBI:38747
is_a: XCO:0000470 ! flavonoid
is_a: XCO:0000506 ! non-steroidal anti-inflammatory drug
created_by: sjwang
creation_date: 2018-11-16T11:03:16Z

[Term]
id: XCO:0000559
name: melatonin
def: "A biogenic amine that is found in animals and plants. In mammals, melatonin is a hormone produced by the pineal gland. Its secretion increases in darkness and decreases during exposure to light. Melatonin is implicated in the regulation of sleep, mood, and reproduction. Melatonin is also an effective antioxidant." [https://druginfo.nlm.nih.gov/drugportal/name/melatonin "Drug Information Portal", https://meshb.nlm.nih.gov/record/ui?ui=D008550 "MESH"]
xref: CHEBI:16796
is_a: XCO:0000125 ! hormone
is_a: XCO:0000271 ! antioxidant
created_by: sjwang
creation_date: 2018-11-19T14:33:05Z

[Term]
id: XCO:0000560
name: controlled melatonin content diet
def: "A solid diet in which the amount of melatonin is maintained at a specified level." []
is_a: XCO:0000559 ! melatonin
created_by: sjwang
creation_date: 2018-11-19T14:48:04Z

[Term]
id: XCO:0000561
name: antidepressant
def: "This is any condition in which the main influencing factor is an antidepressant, a mood-stimulating drug used primarily in the treatment of affective disorders and related conditions." [CHEBI:35469]
synonym: "Not4Curation" RELATED []
xref: MESH:D000928
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: sjwang
creation_date: 2018-11-21T09:51:04Z

[Term]
id: XCO:0000562
name: salidroside
def: "This is any condition in which the main influencing factor is salidroside, a glucoside of tyrosol found in the plant Rhodiola rosea. It is thought to be one of the compounds responsible for the antidepressant and anxiolytic actions of this plant." [https://druginfo.nlm.nih.gov/drugportal/name/salidroside "Drug Information Portal"]
synonym: "2-(4-Hydroxyphenyl)ethyl &#946;-D-glucopyranoside" EXACT []
synonym: "rhodioloside" EXACT []
synonym: "rhodosin" EXACT []
synonym: "sallidroside" EXACT []
synonym: "tyrosol glucoside" EXACT []
xref: CHEBI:9009
xref: MESH:C009172
is_a: XCO:0000561 ! antidepressant
is_a: XCO:0001122 ! antianxiety agent
created_by: sjwang
creation_date: 2018-11-21T09:53:27Z

[Term]
id: XCO:0000563
name: Omacor
def: "OMACOR is a prescription medicine for adults called a lipid-regulating medicine. It is a mix of docosahexaenoic acid [DHA] (~ 50%) + eicosapentaenoic acid [EPA] (~40%) ethylesters." [https://www.nlm.nih.gov/medlineplus/ "Medline Plus"]
synonym: "Lovaza" EXACT []
synonym: "Omega-3-Acid Ethyl Esters (eicosapentaenoic acid and docosahexaenoic acid)" EXACT []
synonym: "Omytrg" EXACT []
is_a: XCO:0000511 ! ester
is_a: XCO:0000680 ! antilipemic agent
created_by: sjwang
creation_date: 2018-11-27T13:04:58Z

[Term]
id: XCO:0000564
name: meclofenamate
def: "A member of the anthranilic acid derivatives class of NSAID drug used for joint, muscular pain, arthritis and dysmenorrhea." [https://en.wikipedia.org/wiki/Meclofenamic_acid "Wikipedia"]
is_a: XCO:0000506 ! non-steroidal anti-inflammatory drug
created_by: sjwang
creation_date: 2018-11-27T14:31:01Z

[Term]
id: XCO:0000565
name: ipragliflozin
def: "A pharmaceutical drug for treatment of type 2 diabetes. Ipragliflozin reduces blood glucose levels by inhibiting the reuptake of glucose by selectively inhibiting SGLT2." [https://en.wikipedia.org/wiki/Ipragliflozin "Wikipedia"]
is_a: XCO:0000407 ! hypoglycemic agent
created_by: sjwang
creation_date: 2018-11-30T14:59:25Z

[Term]
id: XCO:0000566
name: controlled ipragliflozin content diet
def: "A solid diet in which the amount of ipragliflozin, an oral antidiabetic drug, is maintained at a specified level." []
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0000565 ! ipragliflozin
created_by: sjwang
creation_date: 2018-11-30T15:02:35Z

[Term]
id: XCO:0000567
name: adrenomedulin
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000228 ! peptide hormone
created_by: sjwang
creation_date: 2018-12-05T14:02:20Z

[Term]
id: XCO:0000568
name: hydralazine hydrochloride
def: "A vasodilator and an antioxidant. It relaxes arteries and inhibits membrane-bound enzymes that form reactive oxygen species, such as superoxides." []
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000551 ! hydralazine
created_by: sjwang
creation_date: 2018-12-05T14:06:11Z

[Term]
id: XCO:0000569
name: controlled hydralazine hydrochloride content drinking water
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000568 ! hydralazine hydrochloride
created_by: sjwang
creation_date: 2018-12-05T14:21:28Z

[Term]
id: XCO:0000570
name: tolvaptan
def: "A selective and competitive arginine vasopressin receptor 2 antagonist." []
is_a: XCO:0000160 ! receptor antagonist
created_by: sjwang
creation_date: 2018-12-05T14:25:32Z

[Term]
id: XCO:0000571
name: controlled tolvaptan content diet
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0000570 ! tolvaptan
created_by: sjwang
creation_date: 2018-12-05T14:27:59Z

[Term]
id: XCO:0000572
name: vancomycin
def: "This is any condition in which the main influencing factor is vancomycin, a complex glycopeptide from Streptomyces orientalis. Vancomycin inhibits a specific step in the synthesis of the peptidoglycan layer in the Gram-positive bacteria Staphylococcus aureus and Clostridium difficile." [CHEBI:28001]
xref: MESH:D014640
is_a: XCO:0000483 ! antibacterial agent
created_by: sjwang
creation_date: 2018-12-05T14:37:41Z

[Term]
id: XCO:0000573
name: null
is_obsolete: true
created_by: sjwang
creation_date: 2018-12-05T14:41:59Z

[Term]
id: XCO:0000574
name: controlled vancomycin content drinking water
is_a: XCO:0000163 ! controlled content drinking water
is_a: XCO:0000572 ! vancomycin
created_by: sjwang
creation_date: 2018-12-05T14:42:50Z

[Term]
id: XCO:0000575
name: meropenem
def: "Meropenem is a broad-spectrum antibiotic used to treat a variety of bacterial infections." [https://en.wikipedia.org/wiki/Meropenem "Wikipedia"]
synonym: "3-(5-Dimethylcarbamoylpyrrolidin-3-ylthio)-6-(1-hydroxyethyl)-4-methyl-7-oxo-1-azabicyclo(3.2.0)hept-2-ene-2-carboxylic acid" EXACT []
synonym: "Merrem" EXACT []
synonym: "Merrem Novaplus" EXACT []
synonym: "Penem" EXACT []
synonym: "Ronem" EXACT []
synonym: "SM 7338" EXACT []
xref: CHEBI:43968
xref: MESH:D000077731
is_a: XCO:0000483 ! antibacterial agent
created_by: sjwang
creation_date: 2018-12-05T15:07:54Z

[Term]
id: XCO:0000576
name: controlled meropenem content drinking water
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000575 ! meropenem
created_by: sjwang
creation_date: 2018-12-05T15:12:42Z

[Term]
id: XCO:0000577
name: proton pump inhibitor
def: "Proton pump inhibitors (PPIs) reduce the production of acid by blocking H+/K+ ATPase in the wall of the stomach." []
synonym: "Synonym: PPI" EXACT []
is_a: XCO:0000523 ! enzyme inhibitor
created_by: sjwang
creation_date: 2018-12-05T15:17:00Z

[Term]
id: XCO:0000578
name: omeprazole
def: "This is any condition in which the main influencing factor is omeprazole, a highly effective inhibitor of gastric acid secretion used in the therapy of stomach ulcers and Zollinger-Ellison syndrome." [MESH:D009853]
synonym: "OME" EXACT []
synonym: "rac-5-methoxy-2-{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl}-1H-benzimidazole" EXACT []
xref: CHEBI:7772
xref: CID:4594
is_a: XCO:0000577 ! proton pump inhibitor
created_by: sjwang
creation_date: 2018-12-05T15:19:50Z

[Term]
id: XCO:0000579
name: controlled in situ gastrointestinal condition
def: "Any experimental condition in which the internal or external environment of the gastrointestinal system is altered." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
is_a: XCO:0000166 ! controlled in situ organ condition
created_by: sjwang
creation_date: 2018-12-05T15:24:01Z

[Term]
id: XCO:0000580
name: forced feeding
def: "This is any condition in which the main influencing factor is the administration of food or drug by force, especially to a laboratory animal, typically through a tube leading down the throat to the stomach." []
synonym: "gavage" EXACT []
is_a: XCO:0000013 ! diet
created_by: sjwang
creation_date: 2018-12-05T15:43:29Z

[Term]
id: XCO:0000581
name: oral gavage
alt_id: XCO:0000582
alt_id: XCO:0000583
alt_id: XCO:0000584
def: "This is any condition in which the main influencing factor is the introduction of material, food, or drug into the stomach by a tube via the oral cavity." []
synonym: "controlled cecal material content oral gavage" NARROW []
synonym: "controlled content oral gavage" EXACT []
synonym: "controlled omeprazole content  oral gavage" NARROW []
is_a: XCO:0000580 ! forced feeding
created_by: sjwang
creation_date: 2018-12-05T15:45:21Z

[Term]
id: XCO:0000582
name: controlled content oral gavage
def: "Oral gavage in which the amount of one or more solutes are adjusted to a requirement." []
is_obsolete: true
created_by: sjwang
creation_date: 2018-12-05T15:49:29Z

[Term]
id: XCO:0000583
name: controlled omeprazole content  oral gavage
def: "An oral gavage solution made up of solvent and a specified amount of omeprazole." []
is_obsolete: true
created_by: sjwang
creation_date: 2018-12-05T15:51:33Z

[Term]
id: XCO:0000584
name: controlled cecal material content oral gavage
def: "An oral gavage delivery made up of a specified amount of harvested cecal material." []
is_obsolete: true
created_by: sjwang
creation_date: 2018-12-05T15:55:37Z

[Term]
id: XCO:0000585
name: scrambled control oligodeoxynucleotide
def: "A control oligodeoxynucleotide with a non-specific scrambled sequence." []
synonym: "scrambled control ODN" RELATED []
synonym: "SCR ODN" RELATED []
is_a: XCO:0000234 ! deoxyribonucleic acid
created_by: sjwang
creation_date: 2018-12-06T15:58:27Z

[Term]
id: XCO:0000586
name: Gnai2 antisense oligonucleotide
synonym: "G&#945;i2 ODN" RELATED []
synonym: "G&#945;i2 oligodeoxynucleotide" RELATED []
synonym: "Gnai2 antisense oligodeoxynucleotide" RELATED []
synonym: "Gnai2 AS-ODN" RELATED []
synonym: "Gnai2 ODN" EXACT []
is_a: XCO:0000234 ! deoxyribonucleic acid
created_by: sjwang
creation_date: 2018-12-06T16:40:39Z

[Term]
id: XCO:0000587
name: intracerebroventricular cannula implantation
def: "Stereotaxic implant with a stainless steel cannula into a cerebral ventricle, which can be connected via silastic tubing to a miniosmotic pump for chronic infusion." [PMID:25312437]
synonym: "i.c.v. cannula implantation" RELATED []
is_a: XCO:0000027 ! surgical implantation
created_by: sjwang
creation_date: 2018-12-06T16:45:37Z

[Term]
id: XCO:0000588
name: perindopril
def: "Perindopril is a nonsulfhydryl prodrug that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications. It is rapidly metabolized in the liver to perindoprilat, a potent, competitive inhibitor of ACE." [drugbank:DB00790]
synonym: "Aceon" EXACT []
synonym: "Coversum" EXACT []
synonym: "Coversyl" EXACT []
synonym: "ethyl N-{(2S)-1-[(2S,3aS,7aS)-2-carboxyoctahydro-1H-indol-1-yl]-1-oxopropan-2-yl}-L-norvalinate" EXACT []
xref: CHEBI:8024
xref: MESH:D020913
xref: PMID:12376396
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: sjwang
creation_date: 2018-12-07T15:47:47Z

[Term]
id: XCO:0000589
name: Moexipril
def: "A condition in which the main influencing factor is Moexipril, a non-sulfhydryl-containing precursor of the active angiotensin-converting enzyme (ACE) inhibitor Moexiprilat and a vasodilatory antihypertensive drug." []
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: sjwang
creation_date: 2018-12-07T16:00:47Z

[Term]
id: XCO:0000590
name: icatibant
def: "A synthetic decapeptide that is a bradykinin receptor antagonist used for the treatment of hereditary angioedema." []
is_a: XCO:0000160 ! receptor antagonist
created_by: sjwang
creation_date: 2018-12-07T16:19:30Z

[Term]
id: XCO:0000591
name: quinapril
def: "A prodrug that is metabolized to quinaprilat (quinapril diacid), a competitive inhibitor of angiotensin-converting enzyme (ACE)." []
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: sjwang
creation_date: 2018-12-07T16:22:09Z

[Term]
id: XCO:0000592
name: cilazapril
def: "A prodrug that is hydrolyzed to its main metabolite cilazaprilat, an inhibitor of angiotensin-converting enzyme (ACE)." []
synonym: "Dynorm" EXACT []
synonym: "Inhibace" EXACT []
synonym: "Vascace" EXACT []
is_a: XCO:0000524 ! angiotensin converting enzyme inhibitor
created_by: sjwang
creation_date: 2018-12-20T15:23:56Z

[Term]
id: XCO:0000593
name: puromycin aminonucleoside
def: "The aminonucleoside portion of the antibiotic puromycin. NOTE: This molecule does not induce apoptosis and does not inhibit protein synthesis." []
synonym: "3'-Amino-3'-deoxy-N6,N6-dimethyladenosine" EXACT []
is_a: XCO:0000392 ! nucleoside/nucleotide
created_by: sjwang
creation_date: 2018-12-27T10:28:04Z

[Term]
id: XCO:0000594
name: saralasin
def: "This is any condition in which the main influencing factor is saralasin, a competitive angiotensin II receptor antagonist with partial agonistic activity previously used to distinguish renovascular hypertension from essential hypertension." [https://en.wikipedia.org/wiki/Saralasin]
synonym: "Sar-Arg-Val-Tyr-Val-His-Pro-Ala" EXACT []
xref: CHEBI:135894
xref: CID:6324663
is_a: XCO:0000536 ! angiotensin II receptor antagonist
created_by: sjwang
creation_date: 2018-12-27T13:23:15Z

[Term]
id: XCO:0000595
name: surgical manipulation of blood vessels
is_a: XCO:0000165 ! surgical manipulation
created_by: sjwang
creation_date: 2018-12-27T14:59:42Z

[Term]
id: XCO:0000596
name: blood vessel constriction
def: "This is any condition in which the main influencing factor is surgical narrowing of the lumen of a blood vessel. This lumen narrowing could be accomplished by circumferential suturing, use of a manipulatable sleeve, or some other method." []
is_a: XCO:0000595 ! surgical manipulation of blood vessels
created_by: sjwang
creation_date: 2018-12-27T15:05:18Z

[Term]
id: XCO:0000597
name: abdominal aorta constriction
def: "This is any condition in which the main influencing factor is surgical narrowing of the lumen of the abdominal aorta. The abdominal aorta consists of the suprarenal abdominal aorta and the infrarenal aorta." [PMID:28060255]
synonym: "AAC" EXACT []
synonym: "abdominal aortic constriction" EXACT []
is_a: XCO:0000596 ! blood vessel constriction
created_by: sjwang
creation_date: 2018-12-27T15:08:06Z

[Term]
id: XCO:0000598
name: thoracic aorta constriction
def: "This is any condition in which the main influencing factor is surgical narrowing of the lumen of the thoracic aorta. The thoracic aorta consists of the ascending aorta, the aortic arch, and the descending thoracic aorta." [https://en.wikipedia.org/wiki/Aorta]
synonym: "TAC" NARROW []
synonym: "thoracic aortic constriction" EXACT []
synonym: "transverse aortic constriction" NARROW []
is_a: XCO:0000596 ! blood vessel constriction
created_by: sjwang
creation_date: 2018-12-27T15:10:16Z

[Term]
id: XCO:0000599
name: aldosterone
def: "A pregnane-based steroidal hormone produced by the outer-section (zona glomerulosa) of the adrenal cortex in the adrenal gland, and acts on the distal tubules and collecting ducts of the kidney to cause the conservation of sodium, secretion of potassium, increased water retention, and increased blood pressure." [CHEBI:27584]
synonym: "11beta,21-dihydroxy-3,20-dioxopregn-4-en-18-al" EXACT []
xref: MESH:D000450
xref: PMID:8770880
is_a: XCO:0000229 ! steroid hormone
created_by: sjwang
creation_date: 2018-12-27T15:39:58Z

[Term]
id: XCO:0000600
name: 2,3,7,8-tetrachlorodibenzo-p-dioxin
def: "This is any condition in which the main influencing factor is 2,3,7,8-tetrachlorodibenzo-p-dioxin, a polychlorinated dibenzo-p-dioxin that activates the aryl hydrocarbon (AH) receptor, a transcription factor." [https://en.wikipedia.org/wiki/2\,3\,7\,8-Tetrachlorodibenzodioxin]
synonym: "2,3,7,8-Tetrachlorodibenzo[b,e][1,4]dioxine" EXACT []
synonym: "2,3,7,8-tetrachlorooxanthrene" EXACT []
synonym: "TCDD" EXACT []
synonym: "tetrachlorodibenzodioxin" EXACT []
synonym: "tetrachlorodibenzo-p-dioxin" EXACT []
synonym: "tetradioxin" EXACT []
xref: CHEBI:28119
xref: CID:15625
is_a: XCO:0000135 ! receptor agonist
created_by: sjwang
creation_date: 2019-01-21T12:54:07Z

[Term]
id: XCO:0000601
name: gene transfer of the rat natriuretic peptide B gene using an adenovirus vector
def: "A condition in which the rat natriuretic peptide B gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." []
synonym: "gene transfer of adenovirus-NPPB" EXACT []
synonym: "gene transfer of the rat BNP gene using an adenovirus vector" EXACT []
synonym: "gene transfer of the rat Nppb gene using an adenovirus vector" EXACT []
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: sjwang
creation_date: 2019-01-22T13:43:52Z

[Term]
id: XCO:0000602
name: rosiglitazone
def: "A peroxisome proliferator-activated receptor gamma agonist; reduces lipid availability, improves insulin action & glucoregulation" [https://druginfo.nlm.nih.gov/drugportal/name/rosiglitazone "Drug Information Portal"]
xref: CHEBI:50122
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0000407 ! hypoglycemic agent
created_by: sjwang
creation_date: 2019-01-22T13:55:58Z

[Term]
id: XCO:0000603
name: hesperetin
def: "Hesperetin belongs to the flavanone class of flavonoids. Hesperetin, in the form of its glycoside Hesperidin, is the predominant flavonoid in lemons and oranges." [drugbank:DB01094]
xref: CHEBI:28230
xref: MESH:C013015
is_a: XCO:0000470 ! flavonoid
created_by: sjwang
creation_date: 2019-01-22T14:38:41Z

[Term]
id: XCO:0000604
name: Aprotinin
def: "Any condition in which the main influencing factor is Aprotinin, also known as bovine pancreatic trypsin inhibitor (BPTI), a proteinase inhibitor used as medication administered by injection to reduce bleeding during complex surgery, such as heart and liver surgery." [drugbank:DB06692]
synonym: "C284H432N84O79S7" EXACT []
synonym: "Trasylol" EXACT []
is_a: XCO:0000748 ! protease inhibitor
created_by: sjwang
creation_date: 2019-02-15T16:27:32Z

[Term]
id: XCO:0000605
name: aflatoxin B1
def: "An aflatoxin having a tetrahydrocyclopenta[c]furo[3',2':4,5]furo[2,3-h]chromene skeleton with oxygen functionality at positions 1, 4 and 11." [CHEBI:2504]
is_a: XCO:0000240 ! toxin
created_by: sjwang
creation_date: 2019-02-26T11:26:05Z

[Term]
id: XCO:0000606
name: AMG-8718
def: "AMG-8718 is the inhibitor of &#946;-site amyloid precursor protein cleaving enzyme (BACE1)." [PMID:25363711]
is_a: XCO:0000523 ! enzyme inhibitor
created_by: sjwang
creation_date: 2019-03-18T16:27:59Z

[Term]
id: XCO:0000607
name: acetic acid
def: "This is any condition in which the main influencing factor is acetic acid, the product of the oxidation of ethanol and of the destructive distillation of wood. Acetic acid is used locally, occasionally internally, as a counterirritant and also as a reagent." [CHEBI:15366, Stedman:Stedmans_Medical_Dictionary_26th_ed]
synonym: "ethanoic acid" EXACT []
synonym: "ethylic acid" EXACT []
synonym: "methane carboxylic acid" EXACT []
synonym: "vinegar acid" EXACT []
xref: MESH:D019342
is_a: XCO:0000342 ! chemical with specified structure
created_by: sjwang
creation_date: 2019-03-19T17:06:26Z

[Term]
id: XCO:0000608
name: Allyl isothiocyanate
def: "An isothiocyanate with the formula CH2=CHCH2N=C=S. A colorless oil with boiling point 152degreeC, it is responsible for the pungent taste of mustard, horseradish, and wasabi." [CHEBI:73224]
synonym: "MO" RELATED []
synonym: "mustard oil" RELATED []
xref: CHEBI:73224
xref: pubchem.compound:5971
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000482 ! antimicrobial agent
created_by: sjwang
creation_date: 2019-03-27T15:27:46Z

[Term]
id: XCO:0000609
name: 4-methyl-2-(piperidin-1-yl)-quinoline
def: "A potent and selective blocker of TRPC4 channels." [PMID:24388923]
synonym: "4-methyl-2-(piperidin-1-yl)quinoline" EXACT []
synonym: "4-methyl-2-piperidin-1-ylquinoline" EXACT []
synonym: "ML-204" EXACT []
synonym: "ML204" EXACT []
xref: CID:230710
is_a: XCO:0000269 ! calcium channel inhibitor
created_by: sjwang
creation_date: 2019-03-27T15:43:10Z

[Term]
id: XCO:0000610
name: morphine
def: "This is any condition in which the main influencing factor is morphine, the main alkaloid of opium that is a highly potent opiate analgesic psychoactive drug. Morphine acts directly on the central nervous system (CNS) to relieve pain but has a high potential for addiction, with tolerance and both physical and psychological dependence developing rapidly. Morphine is the most abundant opiate found in Papaver somniferum (the opium poppy)." [CHEBI:17303, CID:5288826]
xref: CHEBI:17303
xref: MESH:D009020
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0001329 ! opioid analgesic
created_by: sjwang
creation_date: 2019-03-27T15:52:55Z

[Term]
id: XCO:0000611
name: nifedipine
def: "This is any condition in which the main influencing factor is nifedipine, a potent vasodilator agent with calcium antagonistic action. It is a useful anti-anginal agent that also lowers blood pressure." [MESH:D009543]
synonym: "dimethyl 2,6-dimethyl-4-(2-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate" EXACT []
xref: CHEBI:7565
xref: CID:4485
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000269 ! calcium channel inhibitor
created_by: sjwang
creation_date: 2019-04-22T16:41:50Z

[Term]
id: XCO:0000612
name: endothelin-1
def: "This is any condition in which the main influencing factor is endothelin-1, a 21-amino acid peptide produced in a variety of tissues including endothelial and vascular smooth-muscle cells, neurons and astrocytes in the central nervous system, and endometrial cells. It acts as a modulator of vasomotor tone, cell proliferation, and hormone production." [PMID:7609754]
synonym: "Edn1" EXACT []
synonym: "ET-1" EXACT []
synonym: "Et1" EXACT []
xref: CHEBI:80240
xref: CID:16212950
xref: PMID:12070093
is_a: XCO:0000783 ! cytokine
created_by: sjwang
creation_date: 2019-05-08T14:50:29Z

[Term]
id: XCO:0000613
name: Adenosine triphosphate
def: "Adenosine Triphosphate (ATP) is an adenine nucleotide comprised of three phosphate groups esterified to the sugar moiety, found in all living cells. Adenosine triphosphate is involved in energy production for metabolic processes and RNA synthesis. In addition, this substance acts as a neurotransmitter. In cancer studies, adenosine triphosphate is synthesized to examine its use to decrease weight loss and improve muscle strength." [https://ncit.nci.nih.gov/ncitbrowser/ "NIH Thesaurus"]
xref: CHEBI:15422
xref: pubchem.compound:5957
is_a: XCO:0000392 ! nucleoside/nucleotide
created_by: sjwang
creation_date: 2019-05-08T15:10:50Z

[Term]
id: XCO:0000614
name: rolipram
def: "A phosphodiesterase 4 inhibitor with antidepressant properties." [https://www.ncbi.nlm.nih.gov/mesh/68020889 "MESH"]
xref: CHEBI:104872
is_a: XCO:0000523 ! enzyme inhibitor
created_by: sjwang
creation_date: 2019-05-22T13:50:17Z

[Term]
id: XCO:0000615
name: embolism injection of middle cerebral artery
def: "This is a condition in which the main influencing factor is an injection of a coagulated blood clot to the middle cerebral artery to induce an embolic stroke in an experimental subject." []
is_a: XCO:0000347 ! blood vessel occlusion
created_by: sjwang
creation_date: 2019-05-22T14:06:17Z

[Term]
id: XCO:0000616
name: verapamil
def: "Verapamil is a calcium channel blocker that is a class IV anti-arrhythmia agent." [https://www.ncbi.nlm.nih.gov/mesh?Db=mesh&Cmd=DetailsSearch&Term=%22Verapamil%22%5BMeSH+Terms%5D "MESH"]
xref: CHEBI:9948
xref: pubchem.compound:2520
is_a: XCO:0000269 ! calcium channel inhibitor
created_by: sjwang
creation_date: 2019-05-23T14:15:07Z

[Term]
id: XCO:0000617
name: quinidine
def: "This is any condition in which the main influencing factor is quinidine, a stereoisomer of quinine which dampens the excitability of cardiac and skeletal muscles by blocking voltage-gated sodium channels and potassium channels. Quinidine prolongs action potentials, blocks muscarinic and alpha-adrenergic neurotransmission, and inhibits multiple enzymes." [MESH:68011802 "MESH"]
synonym: "(9S)-6'-methoxycinchonan-9-ol" EXACT []
synonym: "alpha-(6-Methoxy-4-quinolyl)-5-vinyl-2-quinuclidinemethanol" EXACT []
xref: CHEBI:28593
xref: CID:441074
xref: MESH:68011802
is_a: XCO:0000225 ! potassium channel inhibitor
is_a: XCO:0000336 ! adrenergic antagonist
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000618 ! sodium channel inhibitor
is_a: XCO:0000630 ! cholinergic antagonist
created_by: sjwang
creation_date: 2019-05-23T14:24:09Z

[Term]
id: XCO:0000618
name: sodium channel inhibitor
def: "A class of drugs that act by inhibition of sodium influx through cell membranes. Blockade of sodium channels slows the rate and amplitude of initial rapid depolarization, reduces cell excitability, and reduces conduction velocity." [drugbank.category:DBCAT000600]
synonym: "Sodium Channel Blockers" EXACT []
is_a: XCO:0000222 ! cation channel inhibitor
created_by: sjwang
creation_date: 2019-05-23T14:37:49Z

[Term]
id: XCO:0000619
name: digoxin
def: "A cardenolide glycoside that is digitoxin &#946;-hydroxylated at C-12. A cardiac glycoside extracted from the foxglove plant, Digitalis lanata, it is used to control ventricular rate in atrial fibrillation and in the management of congestive heart failure with atrial fibrillation, but the margin between toxic and therapeutic doses is small." []
xref: CHEBI:4551
xref: pubchem.compound:2724385
is_a: XCO:0000139 ! vasoactive chemical
created_by: sjwang
creation_date: 2019-05-23T14:45:00Z

[Term]
id: XCO:0000620
name: vinblastine
def: "Vinblastine is a natural alkaloid isolated from the plant Vinca rosea Linn. Vinblastine binds to tubulin and inhibits microtubule formation, resulting in disruption of mitotic spindle assembly and arrest of tumor cells in the M phase of the cell cycle. This agent may also interfere with amino acid, cyclic AMP, and glutathione metabolism; calmodulin-dependent Ca++ -transport ATPase activity; cellular respiration; and nucleic acid and lipid biosynthesis." [https://ncit-stage.nci.nih.gov/ncitbrowser/ConceptReport.jsp?dictionary=NCI_Thesaurus&code=C930&ns=ncit "NCI Thesaurus"]
xref: CHEBI:1322
xref: pubchem.compound:13342
is_a: XCO:0000435 ! antineoplastic agent
created_by: sjwang
creation_date: 2019-05-23T15:08:50Z

[Term]
id: XCO:0000621
name: tritiated verapamil
def: "Verapamil hydrochloride, tritiated on the N-methyl group. Verapamil acts as a calcium channel blocker" []
synonym: "[Nmethyl- 3H]verapamil hydrochloride" EXACT []
is_a: XCO:0000171 ! radioactively labeled chemical
is_a: XCO:0000616 ! verapamil
created_by: sjwang
creation_date: 2019-05-23T15:20:09Z

[Term]
id: XCO:0000622
name: tritiated quinidine
synonym: "p-3H]quinidine" EXACT []
is_a: XCO:0000171 ! radioactively labeled chemical
is_a: XCO:0000617 ! quinidine
created_by: sjwang
creation_date: 2019-05-23T15:28:31Z

[Term]
id: XCO:0000623
name: tritiated digoxin
synonym: "Digoxin, [3H(G)]-" EXACT []
is_a: XCO:0000171 ! radioactively labeled chemical
is_a: XCO:0000619 ! digoxin
created_by: sjwang
creation_date: 2019-05-23T15:34:38Z

[Term]
id: XCO:0000624
name: thiobutabarbital
def: "A short-acting barbiturate derivative invented in the 1950s. It has sedative, anticonvulsant and hypnotic effects, and is still used in veterinary medicine for induction in surgical anaesthesia." [https://en.wikipedia.org/wiki/Thiobutabarbital "Wikipedia"]
synonym: "Brevinarcon" RELATED []
synonym: "Inactin" RELATED []
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000950 ! anticonvulsant
created_by: sjwang
creation_date: 2019-07-17T10:08:35Z

[Term]
id: XCO:0000625
name: urethane
def: "Antineoplastic agent that is also used as a veterinary anesthetic." []
xref: CHEBI:17967
xref: MESH:D014520
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000435 ! antineoplastic agent
created_by: sjwang
creation_date: 2019-07-17T10:12:04Z

[Term]
id: XCO:0000626
name: removal of maxillary molar crown
def: "Surgical removal of a maxillary molar crown at the gingival line." []
is_a: XCO:0000026 ! surgical removal
created_by: sjwang
creation_date: 2019-07-17T10:22:31Z

[Term]
id: XCO:0000627
name: spironolactone
def: "Any condition in which the main influencing factor is spironolactone, a potassium-sparing diuretic that competitively inhibits mineralocorticoid receptors in the distal convoluted tubule to promote sodium and water excretion and potassium retention. Spironolactone is indicated to treat a number of conditions including heart failure, edema, hyperaldosteronism, adrenal hyperplasia, hypertension, and nephrotic syndrome." [drugbank:DB00421]
synonym: "7alpha-(acetylsulfanyl)-3-oxo-17alpha-pregn-4-ene-21,17-carbolactone" EXACT []
xref: CHEBI:9241
xref: MESH:D013148
is_a: XCO:0000122 ! diuretic
is_a: XCO:0000838 ! mineralocorticoid receptor antagonist
created_by: sjwang
creation_date: 2019-07-24T14:33:14Z

[Term]
id: XCO:0000628
name: atorvastatin
def: "Atorvastatin (Lipitor) is a member of the drug class known as statins. It is used for lowering cholesterol. Atorvastatin is a competitive inhibitor of hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase, the rate-determining enzyme in cholesterol biosynthesis via the mevalonate pathway. HMG-CoA reductase catalyzes the conversion of HMG-CoA to mevalonate. Atorvastatin acts primarily in the liver. Decreased hepatic cholesterol levels increases hepatic uptake of cholesterol and reduces plasma cholesterol levels." [https://en.wikipedia.org/wiki/Atorvastatin]
synonym: "(3R,5R)-7-[3-(anilinocarbonyl)-5-(4-fluorophenyl)-4-phenyl-2-(propan-2-yl)-1H-pyrrol-1-yl]-3,5-dihydroxyheptanoic acid" EXACT []
synonym: "Lipitor" EXACT []
xref: CHEBI:39548
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000680 ! antilipemic agent
created_by: sjwang
creation_date: 2019-07-24T15:29:21Z

[Term]
id: XCO:0000629
name: carbenoxolone
def: "An agent derived from licorice root. It is used for the treatment of digestive tract ulcers, especially in the stomach. Antidiuretic side effects are frequent, but otherwise the drug is low in toxicity." []
xref: MESH:D002229
xref: pubchem.compound:636403
is_a: XCO:0000279 ! terpene
created_by: sjwang
creation_date: 2019-07-24T16:11:51Z

[Term]
id: XCO:0000630
name: cholinergic antagonist
def: "Agents that bind to cholinoceptors (muscarinic or nicotinic) and prevent the effects of acetylcholine (ACh) and other cholinergic agonists." []
is_a: XCO:0000160 ! receptor antagonist
created_by: sjwang
creation_date: 2019-07-30T14:47:58Z

[Term]
id: XCO:0000631
name: atropine
def: "A naturally occurring belladonna alkaloid, is a racemic mixture of equal parts of d- and l-hyoscyamine, whose activity is due almost entirely to the levo isomer of the drug. Atropine is commonly classified as an anticholinergic or antiparasympathetic (parasympatholytic) drug. More precisely, however, it is termed an antimuscarinic agent since it antagonizes the muscarine-like actions of acetylcholine and other choline esters." [drugbank:DB00572]
xref: CHEBI:16684
is_a: XCO:0000630 ! cholinergic antagonist
created_by: sjwang
creation_date: 2019-07-30T14:53:02Z

[Term]
id: XCO:0000632
name: saxagliptin
def: "A monocarboxylic acid amide obtained by formal condensation of the carboxy group of (2S)-amino(3-hydroxyadamantan-1-yl)acetic acid with the amino group of (1S,3S,5S)-2-azabicyclo[3.1.0]hexane-3-carbonitrile. Used in its monohydrate form for the treatment of Type II diabetes. It belongs to the biological class EC 3.4.14.5 (dipeptidyl-peptidase IV) inhibitor ." [CHEBI:71272]
synonym: "3-hydroxyadamantylglycine-4,5-methanoprolinenitrile hydrate" EXACT []
synonym: "BMS 477118" EXACT []
synonym: "Onglyza" EXACT []
xref: CHEBI:71272
xref: MESH:C502994
is_a: XCO:0000407 ! hypoglycemic agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: sjwang
creation_date: 2019-07-30T14:58:42Z

[Term]
id: XCO:0000633
name: hydrocortisone
def: "Cortisol is a steroid hormone, in the glucocorticoid class of hormones. When used as a medication, it is known as hydrocortisone. It is produced in many animals mainly by the zona fasciculata of the adrenal cortex within the adrenal gland." [https://en.wikipedia.org/wiki/Cortisol "wikipedia"]
synonym: "cortisol" RELATED []
is_a: XCO:0000229 ! steroid hormone
created_by: sjwang
creation_date: 2019-07-30T16:03:10Z

[Term]
id: XCO:0000634
name: antidiuretic
def: "This is a condition in which the main influencing factor is an antidiuretic, a substance that helps to control fluid balance in an animal's body by reducing urination, opposing diuresis. Its effects are opposite that of a diuretic." []
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: sjwang
creation_date: 2019-07-30T16:16:56Z

[Term]
id: XCO:0000635
name: polyfructosan
def: "A naturally occurring sugar polymer that acts as an energy storage molecule in plants. It is an inulin analogue and highly soluble in water ." [https://en.wikipedia.org/wiki/Sinistrin "Wikipedia"]
synonym: "Inutest" EXACT []
synonym: "Polyfructosan-S" EXACT []
synonym: "Sinistrin" EXACT []
is_a: XCO:0000174 ! inulin
created_by: sjwang
creation_date: 2019-07-30T16:18:43Z

[Term]
id: XCO:0000636
name: immunosuppressive agent
def: "This is any condition in which the main influencing factor is an agent that suppresses immune function by one of several mechanisms of action. Classical cytotoxic immunosuppressants act by inhibiting DNA synthesis. Others may act through activation of T-cells or by inhibiting the activation of helper cells. In addition, an immunosuppressive agent is a role played by a compound which is exhibited by a capability to diminish the extent and/or voracity of an immune response." [CHEBI:35705]
xref: CHEBI:35705
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: sjwang
creation_date: 2019-08-01T12:47:37Z

[Term]
id: XCO:0000637
name: cyclosporine A
def: "A cyclic nonribosomal peptide of eleven amino acids; an immunosuppressant drug widely used in post-allogeneic organ transplant to reduce the activity of the patient's immune system, and therefore the risk of organ rejection. Also causes reversible inhibition of immunocompetent lymphocytes in the G0- and G1-phase of the cell cycle." [CHEBI:4031]
synonym: "cyclosporine" RELATED []
xref: CHEBI:4031
is_a: XCO:0000636 ! immunosuppressive agent
created_by: sjwang
creation_date: 2019-08-01T12:50:36Z

[Term]
id: XCO:0000638
name: Capsazepine
def: "A benzazepine that is 2,3,4,5-tetrahydro-1H-2-benzazepine which is substituted by hydroxy groups at positions 7 and 8 and on the nitrogen atom by a 2-(p-chlorophenyl)ethylaminothiocarbonyl group. A synthetic analogue of capsaicin, it was the first reported capsaicin receptor antagonist." [CHEBI:70773]
xref: CHEBI:70773
is_a: XCO:0000160 ! receptor antagonist
created_by: sjwang
creation_date: 2019-08-01T12:59:35Z

[Term]
id: XCO:0000639
name: V1-Cal
def: "Peptides developed according to the calcineurin A-interacting site on the C-terminus of Trpv1 was were synthesized as 1 polypeptide with transactivator of transcription (TAT)47&#8208;57 carrier in the following order: N&#8208;terminus–TAT47&#8208;57–spacer (Gly&#8208;Gly)–cargo–C terminus." [PMID:27671317]
is_a: XCO:0000193 ! peptide/protein
created_by: sjwang
creation_date: 2019-08-01T14:16:00Z

[Term]
id: XCO:0000640
name: controlled in situ myocardial condition
def: "Any experimental condition in which the internal or external environment of the myocardial system is altered." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
is_a: XCO:0000166 ! controlled in situ organ condition
created_by: sjwang
creation_date: 2019-08-01T14:40:57Z

[Term]
id: XCO:0000641
name: myocardial reperfusion
def: "This is any condition in which the main influencing factor is myocardial reperfusion, any situation in which the flow of blood to the heart is restored after a period of blood vessel occlusion occurring experimentally." [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "myocardial ischemia/reperfusion" EXACT []
synonym: "myocardial ischemia-reperfusion" EXACT []
synonym: "myocardium ischemia/reperfusion" EXACT []
synonym: "myocardium ischemia-reperfusion" EXACT []
xref: PMID:26448786
xref: PMID:27671317
is_a: XCO:0000640 ! controlled in situ myocardial condition
created_by: sjwang
creation_date: 2019-08-01T14:50:02Z

[Term]
id: XCO:0000642
name: monocrotaline
def: "Monocrotaline is a pyrrolizidine alkaloid and a toxic plant constituent that poisons livestock and humans through the ingestion of contaminated grains and other foods. The alkaloid causes pulmonary artery hypertension, right ventricular hypertrophy, and pathological changes in the pulmonary vasculature. Significant attenuation of the cardiopulmonary changes are noted after oral magnesium treatment." [https://www.ncbi.nlm.nih.gov/mesh/68016686 "MESH"]
synonym: "crotaline" EXACT []
synonym: "MCT" EXACT []
xref: CHEBI:6980
xref: CID:9415
xref: MESH:D016686
is_a: XCO:0000239 ! toxic substance
created_by: sjwang
creation_date: 2019-08-01T17:00:38Z

[Term]
id: XCO:0000643
name: controlled exposure to a foster mother of a different strain within the same species.
is_a: XCO:0000491 ! controlled exposure to an organism of the same species
created_by: sjwang
creation_date: 2019-10-03T15:41:29Z

[Term]
id: XCO:0000644
name: anti-T cell receptor antibody
def: "A monoclonal antibody that appears to be specific for a constant determinant of the rat alpha/beta heterodimeric T cell receptor." []
synonym: "R73" EXACT []
is_a: XCO:0000194 ! antibody
created_by: sjwang
creation_date: 2019-11-05T10:21:40Z

[Term]
id: XCO:0000645
name: propofol
def: "This is any condition in which the main influencing factor is propofol, an intravenous anesthetic agent which has a very rapid onset after infusion or bolus injection plus a very short recovery period of a couple of minutes. Propofol has also been used as an anticonvulsant and antiemetic." [MESH:D015742]
synonym: "2,6-bis(propan-2-yl)phenol" EXACT []
synonym: "2,6-DIISOPROPYLPHENOL" EXACT []
xref: CHEBI:44915
xref: CID:4943
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000950 ! anticonvulsant
is_a: XCO:0001245 ! antiemetic
created_by: sjwang
creation_date: 2019-11-27T12:37:25Z

[Term]
id: XCO:0000646
name: azoxymethane
def: "This is any condition in which the main influencing factor is azoxymethane (AOM), a gene mutation agent that may be used with dextran sulfate sodium (DSS) to create colon cancer models in laboratory animals." []
synonym: "AOM" EXACT []
xref: CAS:25843-45-2
xref: CID:33184
xref: MDL:MFCD00126912
xref: PMID:16928827
is_a: XCO:0000089 ! neoplasm-inducing chemical
created_by: sjwang
creation_date: 2019-12-04T15:04:39Z

[Term]
id: XCO:0000647
name: darusentan
def: "A selective endothelin ETA receptor antagonist. It is being evaluated as a treatment for congestive heart failure and hypertension." [drugbank:DB04883]
is_a: XCO:0000730 ! endothelin receptor antagonist
created_by: slaulede
creation_date: 2019-12-09T18:27:43Z

[Term]
id: XCO:0000648
name: clodronic acid
def: "An organochlorine compound that is methylene chloride in which both hydrogens are replaced by phosphonic acid groups. It inhibits bone resorption and soft tissue calcification, and is used (often as the disodium salt tetrahydrate) as an adjunct in the treatment of severe hypercalcemia associated with malignancy, and in the management of osteolytic lesions and bone pain associated with skeletal metastases." [CHEBI:110423]
synonym: "(dichloromethanediyl)bis(phosphonic acid)" EXACT []
synonym: "clodronate" EXACT []
is_a: XCO:0000435 ! antineoplastic agent
created_by: slaulede
creation_date: 2019-12-10T17:07:59Z

[Term]
id: XCO:0000649
name: trans-4-hydroxy-L-proline
def: "This is any condition in which the main influencing factor is trans-4-hydroxy-L-proline, an optically active form of 4-hydroxyproline having L-trans-configuration. Trans-4-hydroxy-L-proline is a human, mouse, and plant metabolite that is also used to cause disease in a rat model of urolithiasis." [CHEBI:18095, PMID:37334022]
xref: CHEBI:18095
is_a: XCO:0000259 ! disease-inducing chemical
created_by: sjwang
creation_date: 2019-12-12T13:16:31Z

[Term]
id: XCO:0000650
name: controlled cilazapril content drinking water
def: "A drink made up of water and a specified amount of cilazapril consumed by an organism as part of an experiment. Cilazapril is a prodrug that is hydrolyzed to its main metabolite cilazaprilat, an inhibitor of angiotensin-converting enzyme (ACE)." []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000592 ! cilazapril
created_by: slaulede
creation_date: 2019-12-16T15:56:17Z

[Term]
id: XCO:0000651
name: E4177
def: "A condition in which the main influencing factor is E4177, an agent that blocks one or more angiotensin II receptors." []
synonym: "4'-((2-cyclopropyl-7-methyl-3H-imidazo[4,5-b]pyridin-3-yl)methyl)-[1,1'-biphenyl]-2-carboxylic acid" EXACT []
synonym: "E-4177" EXACT []
is_a: XCO:0000536 ! angiotensin II receptor antagonist
created_by: slaulede
creation_date: 2019-12-16T16:34:05Z

[Term]
id: XCO:0000652
name: controlled E4177 content drinking water
def: "A drink made up of water and a specified amount of E4177 consumed by an organism as part of an experiment. E4177 is an agent that blocks one or more angiotensin II receptors." []
synonym: "controlled 4'-((2-cyclopropyl-7-methyl-3H-imidazo[4,5-b]pyridin-3-yl)methyl)-[1,1'-biphenyl]-2-carboxylic acid content drinking water" EXACT []
synonym: "controlled E-4177 content drinking water" EXACT []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000651 ! E4177
created_by: slaulede
creation_date: 2019-12-16T16:39:42Z

[Term]
id: XCO:0000653
name: ionotropic glutamate receptor antagonist
def: "Any condition in which the main influencing factor is an agent that blocks the transmembrane transfer of an ion by a channel that opens when glutamate has been bound by the channel complex or one of its constituent parts." []
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulede
creation_date: 2019-12-16T17:38:36Z

[Term]
id: XCO:0000654
name: kynurenate
def: "Kynurenate is a product of the metabolism of L-Tryptophan and appears in urine in Vitamin B6 deficiencies. Kynurenate is an endogenous antagonist of the ionotropic glutamate receptors." []
is_a: XCO:0000653 ! ionotropic glutamate receptor antagonist
created_by: slaulede
creation_date: 2019-12-16T17:41:34Z

[Term]
id: XCO:0000655
name: prion
def: "An abnormal form of prion protein that in mammals includes pathogenic forms which arise sporadically, as a result of genetic mutation, or by transmission (as by ingestion of infected tissue) and which upon accumulation in the brain cause a prion disease (such as bovine spongiform encephalopathy or Creutzfeldt-Jakob disease." [https://www.merriam-webster.com/dictionary/prion "merriam-webster"]
synonym: "proteinacious infectious particle" EXACT []
is_a: XCO:0000236 ! pathogen
created_by: slaulede
creation_date: 2019-12-19T11:45:30Z

[Term]
id: XCO:0000656
name: ganciclovir
def: "An oxopurine that is guanine substituted by a [(1,3-dihydroxypropan-2-yl)oxy]methyl group at position 9. Ganciclovir is an antiviral drug used to treat or prevent AIDS-related cytomegalovirus infections" []
is_a: XCO:0000657 ! antiviral agent
created_by: sjwang
creation_date: 2020-01-28T10:22:22Z

[Term]
id: XCO:0000657
name: antiviral agent
def: "A substance that kills or slows the growth of a virus." []
is_a: XCO:0000482 ! antimicrobial agent
created_by: sjwang
creation_date: 2020-01-28T10:24:15Z

[Term]
id: XCO:0000658
name: nisoldipine
alt_id: MESH:D015737
def: "A racemate consisting of equimolar amounts of (R)- and (S)-nisoldipine. A calcium channel blocker, it is used in the treatment of hypertension and angina pectoris." [CHEBI:7577]
synonym: "rac-methyl 2-methylpropyl 2,6-dimethyl-4-(2-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate" EXACT []
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000269 ! calcium channel inhibitor
created_by: slaulede
creation_date: 2020-01-28T16:25:54Z

[Term]
id: XCO:0000659
name: controlled nisoldipine content diet
def: "A regimen of solid food in which the amount of nisoldipine consumed is maintained at a specified level." []
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0000658 ! nisoldipine
created_by: slaulede
creation_date: 2020-01-28T16:42:16Z

[Term]
id: XCO:0000660
name: controlled nisoldipine content drinking water
def: "A drink made up of water and a specified amount of nisoldipine in which the amount of nisoldipine consumed is maintained at a specified level." []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000658 ! nisoldipine
created_by: slaulede
creation_date: 2020-01-28T16:53:19Z

[Term]
id: XCO:0000661
name: one-kidney, one-clip occlusion
def: "A surgical manipulation causing blood vessel blockage by the clipping of one renal artery and surgical removal of the contralateral kidney." [https://www.hindawi.com/journals/bmri/2015/528757/tab1/]
synonym: "1k1c" EXACT []
is_a: XCO:0000347 ! blood vessel occlusion
created_by: slaulede
creation_date: 2020-01-31T09:44:27Z

[Term]
id: XCO:0000662
name: two-kidney, one-clip occlusion
def: "A surgical manipulation causing blood vessel blockage by the clipping of one renal artery." [https://www.hindawi.com/journals/bmri/2015/528757/tab1/]
synonym: "2K1C" EXACT []
synonym: "renal artery ligation" RELATED []
is_a: XCO:0000347 ! blood vessel occlusion
created_by: slaulede
creation_date: 2020-01-31T09:55:35Z

[Term]
id: XCO:0000663
name: two-kidney, two-clip occlusion
def: "A surgical manipulation causing blood vessel blockage by the dissection and clipping of both renal arteries." [https://www.hindawi.com/journals/bmri/2015/528757/tab1/]
synonym: "2K2C" EXACT []
is_a: XCO:0000347 ! blood vessel occlusion
created_by: slaulede
creation_date: 2020-01-31T10:08:45Z

[Term]
id: XCO:0000664
name: adrenergic receptor agonist
def: "An agent that selectively binds to and activates adrenergic receptors." [CHEBI:37886]
synonym: "adrenergic agonists" EXACT []
synonym: "adrenoceptor agonists" EXACT []
synonym: "adrenomimetic" EXACT []
synonym: "adrenomimetics" EXACT []
is_a: XCO:0000135 ! receptor agonist
created_by: slaulede
creation_date: 2020-02-11T14:23:32Z

[Term]
id: XCO:0000665
name: beta-adrenergic agonist
def: "A substance that selectively binds to and activates beta-adrenergic receptors." [CHEBI:35522]
synonym: "beta-adrenergic agonists" EXACT []
synonym: "beta-adrenergic receptor agonist" EXACT []
synonym: "beta-adrenergic receptor agonists" EXACT []
synonym: "beta-adrenoceptor agonists" EXACT []
xref: CHEBI:35522
is_a: XCO:0000664 ! adrenergic receptor agonist
created_by: slaulede
creation_date: 2020-02-11T14:28:45Z

[Term]
id: XCO:0000666
name: bronchodilator agent
def: "Any condition in which the main influencing factor is a substance that causes an increase in the expansion of a bronchus or bronchial tubes." []
synonym: "bronchodilator" EXACT []
synonym: "bronchodilator agents" EXACT []
synonym: "broncholytic agent" EXACT []
is_a: XCO:0000341 ! chemical with specified function
created_by: slaulede
creation_date: 2020-02-11T14:48:25Z

[Term]
id: XCO:0000667
name: clenbuterol
alt_id: MESH:D002976
def: "A beta-adrenergic receptor agonist that is 2,6-dichloroaniline in which the hydrogen at position 4 has been replaced by a 2-(tert-butylamino)-1-hydroxyethyl group." [CHEBI:174690]
synonym: "1-(4-amino-3,5-dichlorophenyl)-2-(tert-butylamino)ethanol" EXACT []
xref: CHEBI:174690
is_a: XCO:0000665 ! beta-adrenergic agonist
is_a: XCO:0000666 ! bronchodilator agent
created_by: slaulede
creation_date: 2020-02-11T14:51:50Z

[Term]
id: XCO:0000668
name: arterial catheter implantation and controlled hemorrhage
def: "The insertion of a tubular, flexible surgical instrument into an artery to withdraw a substantial, yet controlled, amount of blood." []
synonym: "arterial catheter implantation and bleeding" EXACT []
synonym: "arterial catheter implantation and hemorrhaging" EXACT []
relationship: has_component XCO:0000360 ! arterial catheter implantation
relationship: has_component XCO:0000812 ! controlled hemorrhage
created_by: slaulede
creation_date: 2020-02-11T16:01:15Z

[Term]
id: XCO:0000669
name: diazoxide
def: "Any condition in which the main influencing factor is diazoxide, a benzothiadiazine that is the S,S-dioxide of 2H-1,2,4-benzothiadiazine which is substituted at position 3 by a methyl group and at position 7 by chlorine. A peripheral vasodilator, it increases the concentration of glucose in the plasma and inhibits the secretion of insulin by the beta- cells of the pancreas. It is used orally in the management of intractable hypoglycaemia and intravenously in the management of hypertensive emergencies." [CHEBI:4495]
synonym: "Proglycem" EXACT []
xref: CHEBI:4495
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000618 ! sodium channel inhibitor
created_by: slaulede
creation_date: 2020-03-05T14:07:13Z

[Term]
id: XCO:0000670
name: Pair-fed diet
def: "A technique in which the amount of food provided to a control group of animals is matched to that consumed by the experimental group, so as to determine the extent to which the effect of a treatment on body weight or body composition occurred independently of changes of energy intake." [PMID:20620991]
is_a: XCO:0000461 ! restricted feeding
created_by: slaulede
creation_date: 2020-03-05T14:46:27Z

[Term]
id: XCO:0000671
name: doxycycline
def: "A tetracycline in which the 5beta-hydrogen is replaced by a hydroxy group, while the 6alpha-hydroxy group is replaced by hydrogen. A semi-synthetic tetracycline antibiotic, it is used to inhibit bacterial protein synthesis and treat non-gonococcal urethritis and cervicitis, exacerbations of bronchitis in patients with chronic obstructive pulmonary disease (COPD), and adult periodontitis." [CHEBI:50845]
synonym: "Doryx" EXACT []
synonym: "Doxyhexal" EXACT []
synonym: "Doxylin" EXACT []
xref: CHEBI:50845
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000672 ! tetracyclines
relationship: part_of XCO:0000965 ! controlled in vitro cell condition
created_by: slaulede
creation_date: 2020-03-05T15:49:21Z

[Term]
id: XCO:0000672
name: tetracyclines
alt_id: MESH:D013754
def: "This is any condition in which the main influencing factor is a subclass of polyketides having an octahydrotetracene-2-carboxamide skeleton, substituted with many hydroxy and other groups." [CHEBI:26895]
xref: CHEBI:26895
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulede
creation_date: 2020-03-05T16:13:01Z

[Term]
id: XCO:0000673
name: alpha-adrenergic agonist
def: "This is any condition in which the main influencing factor is an alpha-adrenergic agonist, an agent that selectively binds to and activates alpha-adrenergic receptors." [CHEBI:35569]
synonym: "alpha-adrenergic agonists" EXACT []
synonym: "alpha-adrenergic receptor agonist" EXACT []
synonym: "alpha-adrenoceptor agonists" EXACT []
xref: CHEBI:35569
is_a: XCO:0000664 ! adrenergic receptor agonist
created_by: slaulede
creation_date: 2020-03-05T16:49:13Z

[Term]
id: XCO:0000674
name: clonidine
alt_id: CHEBI:46631
def: "This is any condition in which the main influencing factor is clonidine, an imidazoline sympatholytic agent that stimulates alpha-2 adrenergic receptors and central imidazoline receptors. It is commonly used in the management of hypertension." [MESH:D003000]
synonym: "Catapres" EXACT []
synonym: "Kapvay" EXACT []
synonym: "Nexiclon" EXACT []
xref: MESH:D003000
is_a: XCO:0000673 ! alpha-adrenergic agonist
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulede
creation_date: 2020-03-05T16:56:21Z

[Term]
id: XCO:0000675
name: gene transfer using a retrovirus vector
def: "A condition in which gene transfer has been performed using a retrovirus as the carrier of the genetic material. A retrovirus is any of a family (Retroviridae) of single-stranded RNA viruses that produce reverse transcriptase by means of which DNA is produced using their RNA as a template and incorporated into the genome of infected cells." [https://www.merriam-webster.com/dictionary/retrovirus]
synonym: "retroviral gene transfer" EXACT []
synonym: "retrovirus transfer" EXACT []
is_a: XCO:0000528 ! gene transfer
created_by: slaulede
creation_date: 2020-03-06T11:39:41Z

[Term]
id: XCO:0000676
name: gene transfer of the rat erb-b2 receptor tyrosine kinase 2 gene using a retrovirus vector
def: "A condition in which the rat erb-b2 receptor tyrosine kinase 2 gene (Erbb2) gene has been (transiently or stably) transferred into a cell or organism using a retrovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [PMID:1913683]
synonym: "pJR-neu" RELATED []
synonym: "retroviral transfer of the rat Erbb2 gene" EXACT []
synonym: "transfer of recombinant retrovirus containing the rat Erbb2 gene" EXACT []
is_a: XCO:0000675 ! gene transfer using a retrovirus vector
created_by: slaulede
creation_date: 2020-03-06T12:01:39Z

[Term]
id: XCO:0000677
name: controlled enalapril content drinking water
def: "A drink made up of water and a specified amount of enalapril consumed by an organism as part of an experiment. Enalapril, a prodrug that is rapidly metabolized in the liver to enalaprilat, is a potent, competitive inhibitor of angiotensin-converting enzyme (ACE)." [American_Heritage:The_American_Heritage_Dictionary_of_the_English_Language--4th_Ed, https://en.wikipedia.org/wiki/Enalapril "Wikipedia"]
synonym: "controlled Enacard content drinking water" EXACT []
synonym: "controlled Renitec content drinking water" EXACT []
synonym: "controlled Vasotec content drinking water" EXACT []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000542 ! enalapril
created_by: slaulede
creation_date: 2020-03-06T13:46:09Z

[Term]
id: XCO:0000678
name: gene transfer of the rat MER proto-oncogene, tyrosine kinase gene using an adenovirus vector
def: "A condition in which the rat MER proto-oncogene, tyrosine kinase gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [PMID:11592982, Webster:Random_House_Kernerman_Websters_College_Dictionary_2010]
synonym: "adenoviral transfer of the rat Mertk gene" EXACT []
synonym: "Ad-Mertk" RELATED []
synonym: "transfer of recombinant adenovirus containing the rat Mertk gene" EXACT []
xref: PMID:11592982
xref: RGD:69283
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulede
creation_date: 2020-03-13T14:57:43Z

[Term]
id: XCO:0000679
name: fenofibrate
alt_id: CHEBI:5001
alt_id: MESH:D011345
def: "A chlorobenzophenone that is (4-chlorophenyl)(phenyl)methanone substituted by a [2-methyl-1-oxo-1-(propan-2-yloxy)propan-2-yl]oxy group at position 1 on the phenyl ring. Used as a lipid -lowering drug." [CHEBI:5001]
is_a: XCO:0000511 ! ester
is_a: XCO:0000680 ! antilipemic agent
created_by: slaulede
creation_date: 2020-04-20T13:16:09Z

[Term]
id: XCO:0000680
name: antilipemic agent
alt_id: CHEBI:35679
def: "This is any condition in which the main influencing factor is a substance used to treat hyperlipidemia (an excess of lipids in the blood)." [CHEBI:35679]
synonym: "antilipemic drug" EXACT []
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: slaulede
creation_date: 2020-04-20T13:26:24Z

[Term]
id: XCO:0000681
name: Medica 16
def: "This is any condition in which the main influencing factor is Medica 16, an &#945;,&#969;-dicarboxylic acid that is hexadecanedioic acid carrying methyl groups at positions 3 and 14. It is a free fatty acid 1 (FFA1/GPR40) receptor agonist and an ATP citrate lyase inhibitor, and exhibits hypolipidemic and antidiabetogenic properties." [CHEBI:149582]
synonym: "3,3,14,14-Tetramethylhexadecanedioic acid" EXACT []
synonym: "Medic-16" EXACT []
xref: CAS:87272-20-6
xref: CHEBI:149582
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000680 ! antilipemic agent
created_by: slaulede
creation_date: 2020-04-24T12:47:27Z

[Term]
id: XCO:0000682
name: Benfluorex
def: "A benzoate ester that has formula C19H20F3NO2. Functionally, it is an anorectic and hypolipidemic agent." [CHEBI:93826, https://en.wikipedia.org/wiki/Benfluorex "Wikipedia"]
synonym: "benzoic acid 2-[1-[3-(trifluoromethyl)phenyl]propan-2-ylamino]ethyl ester" EXACT []
synonym: "Mediator" EXACT []
is_a: XCO:0000511 ! ester
is_a: XCO:0000680 ! antilipemic agent
created_by: slaulede
creation_date: 2020-04-27T18:51:37Z

[Term]
id: XCO:0000683
name: cholestyramine
def: "A bile acid-binding anticholesteremic drug that helps decrease the risk for strokes and heart attacks." [https://www.webmd.com/drugs/2/drug-49/questran-light-oral/details "webmd"]
synonym: "Cholestyramine resin" EXACT []
synonym: "Prevalite" EXACT []
synonym: "Questran" EXACT []
is_a: XCO:0000680 ! antilipemic agent
created_by: slaulede
creation_date: 2020-04-30T12:29:58Z

[Term]
id: XCO:0000684
name: nateglinide
def: "A condition in which the main influencing factor is nateglinide, an N-acyl-D-phenylalanine resulting from the formal condensation of the amino group of D-phenylalanine with the carboxy group of trans-4-isopropylcyclohexanecarboxylic acid. An orally-administered, rapidly-absorbed, short-acting insulinotropic agent, it is used for the treatment of type 2 diabetes mellitus." [CHEBI:31897]
synonym: "N-[(trans-4-isopropylcyclohexyl)carbonyl]-D-phenylalanine" EXACT []
xref: CHEBI:31897
is_a: XCO:0000407 ! hypoglycemic agent
created_by: slaulede
creation_date: 2020-04-30T14:19:39Z

[Term]
id: XCO:0000685
name: fat emulsion
def: "A liquid composed of two immiscible substances, typically some form of fat and water. In parenteral nutrition, a fat emulsion may contain phospholipids, triglycerides and essential fatty acids." [https://www.cancer.gov/publications/dictionaries/cancer-drug/def/fat-emulsion]
synonym: "lipid emulsion" EXACT []
is_a: XCO:0000341 ! chemical with specified function
created_by: slaulede
creation_date: 2020-04-30T14:52:23Z

[Term]
id: XCO:0000686
name: Intralipid 20
def: "A sterile, non&#8209;pyrogenic fat emulsion intended as a source of calories and essential fatty acids for use in a pharmacy admixture program. It is made up of 20% Soybean Oil, 1.2% Egg Yolk, Phospholipids, 2.25% Glycerin, and Water for Injection. In addition, sodium hydroxide has been added to adjust the pH so that the final product pH is 6 to 8.9." [https://www.fresenius-kabi.com/en-ca/products/lipid-emulsions]
synonym: "emulsion 68890-65-3" EXACT []
synonym: "Intralipid" EXACT []
synonym: "Intralipid 20%" EXACT []
synonym: "Intralipos" EXACT []
xref: PMID:12419950
is_a: XCO:0000685 ! fat emulsion
created_by: slaulede
creation_date: 2020-04-30T15:09:24Z

[Term]
id: XCO:0000687
name: cenicriviroc
def: "An experimental drug candidate for the treatment of HIV infection and in combination with Tropifexor for non-alcoholic steatohepatitis. It is an inhibitor of CCR2 and CCR5 receptors." [https://en.wikipedia.org/wiki/Cenicriviroc "Wikipedia"]
synonym: "CVC" EXACT []
synonym: "TAK 652" EXACT []
synonym: "TBR 652" EXACT []
synonym: "TBR-652" EXACT []
synonym: "TBR652" EXACT []
xref: MESH:C506967
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0000657 ! antiviral agent
created_by: slaulede
creation_date: 2020-05-01T16:51:23Z

[Term]
id: XCO:0000688
name: myelin basic protein
def: "Myelin basic protein is a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon. Myelin basic protein may constitute as much as one-third of all protein in myelin." [https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/myelin-basic-protein "ScienceDirect"]
synonym: "Golli-MBP" EXACT []
synonym: "MBP" EXACT []
synonym: "MBP S" EXACT []
synonym: "Mbps" EXACT []
synonym: "myelin A1 protein" EXACT []
synonym: "myelin basic protein S" EXACT []
synonym: "myelin membrane encephalitogenic protein" EXACT []
xref: RGD:736262
is_a: XCO:0000260 ! peptide/protein antigen
is_a: XCO:0000292 ! peripheral nerve myelin
created_by: slaulede
creation_date: 2020-05-11T16:03:19Z

[Term]
id: XCO:0000689
name: vitamin C
def: "Vitamin C is a water-soluble vitamin that is naturally present in some foods, added to others, and available as a dietary supplement. Humans, unlike most animals, are unable to synthesize vitamin C endogenously, so it is an essential dietary component." [https://ods.od.nih.gov/factsheets/VitaminC-HealthProfessional/ "NIH"]
synonym: "L-ascorbic acid" EXACT []
synonym: "Sodium Ascorbate" EXACT []
xref: CHEBI:21241
xref: MESH:D001205
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000377 ! vitamin
created_by: slaulede
creation_date: 2020-05-11T17:25:22Z

[Term]
id: XCO:0000690
name: controlled vitamin content diet
def: "A solid diet in which the amount of any vitamin is maintained at a specified level. Vitamins are organic substances that are required in small amounts for maintenance and growth, but which cannot be manufactured by the human body." [MESH:D014815]
xref: CHEBI:33229
xref: MESH:D014815
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0000377 ! vitamin
created_by: slaulede
creation_date: 2020-05-11T17:39:15Z

[Term]
id: XCO:0000691
name: controlled vitamin C content diet
def: "A solid diet in which the amount of vitamin C is maintained at a specified level. Vitamin C is a water-soluble vitamin that is naturally present in some foods, added to others, and available as a dietary supplement." [https://ods.od.nih.gov/factsheets/VitaminC-HealthProfessional/ "NIH"]
synonym: "controlled ascorbate content diet" EXACT []
synonym: "controlled ascorbic acid content diet" EXACT []
is_a: XCO:0000689 ! vitamin C
is_a: XCO:0000690 ! controlled vitamin content diet
created_by: slaulede
creation_date: 2020-05-11T17:49:21Z

[Term]
id: XCO:0000692
name: carbachol
def: "An ammonium salt that has formula C6H15N2O2. It is a slowly hydrolyzed cholinergic agonist that acts at both muscarinic receptors and nicotinic receptors." []
synonym: "carbamylcholine" EXACT []
synonym: "carbastat" EXACT []
synonym: "carboptic" EXACT []
synonym: "Isopto Carbachol" EXACT []
synonym: "Miostat" EXACT []
xref: CHEBI:3385
xref: MESH:D002217
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000693 ! cholinergic agonist
created_by: slaulede
creation_date: 2020-05-12T16:35:15Z

[Term]
id: XCO:0000693
name: cholinergic agonist
def: "An agent that selectively binds to and activates cholinergic receptors." [CHEBI:38324]
synonym: "acetylcholine receptor agonist" EXACT []
synonym: "cholinomimetic" EXACT []
xref: CHEBI:38324
xref: MESH:D018679
is_a: XCO:0000135 ! receptor agonist
created_by: slaulede
creation_date: 2020-05-12T16:44:51Z

[Term]
id: XCO:0000694
name: enzyme activator
def: "Any substance that combines with an enzyme to increase its catalytic activity. These molecules are often involved in the allosteric regulation of enzymes in the control of metabolism" [https://en.wikipedia.org/wiki/Enzyme_activator "Wikipedia", Miller-Keane:Miller-Keane_Encyclopedia_and_Dictionary_of_Medicine_Nursing_and_Allied_Health--7th_Ed]
is_a: XCO:0000214 ! activator
created_by: slaulede
creation_date: 2020-05-15T09:27:57Z

[Term]
id: XCO:0000695
name: soluble guanylate cyclase activator
def: "An effector that binds to and activates soluble guanylate cyclase (EC 4.6.1.2). It increases the activity of the enzyme only when the heme iron is oxidized (Fe3+) or the heme group is missing." [CHEBI:76022, https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/enzyme-activator "ScienceDirect"]
synonym: "sGC activator" EXACT []
xref: CHEBI:76022
is_a: XCO:0000694 ! enzyme activator
created_by: slaulede
creation_date: 2020-05-15T09:38:35Z

[Term]
id: XCO:0000696
name: soluble guanylate cyclase stimulator
def: "An allosteric enzyme activator that increases guanylate cyclase activity only when the heme iron is in its reduced state (Fe2+)." [CHEBI:76022, https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/enzyme-activator "ScienceDirect"]
synonym: "sGC stimulator" EXACT []
xref: CHEBI:76022
is_a: XCO:0000694 ! enzyme activator
created_by: slaulede
creation_date: 2020-05-15T09:53:41Z

[Term]
id: XCO:0000697
name: GSK2181236A
def: "This is any condition in which the main influencing factor is GSK2181236A, a small molecule actvator of soluble guanylate cyclase." [PMID:22783192]
synonym: "1-(6-{2-[({3-methyl-4 -[(trifluoromethyl)oxy]-4-biphenylyl}methyl)oxy] phenyl}-2-pyridinyl)-5-(trifluoromethyl)-1H-pyrazole-4-carboxylic acid" EXACT []
xref: PMID:22783192
is_a: XCO:0000695 ! soluble guanylate cyclase activator
created_by: slaulede
creation_date: 2020-05-15T10:01:48Z

[Term]
id: XCO:0000698
name: BAY60-4552
def: "This chemical belongs to a novel group of small molecule compounds which increase the enzymatic activity of soluble guanylate cyclase." [PMID:22783192]
synonym: "Nelociguat" EXACT []
xref: PMID:22783192
is_a: XCO:0000696 ! soluble guanylate cyclase stimulator
created_by: slaulede
creation_date: 2020-05-15T10:36:38Z

[Term]
id: XCO:0000699
name: controlled GSK2181236A content diet
def: "This is any condition in which the main influencing factor is a controlled GSK2181236A content diet, a regimen of solid food in which the amount of GSK2181236A consumed is controlled." [PMID:22783192]
synonym: "controlled 1-(6-{2-[({3-methyl-4 -[(trifluoromethyl)oxy]-4-biphenylyl}methyl)oxy] phenyl}-2-pyridinyl)-5-(trifluoromethyl)-1H-pyrazole-4-carboxylic acid content diet" EXACT []
xref: PMID:22783192
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000697 ! GSK2181236A
created_by: slaulede
creation_date: 2020-05-15T11:12:27Z

[Term]
id: XCO:0000700
name: controlled BAY60-4552 content diet
def: "A regimen of solid food in which the amount of BAY60-4552 consumed is controlled." [PMID:22783192]
synonym: "controlled Nelociguat content diet" EXACT []
xref: PMID:22783192
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000698 ! BAY60-4552
created_by: slaulede
creation_date: 2020-05-15T11:16:58Z

[Term]
id: XCO:0000702
name: thiazoles
alt_id: MESH:D013844
def: "An azole in which the five-membered heterocyclic aromatic skeleton contains a N atom and one S atom." [CHEBI:48901]
xref: MESH:D013844
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulede
creation_date: 2020-05-21T14:51:33Z

[Term]
id: XCO:0000703
name: 2,4,5 trimethylthiazoline
def: "A constituent of fox urine and feces that may be an innately aversive odor to rodents." [https://en.wikipedia.org/wiki/Trimethylthiazoline "Wikipedia"]
synonym: "2,4,5-Trimethyl-4,5-dihydro-1,3-thiazole" EXACT []
synonym: "fox odor" EXACT []
synonym: "TMT" EXACT []
xref: MESH:C451263
is_a: XCO:0000702 ! thiazoles
created_by: slaulede
creation_date: 2020-05-21T15:14:18Z

[Term]
id: XCO:0000704
name: carotid artery occlusion
def: "A surgical manipulation causing blockage of one or both of the common carotid arteries, or of a branch (internal or external) of the common carotid arteries." [Mosby:Mosbys_Medical_Dictionary--8th_Ed]
synonym: "common carotid artery occlusion" NARROW []
synonym: "permanent carotid artery occlusion" NARROW []
synonym: "UCAO" NARROW []
synonym: "unilateral carotid artery occlusion" NARROW []
is_a: XCO:0000347 ! blood vessel occlusion
created_by: slaulede
creation_date: 2020-05-21T15:46:29Z

[Term]
id: XCO:0000705
name: organic radical
def: "Neutral organic radicals are subvalent molecules, i.e., they have unpaired electrons, and, as such, they are typically highly reactive, transient species with short lifetimes that tend to dimerize, disproportionate, or react with oxygen." [https://www.sciencedirect.com/topics/chemistry/organic-radical "ScienceDirect"]
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulede
creation_date: 2020-05-22T12:37:56Z

[Term]
id: XCO:0000706
name: lithium phthalocyanine
def: "Physicochemically lithium phthalocyanine is very stable; its response to pO2 does not change with conditions and environments (e.g., pH, temperature, redox conditions) likely to occur in viable biological systems. It is an organic radical compound that forms metallic-organic, paramagnetic crystallites that appear very useful for in vitro and in vivo electron paramagnetic resonance oximetry." [PMID:8390665]
synonym: "LiPc" EXACT []
is_a: XCO:0000705 ! organic radical
created_by: slaulede
creation_date: 2020-05-22T12:53:58Z

[Term]
id: XCO:0000707
name: carvedilol
def: "Carvedilol is a beta-blocker that works by relaxing blood vessels and slowing heart rate to improve blood flow and decrease blood pressure. It is used to treat heart failure, high blood pressure, and heart attack patients." [https://medlineplus.gov/druginfo/meds/a697042.html]
synonym: "1-(9H-carbazol-4-yloxy)-3-{[2-(2-methoxyphenoxy)ethyl]amino}propan-2-ol" EXACT []
synonym: "Coreg" EXACT []
synonym: "Coropres" EXACT []
synonym: "Dilatrend" EXACT []
synonym: "Eucardic" EXACT []
synonym: "Kredex" EXACT []
synonym: "Querto" EXACT []
xref: CHEBI:3441
xref: MESH:D000077261
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000336 ! adrenergic antagonist
created_by: slaulede
creation_date: 2020-05-28T16:40:29Z

[Term]
id: XCO:0000708
name: controlled carvedilol content diet
def: "A regimen of solid food in which the amount of carvedilol consumed is controlled." [PMID:17551266]
synonym: "controlled Coreg content diet" EXACT []
synonym: "controlled Querto content diet" EXACT []
xref: PMID:17551266
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0000707 ! carvedilol
created_by: slaulede
creation_date: 2020-05-28T16:52:10Z

[Term]
id: XCO:0000709
name: cancer cells
def: "A condition in which cells from one organism are used to cause cancer in another organism by injection of, or other means of transferring, live cells from the donor organism to the host organism. Cancer is a disease characterized by uncontrolled cellular proliferation, local cell invasion and metastasis." [DOID:162]
synonym: "carcinoma cells" NARROW []
synonym: "malignant neoplasm cells" EXACT []
synonym: "malignant tumor cells" EXACT []
synonym: "primary cancer cells" NARROW []
synonym: "sarcoma cells" NARROW []
synonym: "tumor cells" BROAD []
is_a: XCO:0000258 ! disease-inducing agent
created_by: slaulede
creation_date: 2020-06-05T10:25:14Z

[Term]
id: XCO:0000710
name: DHD/K12/TRb cells
def: "A condition in which the main influencing factor is a rat colonic carcinoma cell line used to study biochemical correlates of metastasis." [ECACC:90062901]
synonym: "DHD/K12 cells" EXACT []
synonym: "DHD K12/TRb cells" EXACT []
synonym: "DHD-K12 TRb cells" EXACT []
synonym: "TRb cells" EXACT []
xref: ECACC:90062901
xref: PMID:19850492
is_a: XCO:0000709 ! cancer cells
created_by: slaulede
creation_date: 2020-06-05T10:56:45Z

[Term]
id: XCO:0000711
name: taurolidine
def: "An antimicrobial that is also being studied as a treatment for cancer. It is derived from the endogenous amino acid taurine." [https://en.wikipedia.org/wiki/Taurolidine "Wikipedia"]
synonym: "tauroflex" EXACT []
synonym: "taurolin" EXACT []
synonym: "tauroline" EXACT []
xref: CHEBI:135173
xref: MESH:C012566
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulede
creation_date: 2020-06-05T11:10:11Z

[Term]
id: XCO:0000712
name: vasopressin receptor agonist
def: "Any drug which binds to vasopressin receptors and triggers a response." [CHEBI:59727]
synonym: "antidiuretic hormone agonist" EXACT []
synonym: "arginine vasopressin receptor agonist" EXACT []
synonym: "argipressin receptor agonist" EXACT []
xref: CHEBI:59727
is_a: XCO:0000135 ! receptor agonist
created_by: slaulede
creation_date: 2020-06-05T13:31:12Z

[Term]
id: XCO:0000713
name: desmopressin
def: "A synthetic analogue of vasopressin in which 3-mercaptopropionic acid replaces the cysteine residue at position 1 and D-arginine replaces the residue at position 8. Its action is mediated by the vasopressin receptor V2. It has prolonged antidiuretic activity, but little pressor effects." [CHEBI:4450, MESH:D003894]
synonym: "1-Desamino-8-arginine Vasopressin" EXACT []
synonym: "Adiuretin" EXACT []
synonym: "dDAVP" EXACT []
synonym: "Deamino Arginine Vasopressin" EXACT []
synonym: "Desmogalen" EXACT []
xref: CHEBI:4450
xref: MESH:D003894
is_a: XCO:0000228 ! peptide hormone
is_a: XCO:0000712 ! vasopressin receptor agonist
created_by: slaulede
creation_date: 2020-06-05T13:42:43Z

[Term]
id: XCO:0000714
name: SB-239063
def: "A member of the class of imidazoles carrying 4-hydroxycyclohexyl, 4-fluorophenyl and 2-methoxypyrimidin-4-yl substituents at positions 1, 4 and 5 respectively. It is a mitogen-activated protein kinase inhibitor." [CHEBI:90681]
synonym: "Cyclohexanol, 4-(4-(4-fluorophenyl)-5-(2-methoxy-4-pyrimidinyl)-1H-imidazol-1-yl)-, trans-" EXACT []
synonym: "EC 2.7.11.24 inhibitor" EXACT []
synonym: "SB 239063" EXACT []
synonym: "SB239063" EXACT []
synonym: "trans-1-(4-hydroxycyclohexyl)-4-(4-fluorophenyl)-5-(2-methoxypyridimidin-4-yl)imidazole" EXACT []
synonym: "trans-4-[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]cyclohexan-1-ol" EXACT []
xref: CAS:193551-21-2
xref: CHEBI:90681
xref: CID:5166
xref: MESH:C406525
is_a: XCO:0000715 ! mitogen-activated protein kinase inhibitor
created_by: slaulede
creation_date: 2020-06-08T14:10:13Z

[Term]
id: XCO:0000715
name: mitogen-activated protein kinase inhibitor
def: "This is any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of a mitogen-activated protein kinase." [Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed]
synonym: "EC 2.7.11.24 inhibitor" EXACT []
synonym: "MAPK inhibitor" RELATED []
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulede
creation_date: 2020-06-08T14:19:35Z

[Term]
id: XCO:0000716
name: controlled SB-239063 content diet
def: "A regimen of solid food in which the amount of SB-239063 consumed is controlled." []
synonym: "controlled EC 2.7.11.24 inhibitor content diet" BROAD []
xref: PMID:14561850
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000714 ! SB-239063
created_by: slaulede
creation_date: 2020-06-08T14:38:59Z

[Term]
id: XCO:0000717
name: MRI contrast agent
def: "MRI contrast agents are an indispensable part of magnetic resonance imaging. Contrast agents are used to improve the visibility of internal body structures in magnetic resonance imaging (MRI)." [https://en.wikipedia.org/wiki/MRI_contrast_agent "Wikipedia", https://radiopaedia.org/articles/mri-contrast-agents?lang=us]
xref: CHEBI:37335
is_a: XCO:0001451 ! diagnostic imaging agent
created_by: slaulede
creation_date: 2020-06-08T14:55:27Z

[Term]
id: XCO:0000718
name: gadolinium-based contrast agent
def: "This is any condition in which the main influencing factor is a Gadolinium-Based Contrast Agent (GBCA), an intravenous drug used in diagnostic imaging procedures to enhance the quality of magnetic resonance imaging (MRI) or magnetic resonance angiography (MRA)." [https://www.fda.gov/drugs/postmarket-drug-safety-information-patients-and-providers/information-gadolinium-based-contrast-agents "FDA"]
synonym: "GBCA" EXACT []
is_a: XCO:0000717 ! MRI contrast agent
created_by: slaulede
creation_date: 2020-06-08T15:03:11Z

[Term]
id: XCO:0000719
name: gadopentetate dimeglumine
def: "A gadolinium coordination entity that has formula C28H54GdN5O20." [CHEBI:31797]
synonym: "gadolinium (bis{2-[(carboxylatomethyl)(carboxymethyl)amino]ethyl}amino)acetate--1-deoxy-1-(methylamino)-D-glucitol (1:2)" EXACT []
synonym: "Gd-DTPA" EXACT []
synonym: "Magnevist" EXACT []
xref: CHEBI:31797
is_a: XCO:0000718 ! gadolinium-based contrast agent
created_by: slaulede
creation_date: 2020-06-08T15:14:36Z

[Term]
id: XCO:0000720
name: laser photocoagulation
def: "A condition involving eye surgery using a laser to shrink or destroy abnormal structures in the retina, or to intentionally cause scarring." [https://medlineplus.gov/ency/article/007664.htm "MedlinePlus"]
synonym: "laser coagulation" EXACT []
synonym: "laser eye surgery" EXACT []
synonym: "photocoagulation" EXACT []
is_a: XCO:0000165 ! surgical manipulation
is_a: XCO:0000804 ! laser therapy
created_by: slaulede
creation_date: 2020-06-08T17:19:58Z

[Term]
id: XCO:0000721
name: eprosartan
def: "This is any condition whose main influencing factor is eprosartan, a member of the class of imidazoles and thiophenes that is an angiotensin II receptor antagonist used for the treatment of high blood pressure." [CHEBI:4814]
synonym: "Eprozar" EXACT []
synonym: "Teveten" EXACT []
xref: CHEBI:4814
is_a: XCO:0000536 ! angiotensin II receptor antagonist
created_by: slaulede
creation_date: 2020-06-11T17:41:02Z

[Term]
id: XCO:0000722
name: solid food deprivation
def: "This is any condition in which the main influencing factor is solid food deprivation, a condition in which solid food is withheld for a specified period of time, while nourishment through liquids is provided." [https://www.merriam-webster.com/, PMID:23955305]
xref: PMID:23955305
is_a: XCO:0000461 ! restricted feeding
relationship: part_of XCO:0001275 ! unpredictable chronic mild stress
created_by: slaulede
creation_date: 2020-06-12T17:33:11Z

[Term]
id: XCO:0000723
name: butanol
def: "A primary alcohol that is butane in which a hydrogen of one of the methyl groups is substituted by a hydroxy group. It it produced in small amounts in humans by the gut microbes." [CHEBI:28885]
synonym: "1-butanol" EXACT []
synonym: "1-butyl alcohol" EXACT []
synonym: "butan-1-ol" EXACT []
synonym: "n-butanol" EXACT []
xref: CHEBI:28885
is_a: XCO:0000324 ! primary alcohol
created_by: slaulede
creation_date: 2020-06-15T15:35:54Z

[Term]
id: XCO:0000724
name: Carbon-14 butanol
def: "A primary alcohol that is butanol in which one or several of the carbon (C12) atoms is replaced by radioactive Carbon-14." [CHEBI:28885, https://arcinova.com/services/isotope-labelling]
synonym: "C-14 butanol" EXACT []
synonym: "C14 butanol" EXACT []
synonym: "radiocarbon butanol" EXACT []
xref: CHEBI:28885
xref: https://arcinova.com/services/isotope-labelling
is_a: XCO:0000171 ! radioactively labeled chemical
is_a: XCO:0000723 ! butanol
created_by: slaulede
creation_date: 2020-06-15T16:30:42Z

[Term]
id: XCO:0000725
name: cyclodextrin (CD)-clathrated hesperetin
def: "Hesperetin is the aglycone of hesperidin - clathration by CD enhances hesperetin solubility." [PMID:19966469]
xref: PMID:19966469
is_a: XCO:0000603 ! hesperetin
created_by: slaulede
creation_date: 2020-06-23T14:43:30Z

[Term]
id: XCO:0000726
name: hesperidin
def: "A disaccharide derivative that consists of hesperetin substituted by a 6-O-(alpha-L-rhamnopyranosyl)-beta-D-glucopyranosyl moiety at position 7 via a glycosidic linkage." [CHEBI:28775]
synonym: "Hesperetin 7-O-Rutinoside" EXACT []
synonym: "Hesperidin 2S" EXACT []
xref: CHEBI:28775
xref: MESH:D006569
xref: PMID:19966469
is_a: XCO:0000603 ! hesperetin
created_by: slaulede
creation_date: 2020-06-23T14:57:51Z

[Term]
id: XCO:0000727
name: splenectomy
def: "Surgical removal of part or all of the spleen, the highly vascular lymphoid organ which serves to store blood, disintegrate old blood cells, filter foreign substances from the blood, and produce lymphocytes." [American_Heritage:The_American_Heritage_Medical_Dictionary_2007, Dorland:Dorlands_Illustrated_Medical_Dictionary--31st_Ed]
synonym: "spleen removal" EXACT []
is_a: XCO:0000026 ! surgical removal
created_by: slaulede
creation_date: 2020-06-25T12:48:31Z

[Term]
id: XCO:0000728
name: partial splenectomy
def: "Surgical removal of a portion of the spleen, resulting in reduction but not elimination of the physiological functions of the spleen." [Gale:Gale_Encyclopedia_of_Medicine]
synonym: "PS" EXACT []
is_a: XCO:0000727 ! splenectomy
created_by: slaulede
creation_date: 2020-06-25T12:58:14Z

[Term]
id: XCO:0000729
name: enrasentan
def: "Enrasentan is an orally active mixed endothelin A/B receptor antagonist with a 100-fold greater affinity for the endothelin A receptor." [https://drugs.ncats.io/drug/QG16H8A6ZH]
synonym: "(1S,2R,3S)-3-(2-(2-HYDROXYETHOXY)-4-METHOXYPHENYL)-1-(3,4-(METHYLENEDIOXY)PHENYL)-5-PROPOXY-2-INDANCARBOXYLIC ACID" EXACT []
synonym: "SB-217242" EXACT []
is_a: XCO:0000730 ! endothelin receptor antagonist
created_by: slaulede
creation_date: 2020-07-27T15:38:14Z

[Term]
id: XCO:0000730
name: endothelin receptor antagonist
def: "Any condition in which the main influencing factor is an agent that blocks one or more endothelin receptors." [XCO:0000536]
synonym: "endothelin receptor blocker" EXACT []
xref: CHEBI:51451
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulede
creation_date: 2020-07-27T15:48:37Z

[Term]
id: XCO:0000731
name: controlled enrasentan content diet
def: "A regimen of solid food in which the amount of enrasentan consumed is controlled." [RGD:36174026]
synonym: "controlled SB-217242 content diet" EXACT []
xref: RGD:36174026
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0000729 ! enrasentan
created_by: slaulede
creation_date: 2020-07-27T16:09:03Z

[Term]
id: XCO:0000732
name: CC531 cells
def: "A condition in which the main influencing factor is CC531, a rat colonic adenocarcinoma cell line used to study metastasis." []
synonym: "CC-531" EXACT []
xref: PMID:8225852
xref: RRID:CVCL_0206
is_a: XCO:0000709 ! cancer cells
created_by: slaulede
creation_date: 2020-08-18T16:56:25Z

[Term]
id: XCO:0000733
name: sanguinarine
def: "This is any condition in which the main influencing factor is sanguinarine, a benzophenanthridine alkaloid derived from Sanguinaria canadensis and poppy Fumaria species, shown to exhibit anti-microbial, anti-tumoral, and anti-inflammatory activities." [CHEBI:17183, https://www.sciencedirect.com/topics/agricultural-and-biological-sciences/sanguinarine, PMID:21849887]
synonym: "13-methyl-2H,10H-[1,3]dioxolo[4,5-i][1,3]dioxolo[4',5':4,5]benzo[1,2-c]phenanthridinium" EXACT []
synonym: "pseudochelerythrine" EXACT []
xref: CHEBI:17183
xref: MESH:C005705
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000482 ! antimicrobial agent
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulede
creation_date: 2020-09-04T16:56:22Z

[Term]
id: XCO:0000734
name: chemerin-9
def: "A potent chemokine-like receptor 1 (CMKLR1) agonist that corresponds to C-terminal of full length human Chemerin (RARRES2), amino acids 149 - 157. Activates Gi/o signaling pathways in vitro; inhibits cAMP production and promotes phospholipase C production, Ca2+ mobilization, and smooth muscle contraction." [https://www.rndsystems.com/products/chemerin-9-human_7116, PMID:29906243, RGD:1320450]
synonym: "(149)YFPGQFAFS(157)" EXACT []
synonym: "YFPGQFAFS" EXACT []
xref: PMID:29906243
is_a: XCO:0000120 ! inhibitor
is_a: XCO:0000482 ! antimicrobial agent
created_by: slaulede
creation_date: 2020-09-04T17:26:44Z

[Term]
id: XCO:0000735
name: paclitaxel
def: "A tetracyclic diterpenoid which is a mitotic inhibitor used in cancer chemotherapy." [CHEBI:45863]
synonym: "Taxol" EXACT []
xref: CHEBI:45863
xref: MESH:D017239
is_a: XCO:0000435 ! antineoplastic agent
created_by: slaulede
creation_date: 2020-09-08T14:14:00Z

[Term]
id: XCO:0000736
name: diphtheria toxin
def: "An ADP-ribosylating polypeptide produced by CORYNEBACTERIUM DIPHTHERIAE that can cause a localized infection of mucous membranes or skin (diphtheria), myocarditis, polyneuritis, and other systemic toxic effects." [DOID:11405, MESH:D004165]
synonym: "DT" EXACT []
xref: DOID:11405
xref: MESH:D004165
is_a: XCO:0000240 ! toxin
created_by: slaulede
creation_date: 2020-09-08T17:35:42Z

[Term]
id: XCO:0000737
name: endotoxin
def: "A component of bacterial cells, an endotoxin can be a part of the outer membrane of gram-negative bacteria (lipopolysacharride) or a part or the \"spore\" of gram-positive bacteria (delta endotoxin)." [https://www.horseshoecrab.org/med/endotoxin.html, PMID:11468393]
is_a: XCO:0000240 ! toxin
created_by: slaulede
creation_date: 2020-09-14T17:54:49Z

[Term]
id: XCO:0000738
name: lipopolysaccharide
def: "This is any condition in which the main influencing factor is lipopolysaccharide, the most common type of endotoxin, found in the outer membrane of gram-negative bacteria. Lipopolysaccharide consists of the lipid A portion containing fatty acids and disaccharide phosphates, core polysaccharides, and the O-antigen (repetitive glycan polymer)." [https://www.horseshoecrab.org/med/endotoxin.html, PMID:8119492]
synonym: "endotoxin" BROAD []
synonym: "LPS" EXACT []
xref: CHEBI:16412
xref: MESH:D008070
is_a: XCO:0000737 ! endotoxin
created_by: slaulede
creation_date: 2020-09-14T18:06:38Z

[Term]
id: XCO:0000739
name: housing in trios
def: "This is any condition in which the main influencing factor is housing in trios, a sutuation where subjects are housed in groups of three during a specified time period(s)." [https://www.merriam-webster.com/, PMID:16197708]
is_a: XCO:0000033 ! housing condition
created_by: slaulede
creation_date: 2020-09-15T14:52:57Z

[Term]
id: XCO:0000740
name: housing with pathogen-infected subject
def: "This is any condition in which the main influencing factor is housing with pathogen-infected subject(s), a situation in which at least one subject in the housing had a pathogenic infection during the time period leading up to the specified housing period." [https://www.merriam-webster.com/, PMID:16197708]
is_a: XCO:0000033 ! housing condition
created_by: slaulede
creation_date: 2020-09-15T15:27:06Z

[Term]
id: XCO:0000741
name: housing with bacterial pathogen-infected subject
def: "A condition in which subjects are maintained in housing groups in which at least one subject had a bacterial pathogenic infection during the time period leading up to the specified housing period." [https://www.merriam-webster.com/, PMID:16197708]
is_a: XCO:0000475 ! bacterial pathogen
is_a: XCO:0000740 ! housing with pathogen-infected subject
created_by: slaulede
creation_date: 2020-09-15T15:31:42Z

[Term]
id: XCO:0000742
name: housing with Haemophilus-infected subject
def: "A condition in which subjects are maintained in housing groups in which at least one subject had a Haemophilus infection during the time period leading up to the specified housing period. Haemophilus is a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic." [https://www.merriam-webster.com/, PMID:16197708]
is_a: XCO:0000743 ! Haemophilus
is_a: XCO:0000747 ! housing with Pasteurellaceae-infected subject
created_by: slaulede
creation_date: 2020-09-15T15:38:24Z

[Term]
id: XCO:0000743
name: Haemophilus
def: "A condition in which the primary influencing factor is a species of Haemophilus, a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic." [https://en.wikipedia.org/wiki/Haemophilus, https://www.merriam-webster.com/, PMID:16197708]
is_a: XCO:0000475 ! bacterial pathogen
created_by: slaulede
creation_date: 2020-09-15T15:47:23Z

[Term]
id: XCO:0000744
name: housing with Haemophilus H21-infected subject
def: "A condition in which subjects are maintained in housing groups in which at least one subject had a Haemophilus H21 infection during the time period leading up to the specified housing period. Haemophilus H21 is a strain of Haemophilus, a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic." [https://www.merriam-webster.com/, PMID:16197708]
is_a: XCO:0000742 ! housing with Haemophilus-infected subject
created_by: slaulede
creation_date: 2020-09-15T16:42:53Z

[Term]
id: XCO:0000745
name: housing with Haemophilus H35-infected subject
def: "A condition in which subjects are maintained in housing groups in which at least one subject had a Haemophilus H35 infection during the time period leading up to the specified housing period. Haemophilus H35 is a strain of Haemophilus, a genus of Gram-negative, coccobacilli bacteria, some of which are pathogenic." [https://www.merriam-webster.com/, PMID:16197708]
is_a: XCO:0000742 ! housing with Haemophilus-infected subject
created_by: slaulede
creation_date: 2020-09-15T16:46:22Z

[Term]
id: XCO:0000746
name: housing with Pasteurella pneumotropica-infected subject
def: "A condition in which subjects are maintained in housing groups in which at least one subject had a Pasteurella pneumotropica infection during the time period leading up to the specified housing period. Pasteurella pneumotropica is a strain of Pasteurella, a genus Gram-negative, coccobacilli bacteria, some of which are pathogenic." [https://www.uptodate.com/contents/pasteurella-infections, PMID:16197708]
is_a: XCO:0000747 ! housing with Pasteurellaceae-infected subject
created_by: slaulede
creation_date: 2020-09-15T17:00:42Z

[Term]
id: XCO:0000747
name: housing with Pasteurellaceae-infected subject
def: "A condition in which subjects are maintained in housing groups in which at least one subject had a Pasteurellaceae infection during the time period leading up to the specified housing period. Pasteurellaceae is a large family of Gram-negative bacteria including the genera Pasteurella and Haemophilus, some of which are pathogenic." [https://en.wikipedia.org/wiki/Pasteurellaceae, PMID:16197708]
is_a: XCO:0000741 ! housing with bacterial pathogen-infected subject
created_by: slaulede
creation_date: 2020-09-15T17:15:32Z

[Term]
id: XCO:0000748
name: protease inhibitor
def: "Any condition in which the main influencing factor is a substance which decreases or interferes with the activity of a protease, any of numerous enzymes that hydrolyze proteins." [ISBN-13:978-0877798071, ISBN-13:978-1416062578]
synonym: "peptidase inhibitor" RELATED []
synonym: "proteinase inhibitor" EXACT []
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulede
creation_date: 2020-09-22T15:03:07Z

[Term]
id: XCO:0000749
name: phosphoramidon
def: "Any condition in which the main influencing factor is phosphoramidon, a potent inhibitor of thermolysin and other metallo-endopeptidases, isolated from the cultures of Streptomyces tanashiensis." [CHEBI:45353, https://www.sigmaaldrich.com/catalog/product/sigma/r7385?lang=en&region=US]
xref: CHEBI:45353
xref: MESH:C008890
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000748 ! protease inhibitor
created_by: slaulede
creation_date: 2020-09-22T15:31:08Z

[Term]
id: XCO:0000750
name: diclofenac
def: "This is any condition in which the main influencing factor is diclofenac, a monocarboxylic acid consisting of phenylacetic acid having a (2,6-dichlorophenyl)amino group at the 2-position. It is a non-steroidal anti-inflammatory agent (NSAID) with antipyretic and analgesic actions. It is primarily available as the sodium salt." [CHEBI:47381, MESH:D004008]
synonym: "Diclofenac acid" EXACT []
synonym: "Voltaren" NARROW []
xref: CHEBI:47381
xref: CID:3033
xref: MESH:D004008
xref: PMID:32119089
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000506 ! non-steroidal anti-inflammatory drug
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulede
creation_date: 2020-09-25T10:32:53Z

[Term]
id: XCO:0000751
name: unilateral carotid artery occlusion
def: "A surgical manipulation causing blockage of one of the common carotid arteries, or of a branch (internal or external) of the common carotid arteries." [ISBN-13:978-0323049375, PMID:29486300]
synonym: "UCAO" EXACT []
xref: PMID:29486300
is_a: XCO:0000704 ! carotid artery occlusion
created_by: slaulede
creation_date: 2020-09-25T13:30:19Z

[Term]
id: XCO:0000752
name: right carotid artery occlusion
def: "A surgical manipulation causing blockage of the right common carotid artery, or a branch (internal or external) of the right common carotid artery." [ISBN-13:978-0323049375, PMID:29486300]
is_a: XCO:0000751 ! unilateral carotid artery occlusion
created_by: slaulede
creation_date: 2020-09-25T13:54:07Z

[Term]
id: XCO:0000753
name: left carotid artery occlusion
def: "A surgical manipulation causing blockage of the left common carotid artery, or a branch (internal or external) of the left common carotid artery." [ISBN-13:978-0323049375, PMID:31482584]
is_a: XCO:0000751 ! unilateral carotid artery occlusion
created_by: slaulede
creation_date: 2020-09-25T14:00:57Z

[Term]
id: XCO:0000754
name: bilateral carotid artery occlusion
def: "A surgical manipulation causing blockage of both of the common carotid arteries, or left and right branches (internal or external) of the common carotid arteries." [ISBN-13:978-0323049375, PMID:32937001]
synonym: "BCCAo" NARROW []
synonym: "bilateral common carotid artery occlusion" NARROW []
is_a: XCO:0000704 ! carotid artery occlusion
created_by: slaulede
creation_date: 2020-09-25T14:09:32Z

[Term]
id: XCO:0000755
name: dimethyl sulfoxide
def: "This is any condition in which the main influencing factor is dimethyl sulfoxide, a 2-carbon sulfoxide and highly polar organic liquid, that is used widely as a chemical solvent. Because of its ability to penetrate biological membranes, it is used as a vehicle for topical application of pharmaceuticals. Dimethyl sulfoxide shows a range of pharmacological activity including analgesia and anti-inflammation." [CHEBI:28262, MESH:D004121]
synonym: "DMSO" EXACT []
xref: CHEBI:28262
xref: MESH:D004121
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulede
creation_date: 2020-09-25T14:25:59Z

[Term]
id: XCO:0000756
name: Kolliphor HS 15
def: "This is any condition in which the main influencing factor is Kolliphor HS 15, a non-ionic surfactant and emulsifier that is a potential therapeutic agent because of its effectiveness for reversing multidrug resistance in vitro and its low toxicity in vivo." [https://www.sigmaaldrich.com/catalog/papers/1988130, PMID:1988130]
synonym: "Macrogol (15)-hydroxystearate" EXACT []
synonym: "Polyethylene glycol (15)-hydroxystearate" EXACT []
synonym: "Polyoxyethylated 12-hydroxystearic acid" EXACT []
synonym: "Solutol" EXACT []
synonym: "Solutol HS 15" EXACT []
xref: CHEBI:9194
is_a: XCO:0000511 ! ester
is_a: XCO:0001248 ! poloxamers
relationship: has_component XCO:0000926 ! polyethylene glycol
created_by: slaulede
creation_date: 2020-09-25T14:43:25Z

[Term]
id: XCO:0000757
name: surfactant
def: "A substance which lowers the surface tension of the medium in which it is dissolved, and/or the interfacial tension with other phases, and, accordingly, is positively adsorbed at the liquid/vapor and/or at other interfaces." [CHEBI:35195, https://www.merriam-webster.com/dictionary/surfactant]
is_a: XCO:0000341 ! chemical with specified function
created_by: slaulede
creation_date: 2020-09-25T15:01:23Z

[Term]
id: XCO:0000758
name: retinoic acid
def: "Condition in which the main influencing factor is retinoic acid, a retinoid consisting of 3,7-dimethylnona-2,4,6,8-tetraenoic acid substituted at position 9 by a 2,6,6-trimethylcyclohex-1-en-1-yl group (geometry of the four exocyclic double bonds is not specified). Retinoic acid is derived from retinol (vitamin A) and plays important roles in cell growth, differentiation, and organogenesis." [CHEBI:26536, PMID:22439772]
xref: CHEBI:26536
xref: PMID:22439772
is_a: XCO:0000468 ! vitamin A
created_by: slaulede
creation_date: 2020-10-05T16:57:15Z

[Term]
id: XCO:0000760
name: 26 kDa Schistosoma mansoni antigen
def: "A condition in which the major influencing factor is a soluble Schistosoma mansoni protein expressed by the schistosomulum and target of cytotoxic IgE antibodies." [PMID:1719096, PMID:6698106]
is_a: XCO:0000260 ! peptide/protein antigen
created_by: slaulede
creation_date: 2020-10-13T18:01:28Z

[Term]
id: XCO:0000761
name: biologics and probiotics
def: "This is any condition in which the main influencing factor is a biologic (product of, or component of, a living organism) or probiotic introduced externally or internally to a subject to effect a change in phenotype of the subject, usually in treatment of a medical condition. Probiotics are live microorganisms that are intended to have health benefits when consumed or applied to the body." [https://www.fda.gov/about-fda/center-biologics-evaluation-and-research-cber/what-are-biologics-questions-and-answers, https://www.merriam-webster.com/, https://www.nccih.nih.gov/health/probiotics-what-you-need-to-know]
synonym: "biological medical product" EXACT []
synonym: "biopharmaceutical" EXACT []
is_a: XCO:0000850 ! therapeutic agent
created_by: slaulede
creation_date: 2020-10-15T17:39:53Z

[Term]
id: XCO:0000762
name: rat anti-Ab2 T cells
def: "Any condition in which the main influencing factor is an injection of T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against anti-26 kDa (antigen secreted from schistosomula of Schistosoma mansoni) IgE antibodies." [PMID:1719096, PMID:2494262]
xref: PMID:1719096
xref: PMID:2494262
is_a: XCO:0000763 ! T cells
created_by: slaulede
creation_date: 2020-10-15T17:53:02Z

[Term]
id: XCO:0000763
name: T cells
def: "This is any condition in which the main influencing factor is an injection of T cells (T lymphocytes). T cells are integral to the functioning of the immune system and are at the core of adaptive immunity, the system that tailors the body's immune response to specific pathogens" [CL:0000084, https://www.medicinenet.com/script/main/art.asp?articlekey=11300]
is_a: XCO:0000761 ! biologics and probiotics
created_by: slaulede
creation_date: 2020-10-15T18:06:48Z

[Term]
id: XCO:0000764
name: rat anti-Ab2 T cell line
def: "Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against anti-26 kDa (antigen secreted from schistosomula of Schistosoma mansoni) IgE antibodies." [https://www.merriam-webster.com/, PMID:1719096, PMID:2494262]
xref: PMID:1719096
xref: PMID:2494262
is_a: XCO:0000762 ! rat anti-Ab2 T cells
created_by: slaulede
creation_date: 2020-10-16T15:00:38Z

[Term]
id: XCO:0000765
name: rat anti-26 kDa T cells
def: "Any condition in which the main influencing factor is an injection of T cells prepared from the lymph nodes of rats immunized with the 26 kDa antigen secreted from schistosomula of Schistosoma mansoni ." [https://www.merriam-webster.com/, PMID:1719096]
is_a: XCO:0000763 ! T cells
created_by: slaulede
creation_date: 2020-10-16T16:53:18Z

[Term]
id: XCO:0000766
name: rat anti-26 kDa T cell line
def: "Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with the 26 kDa antigen secreted from schistosomula of Schistosoma mansoni." [https://www.merriam-webster.com/, PMID:1719096]
is_a: XCO:0000765 ! rat anti-26 kDa T cells
created_by: slaulede
creation_date: 2020-10-16T16:59:07Z

[Term]
id: XCO:0000767
name: Schistosoma mansoni
def: "A condition in which the main influencing factor is Schistosoma mansoni, a trematode parasite that lives in certain types of freshwater snails. The infectious form of the parasite, known as cercariae, emerge from the snail into the water. Humans can become infected when skin comes in contact with contaminated freshwater." [https://www.cdc.gov/parasites/schistosomiasis/index.html, PMID:1719096]
is_a: XCO:0000363 ! eukaryotic pathogen
created_by: slaulede
creation_date: 2020-10-16T17:29:53Z

[Term]
id: XCO:0000768
name: Schistosoma mansoni cercariae
def: "A condition in which the main influencing factor is the infective cercariae (larvae) of the trematode parasite Schistosoma mansoni." [https://www.britannica.com/science/cercaria, PMID:1719096]
is_a: XCO:0000767 ! Schistosoma mansoni
created_by: slaulede
creation_date: 2020-10-16T17:50:16Z

[Term]
id: XCO:0000769
name: antiserum
def: "Blood serum that contains antibodies against an infective agent (such as a bacteria or virus) or toxic substance (such as snake venom) and may be used to prevent or treat infection or poisoning." [https://www.biologyonline.com/dictionary/antiserum, https://www.merriam-webster.com/]
is_a: XCO:0000761 ! biologics and probiotics
created_by: slaulede
creation_date: 2020-10-19T13:58:56Z

[Term]
id: XCO:0000770
name: rat anti-Ab2 antiserum
def: "Any condition in which the main influencing factor is serum prepared from rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against anti-26 kDa (antigen secreted from schistosomula of Schistosoma mansoni) IgE antibodies." [https://www.merriam-webster.com/, PMID:1719096]
xref: PMID:1719096
is_a: XCO:0000769 ! antiserum
created_by: slaulede
creation_date: 2020-10-19T14:05:35Z

[Term]
id: XCO:0000771
name: rat anti-26 kDa antiserum
def: "Any condition in which the main influencing factor is serum prepared from rats immunized with the 26 kDa antigen secreted from schistosomula of Schistosoma mansoni." [https://www.merriam-webster.com/, PMID:1719096]
xref: PMID:1719096
is_a: XCO:0000769 ! antiserum
created_by: slaulede
creation_date: 2020-10-19T14:09:02Z

[Term]
id: XCO:0000772
name: controlled cocoa butter content diet
def: "A solid diet in which the amount of cocoa butter is maintained at a specified level. Cocoa butter is a pale vegetable fat with a low melting point obtained from cacao beans." [https://www.healthline.com/health/beauty-skin-care/cocoa-butter-benefits, https://www.merriam-webster.com/]
is_a: XCO:0000014 ! controlled content diet
created_by: slaulede
creation_date: 2020-10-19T15:39:19Z

[Term]
id: XCO:0000773
name: controlled soybean oil content diet
def: "A solid diet in which the amount of soybean oil is maintained at a specified level. Soybean oil is a pale yellow drying or semidrying oil that is obtained from soybeans and is used chiefly as a food, in paints, varnishes, linoleum, printing ink, and soap, and as a source of phospholipids, fatty acids, and sterols." [https://www.merriam-webster.com/, https://www.webmd.com/vitamins/ai/ingredientmono-196/soybean-oil]
is_a: XCO:0000454 ! controlled oil content diet
created_by: slaulede
creation_date: 2020-10-19T17:46:26Z

[Term]
id: XCO:0000774
name: oil
def: "Any condition in which the main influencing factor is any of numerous unctuous combustible substances that are liquid or can be liquefied easily on warming, are soluble in ether but not in water, and leave a greasy stain on paper or cloth." [https://www.britannica.com/science/oil-chemical-compound, https://www.merriam-webster.com/, ISBN:978-1-4684-6878-6]
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulede
creation_date: 2020-10-19T18:03:59Z

[Term]
id: XCO:0000775
name: soybean oil
def: "Any condition in which the main influencing factor is soybean oil. Soybean oil is a pale yellow drying or semidrying oil that is obtained from soybeans and is used chiefly as a food, in paints, varnishes, linoleum, printing ink, and soap, and as a source of phospholipids, fatty acids, and sterols." [https://www.merriam-webster.com/, https://www.webmd.com/vitamins/ai/ingredientmono-196/soybean-oil]
is_a: XCO:0000774 ! oil
created_by: slaulede
creation_date: 2020-10-19T18:21:13Z

[Term]
id: XCO:0000776
name: fatty acid
def: "This is any condition in which the main influencing factor is an aliphatic monocarboxylic acid derived from or contained in esterified form in an animal or vegetable fat, oil or wax." [CHEBI:35366, https://www.merriam-webster.com/]
xref: CHEBI:35366
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulede
creation_date: 2020-10-19T18:27:54Z

[Term]
id: XCO:0000777
name: lipoic acid
def: "This is any condition in which the main influencing factor is alpha-lipoic acid, a heterocyclic thia fatty acid comprising pentanoic acid with a 1,2-dithiolan-3-yl group at the 5-position." [CHEBI:16494, MESH:D008063]
synonym: "&#945;-lipoic acid" EXACT []
synonym: "alpha-lipoic acid" EXACT []
synonym: "LA" EXACT []
synonym: "Thioctic Acid" EXACT []
xref: CHEBI:16494
xref: MESH:D008063
xref: PMID:30208622
is_a: XCO:0000776 ! fatty acid
created_by: slaulede
creation_date: 2020-10-19T18:33:37Z

[Term]
id: XCO:0000778
name: spiroplatin
def: "A condition in which the main influencing factor is spiroplatin, a metal drug and analog of the second generation for cisplatin, developed for the treatment of cancer. Spiroplatin induces DNA cross-linking, thereby inhibiting DNA replication and the synthesis of RNA and protein. Initial clinical trials of spiroplatin showed that it could cause less nausea and vomiting than cisplatin, but development was discontinued due to weak anti-tumor effects and toxicity at high dosages." [https://drugs.ncats.io/drug/H2V318W7LE, MESH:C040757]
synonym: "aqua(1,1-bis(aminomethyl)cyclohexane)sulfatoplatinum (II)" EXACT []
synonym: "NSC-311056" EXACT []
synonym: "TNO-6" EXACT []
xref: MESH:C040757
is_a: XCO:0000399 ! complex ion
is_a: XCO:0000435 ! antineoplastic agent
created_by: slaulede
creation_date: 2020-10-20T14:53:27Z

[Term]
id: XCO:0000779
name: rat IgM immunocytoma cells
def: "A condition in which the main influencing factor is rat IgM-secreting immunocytoma cells. The transplantable tumor cells are used in various studies including antibody secretion studies and antitumoral drug studies." [DOID:0050747, PMID:6683993]
synonym: "rat IgM lymphoplasmacytic lymphoma cells" EXACT []
xref: PMID:6683993
is_a: XCO:0000709 ! cancer cells
created_by: slaulede
creation_date: 2020-10-22T13:12:29Z

[Term]
id: XCO:0000780
name: liposomes
def: "This is any condition in which the main influencing factor is liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and used to deliver biologically relevant substances." [https://www.merriam-webster.com/, https://www.sciencedirect.com/topics/pharmacology-toxicology-and-pharmaceutical-science/liposome]
xref: PMID:6744286
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulede
creation_date: 2020-10-27T16:40:20Z

[Term]
id: XCO:0000781
name: positively charged liposomes
def: "An experimental condition in which the main influencing factor is positively charged liposomes, artificial positively charged vesicles composed of one or more concentric phospholipid bilayers and used to deliver biologically relevant substances." [https://www.merriam-webster.com/, https://www.sciencedirect.com/topics/pharmacology-toxicology-and-pharmaceutical-science/liposome, PMID:6744286]
synonym: "lip+" EXACT []
xref: PMID:6744286
is_a: XCO:0000780 ! liposomes
created_by: slaulede
creation_date: 2020-10-27T16:48:40Z

[Term]
id: XCO:0000782
name: negatively charged liposomes
def: "An experimental condition in which the main influencing factor is negatively charged liposomes, artificial negatively charged vesicles composed of one or more concentric phospholipid bilayers and used to deliver biologically relevant substances." [https://www.merriam-webster.com/, https:www.sciencedirect.com/topics/pharmacology-toxicology-and-pharmaceutical-science/liposome, PMID:6744286]
synonym: "lip-" EXACT []
xref: PMID:6744286
is_a: XCO:0000780 ! liposomes
created_by: slaulede
creation_date: 2020-10-27T16:52:12Z

[Term]
id: XCO:0000783
name: cytokine
def: "This is any condition in which the main influencing factor is a cytokine, a small secreted protein that has a specific effect on the interactions and communications between cells. Cytokine is a general name for other signaling molecules, including lymphokines, monokines, and chemokines." [ISBN-13:978-1608316922, PMID:17426506]
synonym: "chemokine" NARROW []
synonym: "lymphokine" NARROW []
synonym: "monokine" NARROW []
is_a: XCO:0000193 ! peptide/protein
created_by: slaulede
creation_date: 2020-10-30T13:38:35Z

[Term]
id: XCO:0000784
name: interleukin-2
def: "This is any condition in which the main influencing factor is interleukin-2, a cytokine made by a type of T lymphocyte. It increases the growth and activity of other T lymphocytes and B lymphocytes, and affects the development of the immune system." [https://www.cancer.gov/publications/dictionaries/cancer-terms/def/interleukin-2, ISBN-13:978-1608316922]
synonym: "IL-2" EXACT []
synonym: "IL2" EXACT []
synonym: "interleukin 2" EXACT []
xref: MESH:D007376
is_a: XCO:0000783 ! cytokine
created_by: slaulede
creation_date: 2020-10-30T13:52:50Z

[Term]
id: XCO:0000785
name: PROb cells
def: "A condition in which the main influencing factor is a rat cell line derived from a colonic adenocarcinoma induced by 1,2- dimethylhydrazine in BDIX rats." [PMID:6358055, PMID:9833767]
xref: PMID:6358055
xref: PMID:9833767
is_a: XCO:0000709 ! cancer cells
created_by: slaulede
creation_date: 2020-10-30T14:41:50Z

[Term]
id: XCO:0000786
name: PRObR1 cells
def: "A rat cell line (PROb 5-FU-resistant subline) derived from colonic adenocarcinoma PROb cells. The R1 cell line was established from PROb cells by in vivo and in vitro adaptation to 5-fluorouracil (5-FU), an anticancer drug." [PMID:9399677, PMID:9833767]
xref: PMID:9399677
xref: PMID:9833767
is_a: XCO:0000785 ! PROb cells
created_by: slaulede
creation_date: 2020-10-30T14:51:26Z

[Term]
id: XCO:0000787
name: sodium butyrate
def: "Any condition in which the main influencing factor is sodium butyrate, an organic sodium salt resulting from the replacement of the proton from the carboxy group of butyric acid (a short-chain fatty acid) by a sodium ion." [CHEBI:64103, MESH:D002087]
synonym: "sodium butanoate" EXACT []
xref: CHEBI:64103
xref: MESH:D002087
is_a: XCO:0000776 ! fatty acid
created_by: slaulede
creation_date: 2020-10-30T14:59:55Z

[Term]
id: XCO:0000788
name: S4MH cells
def: "A condition in which the main influencing factor is a rat rhabdomyosarcoma cell line used to study metastasis." [ISBN-13:978-0781733908, PMID:18028954]
xref: PMID:18028954
is_a: XCO:0000709 ! cancer cells
created_by: slaulede
creation_date: 2020-11-12T16:13:47Z

[Term]
id: XCO:0000789
name: methylcellulose
def: "This is any condition in which the main influencing factor is methylcellulose, a methylester of cellulose used as an emulsifying and suspending agent in cosmetics, pharmaceuticals and the chemical industry. It is used therapeutically as a bulk laxative." [CHEBI:53448, MESH:D008747]
synonym: "Citrucel" EXACT []
synonym: "MC" EXACT []
synonym: "methyl cellulose" EXACT []
is_a: XCO:0000511 ! ester
is_a: XCO:0001107 ! polymer
created_by: slaulede
creation_date: 2020-11-16T14:59:35Z

[Term]
id: XCO:0000790
name: controlled sodium chloride content drinking water
def: "A drink made up of water and a specified amount of sodium chloride dissolved in a sufficient quantity of water." [https://www.merriam-webster.com/]
synonym: "controlled NaCl content drinking water" EXACT []
is_a: XCO:0000164 ! controlled sodium content drinking water
created_by: slaulede
creation_date: 2020-11-19T14:53:13Z

[Term]
id: XCO:0000791
name: standard condition
def: "A condition defined by a mostly uniform set of parameters accepted as normal or average and used by general consent as a basis of comparison." [https://www.dictionary.com, https://www.merriam-webster.com/]
is_obsolete: true
created_by: slaulede
creation_date: 2020-11-30T14:00:43Z

[Term]
id: XCO:0000792
name: emodin
def: "A trihydroxyanthraquinone that is 9,10-anthraquinone which is substituted by hydroxy groups at positions 1, 3, and 8 and by a methyl group at position 6. It is present in the roots and barks of numerous plants (particularly rhubarb and buckthorn), moulds, and lichens. It is an active ingredient of various Chinese herbs." [CHEBI:42223]
xref: CHEBI:42223
xref: MESH:D004642
xref: PMID:31983185
is_a: XCO:0000120 ! inhibitor
is_a: XCO:0000435 ! antineoplastic agent
created_by: slaulede
creation_date: 2020-11-30T18:03:20Z

[Term]
id: XCO:0000793
name: BTB14431
def: "This is an in-silico screening analog of emodin (XCO:0000792)." [PMID:31983185]
synonym: "BTB 14431" EXACT []
xref: PMID:31983185
is_a: XCO:0000435 ! antineoplastic agent
created_by: slaulede
creation_date: 2020-11-30T18:19:37Z

[Term]
id: XCO:0000794
name: gene transfer of the lin-28 homolog B gene using an adenovirus vector
def: "A condition in which the lin-28 homolog B gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [ISBN-13:978-0781733908, PMID:24279313]
synonym: "Ad/Lin28B" RELATED []
synonym: "adenoviral transfer of the Lin28B gene" EXACT []
synonym: "gene transfer of the Lin28B gene using an adenovirus vector" EXACT []
synonym: "transfer of recombinant adenovirus containing the Lin28B gene" EXACT []
xref: PMID:27384999
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulede
creation_date: 2020-12-01T17:05:51Z

[Term]
id: XCO:0000795
name: controlled sodium chloride content diet
def: "A regimen of solid food in which the amount of sodium chloride consumed is controlled." [https://www.merriam-webster.com/]
synonym: "controlled NaCl content diet" EXACT []
is_a: XCO:0000022 ! controlled sodium content diet
created_by: slaulede
creation_date: 2020-12-18T17:49:31Z

[Term]
id: XCO:0000796
name: U46619
def: "A prostaglandin endoperoxide analogue (11,9 epoxymethano-prostaglandin H2) that is a selective agonist of prostaglandin H2 (PGH2)/thromboxane A2 (TxA2) (TP) receptor. It is a stable thromboxane A2 mimetic and a vasoconstrictor." [http://www.apexbt.com, https://www.sigmaaldrich.com]
synonym: "9,11-Dideoxy-9&#945;,11&#945;-methanoepoxyprostaglandin F 2&#945;" EXACT []
synonym: "U 46619" EXACT []
xref: CAS:56985-40-1
xref: PMID:22508433
is_a: XCO:0000135 ! receptor agonist
created_by: slaulede
creation_date: 2021-01-04T16:46:45Z

[Term]
id: XCO:0000797
name: Y-27632
def: "A monocarboxylic acid amide that is trans-[(1R)-1-aminoethyl]cyclohexanecarboxamide in which one of the nitrogens of the aminocarbony group is substituted by a pyridine nucleus. It is a cell-permeable, reversible inhibitor of Rho-associated protein kinase (ROCK) enzyme." [CHEBI:75393, https://www.sigmaaldrich.com]
synonym: "Rho-associated protein kinase Inhibitor" EXACT []
synonym: "ROCK Inhibitor" EXACT []
synonym: "Y 27632" EXACT []
synonym: "Y27632" EXACT []
xref: CAS:146986-50-7
xref: MESH:C108830
xref: PMID:22508433
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulede
creation_date: 2021-01-04T16:52:50Z

[Term]
id: XCO:0000798
name: nociceptin
def: "Generated from the gene PNOC, which produces a preproprotein, which in subsequently processed to form multiple protein products. Nociceptin a 17-amino acid neuropeptide that binds to the nociceptin receptor to induce increased pain sensitivity." [https://www.ncbi.nlm.nih.gov/gene/5368]
synonym: "NOP" EXACT []
synonym: "OFQ" EXACT []
synonym: "orphanin FQ" EXACT []
xref: PMID:17875345
is_a: XCO:0000228 ! peptide hormone
created_by: slaulede
creation_date: 2021-02-08T16:43:57Z

[Term]
id: XCO:0000799
name: ether
def: "This is any condition in which the main influencing factor is ether, a mobile, very volatile, highly flammable liquid used as an inhalation anesthetic and as a solvent for waxes, fats, oils, perfumes, alkaloids, and gums." [https://www.merriam-webster.com/, MESH:D004986]
synonym: "(C2H5)2O" EXACT []
synonym: "C4H10O" EXACT []
synonym: "CH3CH2OCH2CH3" EXACT []
synonym: "Diethyl ether" EXACT []
synonym: "Ethyl ether" EXACT []
xref: CHEBI:25698he
xref: CID:3283
xref: MESH:D004986
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0001196 ! ethers
created_by: slaulede
creation_date: 2021-02-08T16:54:25Z

[Term]
id: XCO:0000800
name: iron oxide nanoparticle
def: "This is any condition in which the main influencing factor is a particle with a size between 1 and 100 nanometers composed of iron oxide (Fe3O4). It contains both Fe2+ and Fe3+ ions and is sometimes formulated as FeO ? Fe2O3. It exhibits permanent magnetism and is ferrimagnetic." [https://en.wikipedia.org/wiki/Iron(II\,III)_oxide, https://pubchem.ncbi.nlm.nih.gov/compound/Iron_II_III_oxide]
synonym: "Fe3O4 nanoparticle" EXACT []
synonym: "Iron(II,III)oxide nanoparticle" EXACT []
synonym: "iron oxide nanoparticles" EXACT []
synonym: "magnetic nanoparticle" EXACT []
synonym: "MNP" EXACT []
xref: PMID:22661893
is_a: XCO:0000338 ! chemical nanoparticle
created_by: slaulede
creation_date: 2021-02-09T12:06:12Z

[Term]
id: XCO:0000801
name: controlled gliadin content diet
def: "A regimen of solid food in which the amount of gliadin consumed is controlled. Gliadins are a group of proteins called alpha, beta, gamma and omega according to their relative electrophoretic mobility in gels. They are the major component of wheat gluten and made up of single-chain polypeptides with an average molecular weight of 25–100 kDa linked by intramolecular disulfide bonds." [https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/gliadin]
xref: PMID:19327106
is_a: XCO:0000030 ! controlled protein content diet
created_by: slaulede
creation_date: 2021-02-09T12:53:16Z

[Term]
id: XCO:0000802
name: GSK1016790A
def: "It is a tertiary carboxamide and cell-permeable, potent and selective agonist of the TRPV4 (transient receptor potential vanilloid 4) channel." [CHEBI:140524]
synonym: "C28H32Cl2N4O6S2" EXACT []
xref: CAS:942206-85-1
xref: PMID:29875065
xref: pubchem.compound:23630211
is_a: XCO:0000217 ! cation channel activator
created_by: slaulede
creation_date: 2021-02-09T15:22:33Z

[Term]
id: XCO:0000803
name: subthreshold laser therapy
def: "Subthreshold therapy is photocoagulation that does not produce clinical or histologic evidence of retinal damage. Therapeutic benefit is thought to be derived by inducing thermal stress on RPE cells. The goal of the subthreshold therapy is to maintain the temperature rise below the threshold of irreversible thermal damage. The main types are micropulse, selective retinal therapy (SRT), and continuous wave laser with EndPoint Management (algorithm/protocol)." [https://eyewiki.aao.org/Sub-threshold_Laser#\:~\:text=Selective%20Retinal%20Therapy%20%28SRT%29%20Selective%20Retinal%20Therapy%20is\,using%20laser%20pulse%20durations%20of%20microseconds%20or%20nanoseconds., PMID:27841848]
xref: PMID:31402999
is_a: XCO:0000720 ! laser photocoagulation
created_by: slaulede
creation_date: 2021-02-11T13:52:41Z

[Term]
id: XCO:0000804
name: laser therapy
def: "Any biomedical use of lasers for purposes designed to improve the state of the subject. Light from a laser is tuned to specific wavelengths and is a beam of coherent electromagnetic radiation usually in the ultraviolet, visible, or infrared regions of the spectrum." [https://www.healthline.com/health/laser-therapy, https://www.merriam-webster.com/]
xref: MESH:D053685
xref: PMID:31402999
is_a: XCO:0000045 ! electromagnetic radiation exposure
created_by: slaulede
creation_date: 2021-02-11T14:10:41Z

[Term]
id: XCO:0000805
name: nondamaging retinal laser therapy
def: "Nondamaging retinal laser therapy (NRT) is a retinal treatment with a lack of tissue damage. Lack of tissue damage allows high-density treatment patterns to increase therapeutic response and periodic retreatments for chronic macular diseases. It is similar to SRT (selective RPE therapy), but using lower energy to avoid killing retinal pigmented epithelial cells." [PMID:27159441]
synonym: "NRT" EXACT []
xref: PMID:31402999
is_a: XCO:0000803 ! subthreshold laser therapy
created_by: slaulede
creation_date: 2021-02-11T15:38:45Z

[Term]
id: XCO:0000806
name: selective retinal therapy
def: "Selective retinal therapy (SRT) is a subthreshold laser therapy used to treat retinal disorders while preventing severe damage to the retina. In SRT RPE (retinal pigment epithelium) cells are selectively damaged without affecting the photoreceptors or choroid by using laser pulse durations of microseconds or nanoseconds" [https://eyewiki.aao.org/Sub-threshold_Laser#\:~\:text=Selective%20Retinal%20Therapy%20%28SRT%29%20Selective%20Retinal%20Therapy%20is\,using%20laser%20pulse%20durations%20of%20microseconds%20or%20nanoseconds., PMID:27841848]
synonym: "selective RPE therapy" EXACT []
synonym: "SRT" EXACT []
xref: PMID:31402999
is_a: XCO:0000803 ! subthreshold laser therapy
created_by: slaulede
creation_date: 2021-02-11T17:14:59Z

[Term]
id: XCO:0000807
name: tetrahydrocurcumin
def: "A beta-diketone that is methane in which two of the hydrogens are substituted by feruloyl groups. It is is a major herbal antioxidant and anti-inflammatory agent" [CHEBI:67263, PMID:22212488]
synonym: "Sabiwhite" EXACT []
synonym: "tetrahydrodiferuloylmethane" EXACT []
xref: CHEBI:67263
xref: PMID:22212488
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulede
creation_date: 2021-02-16T16:28:33Z

[Term]
id: XCO:0000808
name: DL-&#945;-aminoadipate
def: "Any condition in which the main influencing factor is DL-&#945;-aminoadipate. This excitatory amino acid analogue is an intermediate in the principal biosynthetic pathway of lysine. It is a also an inhibitor of glutamine synthetase." [MESH:D015074]
synonym: "AAA" EXACT []
synonym: "dl-&#945;AA" EXACT []
synonym: "DL-&#945;-AAA" EXACT []
xref: CHEBI:37024
xref: MESH:D015074
xref: PMID:28615682
is_a: XCO:0000240 ! toxin
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulede
creation_date: 2021-02-16T17:08:36Z

[Term]
id: XCO:0000809
name: 2-methyl-6-(phenylethynyl)pyridine
def: "This is any condition in which the main influencing factor is 2-methyl-6-(phenylethynyl)pyridine, a methylpyridine that consists of 2-methylpyridine bearing an additional phenylethynyl group at position 6. It is a potent and highly selective non-competitive antagonist at the mGlu5 receptor subtype (IC50 = 36 nM) and a positive allosteric modulator at mGlu4 receptors. It functions as an excitatory amino acid antagonist and an anxiolytic agent." [CHEBI:64159, MESH:C121465]
synonym: "MPEP" EXACT []
xref: PMID:28615682
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0001122 ! antianxiety agent
created_by: slaulede
creation_date: 2021-02-16T17:41:28Z

[Term]
id: XCO:0000810
name: 2-Chloro-5-hydroxyphenylglycine
def: "Any condition in which the main influencing factor is 2-Chloro-5-hydroxyphenylglycine, a metabotropic glutamate receptor 5 agonist." [PMID:28615682]
synonym: "(R,S)-2-chloro- 5-hydroxyphenylglycine" EXACT []
synonym: "CHPG" EXACT []
xref: MESH:C107349
xref: PMID:28615682
is_a: XCO:0000135 ! receptor agonist
created_by: slaulede
creation_date: 2021-02-16T18:30:58Z

[Term]
id: XCO:0000811
name: A23187
def: "This is any condition in which the main influencing factor is A23187, an ionophorous, polyether antibiotic from Streptomyces chartreusensis. It binds and transports calcium and other divalent cations across membranes." [MESH:D000001]
synonym: "A-23187" EXACT []
synonym: "calcimycin" EXACT []
xref: CHEBI:3305
xref: MESH:D000001
xref: PMID:22508433
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000482 ! antimicrobial agent
is_a: XCO:0000890 ! ionophore
created_by: slaulede
creation_date: 2021-02-22T13:09:46Z

[Term]
id: XCO:0000812
name: controlled hemorrhage
def: "This is any condition in which the main influencing factor is controlled hemorrhage, the drawing of blood (by venipuncture or artery puncture) for transfusion, apheresis, diagnostic testing, or experimental procedures." [https://www.merriam-webster.com/, ISBN-13:978-0702033896]
synonym: "phlebotomy" NARROW []
xref: PMID:17998886
is_a: XCO:0000595 ! surgical manipulation of blood vessels
created_by: slaulede
creation_date: 2021-02-23T15:25:59Z

[Term]
id: XCO:0000813
name: total body irradiation
def: "Total body irradiation (TBI) is a form of radiotherapy (typically X-rays or gamma rays) used primarily as part of the preparative regimen for hematopoietic stem cell (or bone marrow) transplantation." [https://en.wikipedia.org/wiki/Total_body_irradiation, https://www.merriam-webster.com/]
synonym: "TBI" EXACT []
xref: ISBN-13:978-0323240987
xref: PMID:30575429
is_a: XCO:0000043 ! X-ray exposure
created_by: slaulede
creation_date: 2021-03-02T14:21:45Z

[Term]
id: XCO:0000814
name: partial body irradiation
def: "Partial body irradiation (PBI) is a form of radiotherapy used to target certain organs or to study the effects of sublethal doses of radiation." [PMID:22929471, PMID:27147332]
synonym: "PBI" EXACT []
xref: PMID:22929471
xref: PMID:27147332
is_a: XCO:0000043 ! X-ray exposure
created_by: slaulede
creation_date: 2021-03-02T14:31:47Z

[Term]
id: XCO:0000815
name: leg-out partial body irradiation
def: "This is a condition/model system that features partial body irradiation (PBI) delivering a high dose of radiation to most of the body, and a small fraction of that dose to one leg of the subject. It allows the study of multi-organ radiation injury while sparing the bone marrow from a lethal dose." [PMID:27682899, PMID:30575429]
synonym: "leg-out PBI" EXACT []
xref: PMID:27682899
xref: PMID:30575429
is_a: XCO:0000814 ! partial body irradiation
created_by: slaulede
creation_date: 2021-03-02T15:00:18Z

[Term]
id: XCO:0000816
name: partial-body irradiation with 5% bone marrow sparing
def: "Partial-body irradiation with 5% bone marrow sparing (tibiae, ankles, feet) is used to define acute radiation-induced GI-ARS, H-ARS, and acute kidney injury (AKI) as well as the delayed effects of acute radiation exposure (DEARE) characterized by prolonged GI, lung, and heart injury and chronic kidney injury (CKI). This condition/model system allows analysis of concomitant multi-organ sequelae." [PMID:22929471, PMID:30575429]
synonym: "PBI/BM5" EXACT []
xref: PMID:22929471
xref: PMID:30575429
is_a: XCO:0000814 ! partial body irradiation
created_by: slaulede
creation_date: 2021-03-02T15:35:19Z

[Term]
id: XCO:0000817
name: whole thorax lung irradiation
def: "Whole thorax lung irradiation is a type of partial body irradiation used to target the lungs. In experimental animals it is used to study the lung morbidities caused by radiation exposure." [PMID:30575429]
synonym: "WTLI" EXACT []
xref: PMID:30575429
xref: PMID:33009295
is_a: XCO:0000814 ! partial body irradiation
created_by: slaulede
creation_date: 2021-03-02T15:55:53Z

[Term]
id: XCO:0000818
name: gene transfer using a plasmid vector
def: "A condition in which gene transfer has been performed using a plasmid as the carrier of the genetic material. A plasmid is a small, circular, double-stranded DNA molecule that is distinct from a cell's chromosomal DNA. Plasmids naturally exist in bacterial cells, and they also occur in some eukaryotes. Plasmids that are used experimentally as molecular tools are called vectors." [https://www.merriam-webster.com/, https://www.nature.com/scitable/definition/plasmid-plasmids-28/]
synonym: "plasmid gene transfer" EXACT []
xref: PMID:21993171
is_a: XCO:0000528 ! gene transfer
created_by: slaulede
creation_date: 2021-03-04T18:11:03Z

[Term]
id: XCO:0000819
name: gene transfer using plasmid vector pVAX2
def: "A condition in which gene transfer has been performed using the plasmid pVAX2 as the carrier of the genetic material. The pVAX2 plasmid is based on the pVAX1 plasmid, which was designed for use in the development of DNA vaccines." [https://www.thermofisher.com/order/catalog/product/V26020#/V26020, PMID:19440225]
xref: PMID:19440225
is_a: XCO:0000818 ! gene transfer using a plasmid vector
created_by: slaulede
creation_date: 2021-03-04T18:29:17Z

[Term]
id: XCO:0000820
name: gene transfer using empty plasmid vector pVAX2
def: "A control condition in which gene transfer has been performed using an empty plasmid pVAX2. The pVAX2 plasmid is based on the pVAX1 plasmid, which was designed for use in the development of DNA vaccines." [https://www.thermofisher.com/order/catalog/product/V26020#/V26020, PMID:21993171]
synonym: "gene transfer using only the backbone of plasmid vector pVAX2" EXACT []
xref: PMID:19440225
xref: PMID:21993171
is_a: XCO:0000819 ! gene transfer using plasmid vector pVAX2
created_by: slaulede
creation_date: 2021-03-08T13:54:50Z

[Term]
id: XCO:0000821
name: gene transfer of the rat GDNF gene using the plasmid vector pVAX2
def: "A condition in which the rat GDNF gene has been (transiently or stably) transferred into a cell or organism using the plasmid vector pVAX2 in order to induce synthesis of that gene's product in the recipient cell or organism." [https://www.thermofisher.com/order/catalog/product/V26020#/V26020, PMID:21993171]
xref: PMID:19440225
xref: PMID:21993171
is_a: XCO:0000819 ! gene transfer using plasmid vector pVAX2
created_by: slaulede
creation_date: 2021-03-08T14:07:05Z

[Term]
id: XCO:0000822
name: JTE-607
def: "JTE-607 is a pro-drug that is cleaved by carboxylesterase 1 (CES1) to its active metabolite, which then binds to cleavage and polyadenylation specificity factor 3 (CPSF3). JTE-607 reduces the production of proinflammatory cytokines in models of acute injury, septic shock and endotoxemia." [https://www.sigmaaldrich.com/catalog/product/sigma/sml2833?lang=en&region=US, https://www.tocris.com/products/jte-607-dihydrochloride_5185?gclid=Cj0KCQiA1pyCBhCtARIsAHaY_5d7izfKf8E3Lgu7fCItYrJRNFR8iSoRV7HWnsqZOjNwTGeTa9Pcu-4aAthgEALw_wcB]
synonym: "JTE 607" EXACT []
synonym: "JTE 607 dihydrochloride" EXACT []
xref: PMID:10493164
is_a: XCO:0000120 ! inhibitor
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulede
creation_date: 2021-03-09T12:06:36Z

[Term]
id: XCO:0000823
name: peanut oil
def: "Any condition in which the main influencing factor is peanut oil, a colorless to yellow fatty nondrying oil that is obtained from peanuts and is used chiefly as a salad oil, in margarine, in soap, and as a vehicle in pharmaceutical preparations and cosmetics." [https://www.merriam-webster.com]
synonym: "arachis oil" EXACT []
synonym: "groundnut oil" EXACT []
xref: PMID:24388923
is_a: XCO:0000774 ! oil
created_by: slaulede
creation_date: 2021-03-25T15:05:12Z

[Term]
id: XCO:0000824
name: pertussis toxin
def: "Pertussis toxin (PT) is a protein-based AB5-type exotoxin produced by the bacterium Bordetella pertussis, which causes whooping cough. PT is one of the most complex bacterial toxins known, composed of six subunits with an A protomer responsible for biologic activities and a B pentamer directing binding and entry of the A subunit into the cytoplasm." [https://en.wikipedia.org/wiki/Pertussis_toxin, https://www.sciencedirect.com/topics/medicine-and-dentistry/pertussis-toxin]
synonym: "B. pertussis toxin" EXACT []
synonym: "Bordetella pertussis toxin" EXACT []
synonym: "PT" EXACT []
xref: PMID:1702803
is_a: XCO:0000240 ! toxin
created_by: slaulede
creation_date: 2021-04-01T16:00:00Z

[Term]
id: XCO:0000825
name: cyclophosphamide
def: "An experimental condition in which the main influencing factor is cyclophosphamide (CP), an antineoplastic and immunosuppressive agent that must be activated in the liver to form the active aldophosphamide. As chemotherapy it is used to treat lymphoma, multiple myeloma, leukemia, ovarian cancer, breast cancer, small cell lung cancer, neuroblastoma, and sarcoma." [https://en.wikipedia.org/wiki/Cyclophosphamide, MESH:D003520]
synonym: "CP" EXACT []
synonym: "cytophosphane" EXACT []
xref: CHEBI:4027
xref: MESH:D003520
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000636 ! immunosuppressive agent
created_by: slaulede
creation_date: 2021-04-01T16:35:28Z

[Term]
id: XCO:0000826
name: rat anti-Hu-MBP T cell line
def: "Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with human myelin basic protein." [PMID:1702803]
synonym: "rat anti-Hu-BP T cell line" EXACT []
xref: PMID:1702803
is_a: XCO:0000763 ! T cells
created_by: slaulede
creation_date: 2021-04-01T17:07:53Z

[Term]
id: XCO:0000827
name: rat anti-Hu-S102-129 T cell line
def: "Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with synthetic human myelin basic protein peptide 102-129." [PMID:1702803]
xref: PMID:1702803
is_a: XCO:0000763 ! T cells
created_by: slaulede
creation_date: 2021-04-01T17:27:28Z

[Term]
id: XCO:0000828
name: human myelin basic protein
def: "Any condition in which the main influencing factor is human myelin basic protein, a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon. Human myelin basic protein is purified from human tissue or extracted from cultured cells containing cloned copies of the human myelin basic protein gene." [PMID:1702803]
synonym: "Hu-BP" EXACT []
synonym: "human MBP" EXACT []
xref: PMID:1702803
is_a: XCO:0000688 ! myelin basic protein
created_by: slaulede
creation_date: 2021-04-01T17:46:52Z

[Term]
id: XCO:0000829
name: corn oil
def: "Corn oil is a refined fixed, that is, nonvolatile, oil obtained from from the germ of corn kernels. It has high polyunsaturated lipid content and is used as a delivery vehicle for lipophilic substances." [https://www.merriam-webster.com, ISBN-13:978-1608316922]
synonym: "maize oil" EXACT []
xref: PMID:26514922
is_a: XCO:0000774 ! oil
created_by: slaulede
creation_date: 2021-04-08T17:10:21Z

[Term]
id: XCO:0000830
name: artificial cerebrospinal fluid
def: "Any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF), a buffer solution prepared with a composition representative of cerebrospinal fluid. It is used experimentally for rat brain microdialysis experiments, the culture of hippocampal tissue slices, or irrigation treatment of brain trauma lesions to supply oxygen, maintain osmolarity, and to buffer pH at biological levels." [https://biochemazone.com/product/artificial-cerebrospinal-solution-bz178/, https://en.wikipedia.org/wiki/Artificial_cerebrospinal_fluid]
synonym: "aCSF" EXACT []
synonym: "cerebrospinal fluid simulation fluid" EXACT []
xref: PMID:22356885
is_a: XCO:0000154 ! ion/salt solution
created_by: slaulede
creation_date: 2021-04-23T17:15:50Z

[Term]
id: XCO:0000831
name: 2% dimethyl sulfoxide in artificial cerebrospinal fluid
def: "Any condition in which the main influencing factor is a 2% solution (v/v) of dimethyl sulfoxide in artificial cerebrospinal fluid, a buffer solution prepared with a composition representative of cerebrospinal fluid. Dimethyl sulfoxide is a 2-carbon sulfoxide and highly polar organic liquid, that is used widely as a chemical solvent." [CHEBI:28262, https://en.wikipedia.org/wiki/Artificial_cerebrospinal_fluid, MESH:D004121]
synonym: "2% DMSO in aCSF" EXACT []
xref: PMID:22356885
relationship: has_component XCO:0000755 ! dimethyl sulfoxide
relationship: has_component XCO:0000830 ! artificial cerebrospinal fluid
created_by: slaulede
creation_date: 2021-04-23T17:27:15Z

[Term]
id: XCO:0000832
name: lensotomy
def: "Any process involving manual and instrumental techniques for incision of a lens in the eye of an organism to investigate and/or treat a pathological condition." [https://en.wikipedia.org/wiki/List_of_surgical_procedures, PMID:16631043]
synonym: "intentional incision of an ocular lens" EXACT []
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulede
creation_date: 2021-04-30T17:36:25Z

[Term]
id: XCO:0000833
name: lacidipine
def: "Any condition in which the main influencing factor is lacidipine, a lipophilic dihydropyridine calcium channel blocker with a slow onset of action used to treat hypertension." [https://go.drugbank.com/drugs/DB09236, https://www.sigmaaldrich.com/catalog/product/sigma/sml0946?lang=en&region=US&utm_medium=cpc&utm_source=bing&utm_term=lacidipine&utm_campaign=Backlog%20Product-Focused%20Ads%20Phase%202%20(Bing%20ebizpfs)%20(new_c)&utm_content=sigma/sml0946]
synonym: "Lacipil" EXACT []
synonym: "Motens" EXACT []
xref: CHEBI:135737
xref: MESH:C060285
xref: PMID:10023637
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000269 ! calcium channel inhibitor
is_a: XCO:0000511 ! ester
created_by: slaulede
creation_date: 2021-05-10T13:22:23Z

[Term]
id: XCO:0000834
name: formaldehyde
def: "Any condition in which the main influencing factor is formaldehyde, an aldehyde resulting from the formal oxidation of methanol. In solution, it has a wide range of uses: in the manufacture of resins and textiles, as a disinfectant, and as a laboratory fixative or preservative." [CHEBI:16842, MESH:D005557]
synonym: "formalin" EXACT []
synonym: "Methanal" EXACT []
synonym: "Methylene oxide" EXACT []
synonym: "Oxomethane" EXACT []
xref: CHEBI:16842
xref: PMID:21184763
is_a: XCO:0000239 ! toxic substance
created_by: slaulede
creation_date: 2021-05-17T14:00:31Z

[Term]
id: XCO:0000835
name: BT4C cells
def: "A condition in which the main influencing factor is a rat malignant glioma cell line." [https://web.expasy.org/cellosaurus/CVCL_5712, PMID:23079672]
synonym: "BT4c" EXACT []
xref: Cellosaurus:CVCL_5712
xref: PMID:23079672
is_a: XCO:0000709 ! cancer cells
created_by: slaulede
creation_date: 2021-05-18T13:29:46Z

[Term]
id: XCO:0000836
name: gene transfer of the HSV-tk gene using an adenovirus vector
def: "A condition in which the herpes simplex virus thymidine kinase (HSV-tk) gene has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [PMID:23079672]
synonym: "gene transfer of the herpes simplex virus thymidine kinase gene using an adenovirus vector" EXACT []
synonym: "gene transfer of the Herpes Simplex Virus type 1 thymidine kinase gene using an adenovirus vector" EXACT []
synonym: "gene transfer using AdHSV-tk" EXACT []
xref: PMID:23079672
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulede
creation_date: 2021-05-18T13:40:36Z

[Term]
id: XCO:0000837
name: gene transfer of the 15-LO-1 gene using an adenovirus vector
def: "A condition in which the 15-Lipoxygenase-1 (15-LO-1) gene has been transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [PMID:23079672]
synonym: "gene transfer of the 15-Lipoxygenase-1 gene using an adenovirus vector" EXACT []
synonym: "gene transfer using Ad15-LO-1" EXACT []
xref: PMID:23079672
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulede
creation_date: 2021-05-18T13:57:02Z

[Term]
id: XCO:0000838
name: mineralocorticoid receptor antagonist
def: "Any condition in which the main influencing factor is an agent that blocks the mineralocorticoid (primarily aldosterone) receptor (NR3C2), which regulates water and electrolyte metabolism." [https://en.wikipedia.org/wiki/Aldosterone, https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/mineralocorticoids]
synonym: "aldosterone receptor antagonist" EXACT []
synonym: "MR antagonist" EXACT []
xref: PMID:32088716
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulede
creation_date: 2021-05-21T11:58:21Z

[Term]
id: XCO:0000839
name: finerenone
def: "Any condition in which the main influencing factor is finerenone, a nonsteroidal mineralocorticoid receptor antagonist." [https://en.wikipedia.org/wiki/Finerenone, https://www.medchemexpress.com/finerenone.html]
synonym: "BAY 94-8862" EXACT []
synonym: "DB16165" EXACT []
synonym: "FIN" EXACT []
xref: PMID:32088716
is_a: XCO:0000838 ! mineralocorticoid receptor antagonist
created_by: slaulede
creation_date: 2021-05-21T12:40:05Z

[Term]
id: XCO:0000840
name: Eplerenone
def: "Any condition in which the main influencing factor is Eplerenone, a steroidal antimineralocorticoid of the spirolactone group and a selective aldosterone receptor antagonist (SARA)." [https://en.wikipedia.org/wiki/Eplerenone, https://go.drugbank.com/drugs/DB00700]
synonym: "DB00700" EXACT []
synonym: "epoxymexrenone" EXACT []
synonym: "Inspra" EXACT []
xref: PMID:32088716
is_a: XCO:0000838 ! mineralocorticoid receptor antagonist
created_by: slaulede
creation_date: 2021-05-21T12:50:59Z

[Term]
id: XCO:0000841
name: GSK-812
def: "An experimental condition in which the main influencing factor is GSK-812, a potent neuroprotectant that can induce GDNF in normal and diseased retina, and antagonizes multiple receptors, including D2 and D3 receptors, and 5-HT2A, 2C, and 5-HT6 receptors.." [http://www.probechem.com/products_GSK-812.aspx, PMID:28441076]
synonym: "1H-3-Benzazepine, 7-[[4-[(4-chlorophenyl)Methoxy]phenyl]sulfonyl]-2,3,4,5-tetrahydro-8-Methoxy-3-Methyl-" EXACT []
synonym: "7-[4-[(4-chlorophenyl)methoxy]phenyl]sulfonyl-8-methoxy-3-methyl-1,2,4,5-tetrahydro-3-benzazepine" EXACT []
synonym: "7-[[4-[(4-Chlorophenyl)methoxy]phenyl]sulfonyl]-2,3,4,5-tetrahydro-8-methoxy-3-methyl-1H-3-benzazepine" EXACT []
synonym: "GSK812" EXACT []
xref: PMID:28441076
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulede
creation_date: 2021-06-04T12:00:41Z

[Term]
id: XCO:0000842
name: nicotinic antagonist
def: "Any condition in which the main influencing factor is a nicotinic antagonist, a type of anticholinergic drug that inhibits the action of acetylcholine (ACh) at nicotinic acetylcholine receptors." [CHEBI:48878, https://en.wikipedia.org/wiki/Nicotinic_antagonist]
synonym: "nicotinic acetylcholine receptor antagonist" EXACT []
synonym: "nicotinic cholinergic antagonist" EXACT []
xref: CHEBI:48878
xref: PMID:24400148
is_a: XCO:0000630 ! cholinergic antagonist
created_by: slaulede
creation_date: 2021-06-10T10:31:44Z

[Term]
id: XCO:0000843
name: mecamylamine
def: "Any condition in which the main influencing factor is mecamylamine, a ganglionic blocking agent that inhibits transmission between preganglionic and postganglionic neurons in the autonomic nervous system." [CHEBI:48878, https://en.wikipedia.org/wiki/Mecamylamine, MESH:D008464]
synonym: "C11H21N" EXACT []
synonym: "Inversine" EXACT []
synonym: "Vecamyl" EXACT []
xref: PMID:24400148
is_a: XCO:0000842 ! nicotinic antagonist
created_by: slaulede
creation_date: 2021-06-10T11:03:37Z

[Term]
id: XCO:0000844
name: sodium phenobarbital
def: "This is any condition in which the main influencing factor is the sodium salt of phenobarbital (barbituric acid substituted at C-5 by ethyl and phenyl groups). Sodium phenobarbital is an acvtivator of the constitutive androstane receptor (CAR; Nr1i3)." [CHEBI:8070, PMID:29548889]
synonym: "C12H11N2NaO3" EXACT []
synonym: "Luminal sodium" EXACT []
synonym: "NaPB" EXACT []
synonym: "phenobarbital sodium" EXACT []
synonym: "phenobarbital sodium salt" EXACT []
synonym: "Sodium phenobarbitone" EXACT []
xref: PMID:29548889
is_a: XCO:0000135 ! receptor agonist
relationship: has_component XCO:0001203 ! phenobarbital
created_by: slaulede
creation_date: 2021-06-24T15:00:49Z

[Term]
id: XCO:0000845
name: pregnenolone 16alpha-carbonitrile
def: "Any condition in which the main influencing factor is pregnenolone 16alpha-carbonitrile, a catatoxic steroid that acts as an agonist of the rodent pregnane X receptor (PXR; Nr1i2)." [CHEBI:35591, PMID:5793358]
synonym: "3beta-hydroxy-20-oxopregn-5-ene-16alpha-carbonitrile" EXACT []
synonym: "C22H31NO2" EXACT []
synonym: "PCN" EXACT []
xref: MESH:D011285
xref: PMID:29548889
is_a: XCO:0000091 ! steroid
is_a: XCO:0000135 ! receptor agonist
created_by: slaulede
creation_date: 2021-06-24T15:21:50Z

[Term]
id: XCO:0000846
name: Hu-S102-129
def: "Any condition in which the main influencing factor is a 28 amino acid polypeptide representing residues 102 to 129 in the human myelin basic protein molecule. Myelin basic protein is a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon." [PMID:1702803]
synonym: "PSQGKGRGLSLSRFSWGAEGQRPGFGYG" EXACT []
xref: PMID:1702803
is_a: XCO:0000828 ! human myelin basic protein
created_by: slaulede
creation_date: 2021-06-28T15:35:55Z

[Term]
id: XCO:0000847
name: Hu-S110-129
def: "Any condition in which the main influencing factor is a 20 amino acid polypeptide representing residues 110 to 129 in the human myelin basic protein molecule. Myelin basic protein is a hydrophobic insulator that can be synthesized by the oligodendrocyte and/or Schwann cell as part of the myelin sheath which is wrapped around the axon." [PMID:1702803]
synonym: "LSLSRFSWGAEGQRPGFGYG" EXACT []
xref: PMID:1702803
is_a: XCO:0000828 ! human myelin basic protein
created_by: slaulede
creation_date: 2021-06-28T15:42:51Z

[Term]
id: XCO:0000848
name: negatively charged liposome-entrapped doxorubicin
def: "An experimental condition in which the main influencing factor is negatively charged liposomes containing doxorubicin, a cytotoxic anthracycline antibiotic isolated from cultures of Streptomyces peucetius var. caesius and used as a chemotherapy medication." [PMID:6744286]
synonym: "lip- DXR" EXACT []
xref: PMID:6744286
is_a: XCO:0000539 ! doxorubicin
is_a: XCO:0000782 ! negatively charged liposomes
created_by: slaulede
creation_date: 2021-06-28T17:06:42Z

[Term]
id: XCO:0000849
name: positively charged liposome-entrapped doxorubicin
def: "An experimental condition in which the main influencing factor is positively charged liposomes containing doxorubicin, a cytotoxic anthracycline antibiotic isolated from cultures of Streptomyces peucetius var. caesius and used as a chemotherapy medication." [PMID:6744286]
synonym: "lip+ DXR" EXACT []
xref: PMID:6744286
is_a: XCO:0000539 ! doxorubicin
is_a: XCO:0000781 ! positively charged liposomes
created_by: slaulede
creation_date: 2021-06-28T17:14:08Z

[Term]
id: XCO:0000850
name: therapeutic agent
def: "This is any condition in which the main influencing factor is a chemical, biologic, organism, or action that exerts some force or effect resulting in a favorable outcome or improvement in the symptoms of a disorder or disease." [https://www.merriam-webster.com/, ISBN-13:978-0683400076]
synonym: "medicinal agent" EXACT []
synonym: "Not4Curation" RELATED []
synonym: "remedial agent" EXACT []
xref: PMID:29273085
is_a: XCO:0000000 ! experimental condition
created_by: slaulede
creation_date: 2021-06-28T18:20:14Z

[Term]
id: XCO:0000851
name: stem cells
def: "This is a condition in which the main influencing factor is a stem cell, an unspecialized cell capable of perpetuating itself through cell division and having the potential to give rise to a variety of differentiated cells with specialized functions." [CL:0000034, https://en.wikipedia.org/wiki/Stem_cell, https://www.merriam-webster.com/]
synonym: "Not4Curation" RELATED []
xref: PMID:29273085
is_a: XCO:0000761 ! biologics and probiotics
created_by: slaulede
creation_date: 2021-06-28T18:41:49Z

[Term]
id: XCO:0000852
name: human periodontal ligament-derived stem cells
def: "A condition in which the main influencing factor is human periodontal ligament-derived stem cells, which reside in the perivascular space of the periodontium, possess characteristics of mesenchymal stem cells and are a promising tool for periodontal and other tissue type regeneration. The advantages of the use of dental stem cells include their easy isolation by noninvasive routine clinical procedures, their broad differentiation potential, minimal ethical concerns, and that they may enable autologous transplantation." [PMID:25861283, PMID:29273085]
synonym: "hPDLSCs" EXACT []
xref: PMID:29273085
is_a: XCO:0001393 ! human stem cells
created_by: slaulede
creation_date: 2021-06-29T11:11:08Z

[Term]
id: XCO:0000853
name: rat serum from subject bearing a B48-14 IgE-producing hybridoma
def: "Any condition in which the main influencing factor is serum prepared from rats bearing a subcutaneously injected B48-14 IgE-producing hybridoma. The serum is essentially antiserum containing B48-14 IgE, which are directed against a S. mansoni adult worm antigen." [https://www.merriam-webster.com/, PMID:3108390]
xref: PMID:3108390
is_a: XCO:0000769 ! antiserum
created_by: slaulede
creation_date: 2021-06-29T17:41:28Z

[Term]
id: XCO:0000854
name: rat serum from subject bearing IR983F myeloma
def: "Any condition in which the main influencing factor is serum prepared from rats bearing subcutaneously injected IR983F myeloma cells. The serum is essentially control for antiserum from rats bearing IgE-producing hybridomas." [https://www.merriam-webster.com/, PMID:3108390]
synonym: "rat serum from subject bearing IR 983 F myeloma" EXACT []
xref: PMID:3108390
is_a: XCO:0000769 ! antiserum
created_by: slaulede
creation_date: 2021-06-29T18:07:47Z

[Term]
id: XCO:0000855
name: rat serum from subject bearing a non-specified IgE-producing hybridoma
def: "Any condition in which the main influencing factor is serum prepared from rats bearing a subcutaneously injected non-specified IgE-producing hybridoma. The serum is essentially antiserum containing control IgE, which are directed against an unspecified antigen." [https://www.merriam-webster.com/, PMID:3108390]
xref: PMID:3108390
is_a: XCO:0000769 ! antiserum
created_by: slaulede
creation_date: 2021-06-29T18:12:26Z

[Term]
id: XCO:0000856
name: resveratrol
def: "A stilbenol that is stilbene in which the phenyl groups are substituted at positions 3, 5, and 4' by hydroxy groups. It is produced by various plants and has anti-oxidant, anti-inflammatory, cardioprotective, anti-mutagenic, and anti-carcinogenic properties." [MESH:D000077185]
synonym: "3,4',5-Stilbenetriol" EXACT []
synonym: "3,4',5-Trihydroxystilbene" EXACT []
synonym: "5-[2-(4-hydroxyphenyl)ethenyl]benzene-1,3-diol" EXACT []
synonym: "RSV" EXACT []
synonym: "SRT501" EXACT []
xref: PMID:30621358
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulede
creation_date: 2021-06-29T18:22:55Z

[Term]
id: XCO:0000857
name: vildagliptin
def: "Any condition in which the main influencing factor is vildagliptin, a pyrrolidine-carbonitrile derivative and potent inhibitor of dipeptidyl peptidase 4 (DPP-4) that is used in the treatment of type 2 diabetes mellitus." [MESH:D000077597, PMID:23774700]
synonym: "VG" EXACT []
xref: PMID:23774700
is_a: XCO:0000407 ! hypoglycemic agent
created_by: slaulede
creation_date: 2021-07-02T13:08:02Z

[Term]
id: XCO:0000858
name: rat anti-control-Ab2 T cells
def: "Any condition in which the main influencing factor is an injection of T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against non-specific IgE antibodies." [PMID:1719096]
xref: PMID:1719096
xref: PMID:2494262
is_a: XCO:0000763 ! T cells
created_by: slaulede
creation_date: 2021-07-02T17:20:09Z

[Term]
id: XCO:0000859
name: rat anti-control-Ab2 T cell line
def: "Any condition in which the main influencing factor is an injection of cultured cells derived from T cells prepared from the lymph nodes of rats immunized with Ab2 antibodies. These Ab2 antibodies are antiidiotypic antibodies raised against non-specific IgE antibodies." [PMID:1719096]
xref: PMID:1719096
xref: PMID:2494262
is_a: XCO:0000858 ! rat anti-control-Ab2 T cells
created_by: slaulede
creation_date: 2021-07-02T17:23:47Z

[Term]
id: XCO:0000860
name: anti-rh-VEGF165 monoclonal antibody
def: "A condition in which the main influencing factor is a monoclonal antibody having specific amino acid sequences with the ability to adhere to and interact specifically with recombinant human vascular endothelial growth factor 165." [https://www.merriam-webster.com/, PMID:11316858]
synonym: "anti-recombinant human vascular endothelial growth factor 165 monoclonal antibody" EXACT []
xref: PMID:15702434
is_a: XCO:0000194 ! antibody
created_by: slaulede
creation_date: 2021-07-06T14:53:33Z

[Term]
id: XCO:0000861
name: control IgG monoclonal antibody
def: "A condition in which the main influencing factor is an isotype-matched (IgG) monoclonal antibody to provide a control for some target-specific monoclonal antibody." [https://www.merriam-webster.com/, PMID:11316858]
synonym: "isotype-matched control Ab" EXACT []
xref: PMID:15702434
is_a: XCO:0000194 ! antibody
created_by: slaulede
creation_date: 2021-07-06T15:18:46Z

[Term]
id: XCO:0000862
name: bendroflumethiazide
def: "A condition in which the main influencing factor is bendroflumethiazide, a sulfonamide consisting of 7-sulfamoyl-3,4-dihydro-2H-1,2,4-benzothiadiazine 1,1-dioxide in which the hydrogen at position 6 is substituted by a trifluoromethyl group and that at position 3 is substituted by a benzyl group. It has been used in the treatment of familial hyperkalemia, hypertension, edema, and urinary tract disorders." [CHEBI:3013, MESH:D001539]
synonym: "Aprinox" EXACT []
synonym: "bendrofluazide" EXACT []
synonym: "BTZ" EXACT []
xref: PMID:18480177
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulede
creation_date: 2021-07-06T17:28:01Z

[Term]
id: XCO:0000863
name: antihypertensive agent
def: "This is any condition in which the main influencing factor is a drug used in the treatment of acute or chronic vascular hypertension regardless of pharmacological mechanism." [CHEBI:35674, ISBN-13:9780781733908]
synonym: "antihypertensive drug" EXACT []
xref: PMID:18480177
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: slaulede
creation_date: 2021-07-06T17:35:52Z

[Term]
id: XCO:0000864
name: hepatic portal vein occlusion
def: "A condition involving surgical manipulation causing blockage of one or more branches of the hepatic portal vein, a vein that transports nutrients from the digestive tract to the liver." [ISBN-13:9780781733908, PMID:32156510]
synonym: "hepatic portal vein ligation" RELATED []
synonym: "HPV occlusion" EXACT []
synonym: "liver portal vein occlusion" EXACT []
xref: PMID:32156510
is_a: XCO:0000347 ! blood vessel occlusion
created_by: slaulede
creation_date: 2021-07-08T13:48:54Z

[Term]
id: XCO:0000865
name: dehydroepiandrosterone
def: "A condition in which the main influencing factor is an androstanoid that is androst-5-ene substituted by a beta-hydroxy group at position 3 and an oxo group at position 17. It is a major C19 steroid produced by the adrenal cortex. It is also produced in small quantities in the testis and the ovary." [CHEBI:28689, MESH:D003687]
synonym: "androstenolone" EXACT []
synonym: "DHEA" EXACT []
xref: PMID:9415976
is_a: XCO:0000229 ! steroid hormone
created_by: slaulede
creation_date: 2021-07-09T13:35:10Z

[Term]
id: XCO:0000866
name: anal sphincter myotomy
def: "Any process involving manual and instrumental techniques for incision of the internal anal sphincter muscle. The inner is controlled by the nervous system, while the external anal sphincter muscle is under voluntary control." [https://www.merriam-webster.com/medical/myotomy, https://www.verywellhealth.com/sphincterotomy-overview-4584862]
synonym: "lateral internal sphincterotomy" EXACT []
synonym: "sphincterotomy" EXACT []
xref: PMID:29391927
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulede
creation_date: 2021-07-09T16:04:48Z

[Term]
id: XCO:0000867
name: incision repair
def: "A process in which manual and instrumental techniques are used to close a wound or surgical incision with sutures, staples, glue, or some other closure material." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "incision closure" EXACT []
synonym: "incision stapling" NARROW []
synonym: "incision suturing" NARROW []
xref: PMID:29391927
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulede
creation_date: 2021-07-09T16:46:51Z

[Term]
id: XCO:0000868
name: incision repair with conventional suture
def: "A process in which manual and instrumental techniques are used to close a wound or surgical incision with sutures. Surgical sutures are specially made thread that comes in different sizes and different material." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "incision suturing" EXACT []
xref: PMID:29391927
is_a: XCO:0000867 ! incision repair
created_by: slaulede
creation_date: 2021-07-09T17:22:07Z

[Term]
id: XCO:0000869
name: incision repair with biosuture
def: "A process in which manual and instrumental techniques are used to close a wound or surgical incision with biosutures. Biosutures are surgical sutures upon which stem cells have been grown in vitro." [https://www.merriam-webster.com/, PMID:29391927]
synonym: "incision suturing with biosuture" EXACT []
xref: PMID:18690635
xref: PMID:29391927
is_a: XCO:0000867 ! incision repair
created_by: slaulede
creation_date: 2021-07-12T10:20:45Z

[Term]
id: XCO:0000870
name: rat adipose-derived stem cells
def: "A condition in which the main influencing factor is a rat stem cell, isolated from subcutaneous fat tissue and cultured in vitro. A stem cell is an unspecialized cell capable of perpetuating itself through cell division and having the potential to give rise to a variety of differentiated cells with specialized functions." [https://www.merriam-webster.com/, PMID:29391927]
synonym: "adipose-derived stem cells" BROAD []
xref: PMID:29391927
is_a: XCO:0000851 ! stem cells
created_by: slaulede
creation_date: 2021-07-12T12:42:34Z

[Term]
id: XCO:0000871
name: 5-fluorouracil
def: "A nucleobase analogue that is uracil in which the hydrogen at position 5 is replaced by fluorine. Following conversion to the active deoxynucleotide, It inhibits DNA synthesis by blocking the thymidylate synthetase conversion of deoxyuridylic acid to thymidylic acid." [CHEBI:46345, MESH:D005472]
synonym: "5-Fluoracil" EXACT []
synonym: "5-fluoropyrimidine-2,4(1H,3H)-dione" EXACT []
synonym: "5-FU" EXACT []
synonym: "fluorouracil" EXACT []
xref: PMID:10431686
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000636 ! immunosuppressive agent
created_by: slaulede
creation_date: 2021-07-16T15:49:31Z

[Term]
id: XCO:0000872
name: thymosin alpha-1
def: "This is any condition in which the main influencing factor is thymosin alpha-1, a member of a family of heat-stable, polypeptide hormones secreted by the thymus gland. Thymosins are immune response-modulating molecules." [MESH:D013947, PMID:33362999]
synonym: "prothymosin alpha" RELATED []
synonym: "prothymosin, alpha" RELATED []
synonym: "PTMA" RELATED []
synonym: "thymalfasin" EXACT []
synonym: "TMSA" RELATED []
xref: PMID:10431686
is_a: XCO:0000228 ! peptide hormone
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000657 ! antiviral agent
created_by: slaulede
creation_date: 2021-07-16T16:55:07Z

[Term]
id: XCO:0000873
name: DHD/K12/TRb - Sp-5 cells
def: "A condition in which the main influencing factor is the pulmonary metastatic subclone Sp-5 of a rat colonic carcinoma cell line (DHD/K12/TRb) used to study biochemical correlates of metastasis." [PMID:19850492, PMID:7818325]
synonym: "DHD/K12 - Sp-5 cells" EXACT []
synonym: "DHD K12/TRb - Sp-5 cells" EXACT []
synonym: "DHD-K12 TRb - Sp-5 cells" EXACT []
synonym: "TRb - Sp-5 cells" EXACT []
xref: PMID:7818325
is_a: XCO:0000710 ! DHD/K12/TRb cells
created_by: slaulede
creation_date: 2021-07-19T17:18:00Z

[Term]
id: XCO:0000874
name: controlled in situ lung condition
def: "This is any condition in which the main influencing factor is a controlled in situ lung condition in which the internal or external environment of one or both lungs is experimentally manipulated, for example through perfusion, increased or decreased blood flow, etc. without removal from the body." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "controlled in situ pulmonary condition" EXACT []
synonym: "Not4Curation" EXACT []
xref: PMID:7818325
is_a: XCO:0000166 ! controlled in situ organ condition
created_by: slaulede
creation_date: 2021-07-19T17:25:18Z

[Term]
id: XCO:0000875
name: isolated lung perfusion
def: "An experimental condition consisting of right or left thoracotomy with cannulation of pulmonary artery and vein, perfusion via artery, and collection of effluent from pulmonary vein to prevent systemic circulation of treatment or vehicle." [PMID:7818325, PMID:8347000]
synonym: "isolated single lung perfusion" EXACT []
xref: PMID:7818325
is_a: XCO:0000874 ! controlled in situ lung condition
created_by: slaulede
creation_date: 2021-07-19T17:33:20Z

[Term]
id: XCO:0000876
name: floxuridine
def: "This is an antineoplastic antimetabolite that is metabolized to fluorouracil when administered by rapid injection. When administered by slow, continuous, intra-arterial infusion, it is converted to floxuridine monophosphate. It has been used to treat hepatic metastases of gastrointestinal adenocarcinomas and for palliation in malignant neoplasms of the liver and gastrointestinal tract." [CHEBI:60761, MESH:D005467]
synonym: "2'-deoxy-5-fluorouridine" EXACT []
synonym: "5FDU" EXACT []
synonym: "5-Fluorodeoxyuridine" EXACT []
synonym: "5-FUdR" EXACT []
synonym: "deoxyfluorouridine" EXACT []
synonym: "fluorodeoxyuridine" EXACT []
synonym: "FUDR" EXACT []
synonym: "PMID:7818325" EXACT []
is_a: XCO:0000390 ! antimetabolite
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000657 ! antiviral agent
created_by: slaulede
creation_date: 2021-07-19T18:12:49Z

[Term]
id: XCO:0000877
name: Hespan buffer
def: "This is any condition in which the main influencing factor is Hespan buffer, 6% hetastarch in buffered solution. A buffer is a homogeneous mixture of molecules, atoms and/or ions, one or more of which have the capacity to cause the solution to resist change in pH upon addition of small amounts of acid or base, dispersed in a sufficient quantity of solvent." [https://www.fda.gov, PMID:10155362]
synonym: "HB" EXACT []
xref: PMID:7818325
is_a: XCO:0000315 ! buffer solution
created_by: slaulede
creation_date: 2021-07-19T18:38:39Z

[Term]
id: XCO:0000878
name: Hespan buffer perfusate
def: "Any condition in which the main influencing factor is Hespan buffer (6% hetastarch in buffered solution) injected or pumped into, or poured through, an organ or tissue, usually via a blood vessel." [https://www.fda.gov, PMID:10155362]
synonym: "HB perfusate" EXACT []
xref: PMID:7818325
is_a: XCO:0000115 ! perfusate
is_a: XCO:0000877 ! Hespan buffer
created_by: slaulede
creation_date: 2021-07-20T13:59:06Z

[Term]
id: XCO:0000879
name: triamcinolone acetonide
def: "A synthetic glucocorticoid that is the 16,17-acetonide of triamcinolone. It is an anti-inflammatory agent used topically in the treatment of various skin disorders." [CHEBI:71418, MESH:D014222]
synonym: "Azmacort" EXACT []
synonym: "Cinonide" EXACT []
synonym: "Kenalog 40" EXACT []
synonym: "Tricort-40" EXACT []
xref: PMID:27856527
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulede
creation_date: 2021-07-20T14:16:29Z

[Term]
id: XCO:0000880
name: mifepristone
def: "Any condition in which the main influencing factor is mifepristone, a progestational and glucocorticoid hormone antagonist. Its inhibition of progesterone induces bleeding during the luteal phase and in early pregnancy by releasing endogenous prostaglandins from the endometrium or decidua. As a glucocorticoid receptor antagonist, the drug has been used to treat hypercortisolism in patients with nonpituitary Cushing Syndrome." [MESH:D015735]
synonym: "Mifegyne" EXACT []
synonym: "Mifeprex" EXACT []
synonym: "RU 38486" EXACT []
synonym: "RU38486" EXACT []
synonym: "RU-486" EXACT []
synonym: "RU486" EXACT []
synonym: "ZK98296" EXACT []
xref: PMID:27856527
is_a: XCO:0000120 ! inhibitor
created_by: slaulede
creation_date: 2021-07-20T14:26:43Z

[Term]
id: XCO:0000881
name: 4[N-methyl-14C] iodoantipyrine
def: "This is 4-Iodoantipyrine, labeled with C-14 on the N-methyl group. Iodoantipyrine readily crosses the blood-brain barrier, and has been used to measure total and regional cerebral blood flow in vivo." [https://www.perkinelmer.com/product/iodoantipyrine-4-n-methyl-14c-nec712050uc#]
synonym: "4-iodo-5-methyl-1-(114C)methyl-2-phenylpyrazol-3-one" EXACT []
synonym: "4-Iodoantipyrene-N-methyl-14C" EXACT []
synonym: "C11H11IN2O" EXACT []
xref: PMID:29498562
xref: pubchem.compound:101126542
is_a: XCO:0000171 ! radioactively labeled chemical
created_by: slaulede
creation_date: 2021-07-29T17:59:13Z

[Term]
id: XCO:0000882
name: sleeve gastrectomy
def: "This procedure involves removal of about 80% of the stomach, leaving a tube-shaped stomach about the size and shape of a banana. The procedure is typically performed as a surgical intervention for weight control." [https://www.mayoclinic.org/tests-procedures/sleeve-gastrectomy/about/pac-20385183, ISBN-13:9780781733908]
synonym: "vertical sleeve gastrectomy" EXACT []
xref: PMID:29168078
is_a: XCO:0000026 ! surgical removal
created_by: slaulede
creation_date: 2021-08-02T15:06:01Z

[Term]
id: XCO:0000883
name: pantoprazole
def: "This is a substituted benzimidazole and proton pump inhibitor that is used in the treatment of gastroesophageal reflux and peptic ulcer." [CHEBI:7915, MESH:D000077402]
synonym: "5-(difluoromethoxy)-2-{[(3,4-dimethoxypyridin-2-yl)methyl]sulfinyl}-1H-benzimidazole" EXACT []
synonym: "BY-1023" EXACT []
synonym: "Protonix" EXACT []
synonym: "SKF-96022" EXACT []
xref: PMID:29168078
is_a: XCO:0000577 ! proton pump inhibitor
created_by: slaulede
creation_date: 2021-08-02T15:19:16Z

[Term]
id: XCO:0000884
name: trypan blue
def: "Any condition in which the main influencing factor is trypan blue, an azo dye used as a vital stain to selectively colour dead tissues or cells blue." [https://en.wikipedia.org/wiki/Trypan_blue, https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/trypan-blue]
synonym: "tetrasodium 3,3'-[(3,3'-dimethylbiphenyl-4,4'-diyl)didiazene-2,1-diyl]bis(5-amino-4-hydroxynaphthalene-2,7-disulfonate)" EXACT []
xref: PMID:3347907
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000512 ! teratogen
created_by: slaulede
creation_date: 2021-08-02T16:18:02Z

[Term]
id: XCO:0000885
name: diabetes-inducing chemical
def: "A condition in which the main influencing factor is substance that is toxic to the pancreatic insulin-producing beta cells of the islets of Langerhans in rodents and other animals and can therefore be used for modeling diabetes mellitus through destruction of the beta cells." [CHEBI:9288, ISBN-13:9780781733908]
xref: PMID:12401717
is_a: XCO:0000259 ! disease-inducing chemical
created_by: slaulede
creation_date: 2021-08-09T17:47:11Z

[Term]
id: XCO:0000886
name: epilepsy-inducing chemical
def: "A condition in which the main influencing factor is substance that causes seizures in experimental animals, initiated by the injection of a drug." [DOID:9007090, PMID:31039378]
synonym: "seizure-inducing chemical" EXACT []
xref: PMID:31039378
is_a: XCO:0000259 ! disease-inducing chemical
created_by: slaulede
creation_date: 2021-08-09T18:13:25Z

[Term]
id: XCO:0000887
name: pentetrazol
def: "This a pharmaceutical agent that displays activity as a central nervous system and respiratory stimulant. It is considered a non-competitive gamma-aminobutyric acid antagonist. Pentetrazol has been used experimentally to study seizure phenomenon and to identify pharmaceuticals that may control seizure susceptibility." [MESH:D010433]
synonym: "1,5-pentamethylenetetrazole" EXACT []
synonym: "pentamethylenetetrazole" EXACT []
synonym: "pentylenetetrazole" EXACT []
synonym: "PTZ" EXACT []
xref: CHEBI:34910
xref: PMID:31039378
is_a: XCO:0000886 ! epilepsy-inducing chemical
created_by: slaulede
creation_date: 2021-08-10T12:49:31Z

[Term]
id: XCO:0000888
name: pilocarpine
def: "Pilocarpine is a miotic alkaloid obtained from jaborandi that is used chiefly in the form of its hydrochloride or nitrate especially in the treatment of glaucoma. It is a cholinergic (muscarinic) agonist and used to cause seizures in animal models of epilepsy." [https://medlineplus.gov/druginfo/meds/a608039.html, https://www.merriam-webster.com/, MESH:D010862]
xref: CHEBI:39462
xref: PMID:31039378
is_a: XCO:0000693 ! cholinergic agonist
is_a: XCO:0000886 ! epilepsy-inducing chemical
created_by: slaulede
creation_date: 2021-08-10T13:18:44Z

[Term]
id: XCO:0000889
name: ionomycin
def: "Ionomycin is a very long-chain fatty acid that is a calcium ionophore produced by Streptomyces conglobatus. It is used in research to raise the intracellular level of Ca(2+) and as a research tool to understand Ca(2+) transport across biological membranes." [CHEBI:63954, MESH:D015759]
synonym: "C41H72O9" EXACT []
xref: CHEBI:63954
xref: MESH:D015759
xref: PMID:32300198
is_a: XCO:0000776 ! fatty acid
is_a: XCO:0000890 ! ionophore
created_by: slaulede
creation_date: 2021-08-10T13:36:53Z

[Term]
id: XCO:0000890
name: ionophore
def: "A compound that facilitates transmission of an ion across a lipid barrier (as in a cell membrane) by combining with the ion or by increasing the permeability of the barrier to it." [CHEBI:24869, https://www.merriam-webster.com/]
synonym: "ion carrier" EXACT []
xref: PMID:32300198
is_a: XCO:0000341 ! chemical with specified function
created_by: slaulede
creation_date: 2021-08-10T13:40:47Z

[Term]
id: XCO:0000891
name: phorbol 13-acetate 12-myristate
def: "Phorbol 13-acetate 12-myristate is a phorbol ester found in croton oil with very effective tumor promoting activity. It is a protein kinase C agonist and stimulates the synthesis of both DNA and RNA." [MESH:D013755]
synonym: "12-O-Tetradecanoyl Phorbol 13-Acetate" EXACT []
synonym: "phorbol myristate acetate" EXACT []
synonym: "PMA" EXACT []
synonym: "tetradecanoylphorbol acetate" EXACT []
synonym: "TPA" EXACT []
xref: CHEBI:37537
is_a: XCO:0000694 ! enzyme activator
is_a: XCO:0000892 ! tumor promoter
created_by: slaulede
creation_date: 2021-08-10T13:54:49Z

[Term]
id: XCO:0000892
name: tumor promoter
def: "Tumor promoters are substances that enhance tumorigenicity when administered after a carcinogen. In general, tumor promoters do not possess tumorigenic activity themselves." [https://www.cancer.gov/publications/dictionaries/cancer-terms/def/tumor-promotion, PMID:10417370]
xref: PMID:32300198
is_a: XCO:0000259 ! disease-inducing chemical
created_by: slaulede
creation_date: 2021-08-10T15:45:15Z

[Term]
id: XCO:0000893
name: controlled ramipril content drinking water
def: "A drink made up of water and a specified amount of ramipril in which the amount of ramipril consumed is maintained at a specified level." [https://www.merriam-webster.com/, PMID:20864942]
synonym: "controlled Altace content drinking water" EXACT []
xref: CHEBI:8774
xref: PMID:20864942
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000548 ! ramipril
created_by: slaulede
creation_date: 2021-08-26T11:53:55Z

[Term]
id: XCO:0000894
name: controlled hesperidin content diet
def: "A regimen of solid food in which the amount of hesperidin, a disaccharide derivative that consists of hesperetin substituted by a 6-O-(alpha-L-rhamnopyranosyl)-beta-D-glucopyranosyl moiety at position 7 via a glycosidic linkage, is controlled." [CHEBI:28775]
synonym: "controlled Hesperetin 7-O-Rutinoside content diet" EXACT []
synonym: "controlled Hesperidin 2S content diet" EXACT []
xref: CHEBI:28775
xref: MESH:D006569
xref: PMID:19966469
is_a: XCO:0000726 ! hesperidin
is_a: XCO:0000896 ! controlled hesperetin content diet
created_by: slaulede
creation_date: 2021-08-27T15:37:24Z

[Term]
id: XCO:0000895
name: controlled cyclodextrin (CD)-clathrated hesperetin content diet
def: "A regimen of solid food in which the amount of cyclodextrin (CD)-clathrated hesperetin is controlled. CD-clathrated hesperetin is the aglycone of hesperidin. Clathration by CD enhances hesperetin solubility." [PMID:19966469]
xref: CHEBI:28230
xref: MESH:C013015
xref: PMID:19966469
is_a: XCO:0000725 ! cyclodextrin (CD)-clathrated hesperetin
is_a: XCO:0000896 ! controlled hesperetin content diet
created_by: slaulede
creation_date: 2021-08-27T15:46:09Z

[Term]
id: XCO:0000896
name: controlled hesperetin content diet
def: "A regimen of solid food in which the amount of hesperetin is controlled. Hesperetin belongs to the flavanone class of flavonoids. Hesperetin, in the form of its glycoside Hesperidin, is the predominant flavonoid in lemons and oranges." [drugbank:DB01094]
xref: CHEBI:28230
xref: MESH:C013015
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0000603 ! hesperetin
created_by: slaulede
creation_date: 2021-08-27T15:51:49Z

[Term]
id: XCO:0000897
name: capsaicin
def: "This is an alkylamide found in some peppers that acts as an agonist at TRPV1 cation channels." [MESH:D002211]
synonym: "(6E)-N-(4-hydroxy-3-methoxybenzyl)-8-methylnon-6-enamide" EXACT []
synonym: "8-Methyl-N-Vanillyl-6-Nonenamide" EXACT []
synonym: "Axsain" EXACT []
synonym: "Capsaicine" EXACT []
xref: CHEBI:3374
xref: PMID:27335281
is_a: XCO:0000217 ! cation channel activator
created_by: slaulede
creation_date: 2021-09-16T12:42:30Z

[Term]
id: XCO:0000898
name: minoxidil
def: "This a pyrimidine N-oxide that is a potent direct-acting peripheral vasodilator that reduces peripheral resistance and produces a fall in blood pressure." [CHEBI:6942, MESH:D008914]
synonym: "2,4-Pyrimidinediamine, 6-(1-piperidinyl)-, 3-oxide" EXACT []
synonym: "6-(piperidin-1-yl)pyrimidine-2,4-diamine 3-oxide" EXACT []
synonym: "Rogaine" EXACT []
synonym: "U 10858" EXACT []
xref: PMID:27335281
is_a: XCO:0000140 ! vasodilator
created_by: slaulede
creation_date: 2021-09-16T13:23:00Z

[Term]
id: XCO:0000899
name: hydrochlorothiazide
def: "This is a thiazide diuretic often considered the prototypical member of this class. It reduces the reabsorption of electrolytes from the renal tubules. This results in increased excretion of water and electrolytes, including sodium, potassium, chloride, and magnesium. It is used in the treatment of several disorders including edema, hypertension, diabetes insipidus, and hypoparathyroidism." [MESH:D006852]
synonym: "Dichlothiazide" EXACT []
synonym: "Dihydrochlorothiazide" EXACT []
xref: CHEBI:5778
xref: PMID:3611778
is_a: XCO:0000122 ! diuretic
created_by: slaulede
creation_date: 2021-10-07T13:42:44Z

[Term]
id: XCO:0000900
name: controlled hydrochlorothiazide content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of hydrochlorothiazide in which the amount of hydrochlorothiazide consumed is maintained at a specified level." [https://www.merriam-webster.com/]
synonym: "controlled dichlothiazide content drinking water" EXACT []
synonym: "controlled dihydrochlorothiazide content drinking water" EXACT []
synonym: "controlled Microzide content drinking water" EXACT []
xref: CHEBI:5778
xref: PMID:3611778
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000899 ! hydrochlorothiazide
created_by: slaulede
creation_date: 2021-10-07T14:29:25Z

[Term]
id: XCO:0000901
name: controlled delapril content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of delapril in which the amount of delapril consumed is maintained at a specified level." [https://www.merriam-webster.com/]
xref: CHEBI:135735
xref: PMID:8505110
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000540 ! delapril
created_by: slaulede
creation_date: 2021-10-07T15:05:11Z

[Term]
id: XCO:0000902
name: controlled candesartan content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of candesartan in which the amount of candesartan consumed is maintained at a specified level." [https://www.merriam-webster.com/]
xref: CHEBI:3348
xref: MESH:C081643
xref: PMID:8505110
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000438 ! candesartan
created_by: slaulede
creation_date: 2021-10-07T15:17:01Z

[Term]
id: XCO:0000903
name: 99mTc-mebrofenin
def: "Technetium (99mTc) mebrofenin is a diagnostic radiopharmaceutical used for imaging of the liver and the gallbladder." [https://en.wikipedia.org/wiki/Technetium_(99mTc)_mebrofenin]
synonym: "99mTc-N-(3-bromo-2,4,6-trimethylphenylcarbamoilmethyl 1-iminodiacetic acid" EXACT []
synonym: "Choletec" EXACT []
synonym: "Technetium mebrofenin" EXACT []
xref: CHEBI:135608
xref: PMID:30208622
is_a: XCO:0000171 ! radioactively labeled chemical
created_by: slaulede
creation_date: 2021-10-07T18:18:21Z

[Term]
id: XCO:0000904
name: controlled resveratrol content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of resveratrol in which the amount of resveratrol consumed is maintained at a specified level." [https://www.merriam-webster.com/, PMID:30621358]
synonym: "controlled 3,4',5-Stilbenetriol content drinking water" EXACT []
synonym: "controlled RSV content drinking water" EXACT []
synonym: "controlled SRT501 content drinking water" EXACT []
xref: MESH:D000077185
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000856 ! resveratrol
created_by: slaulede
creation_date: 2021-10-08T18:16:04Z

[Term]
id: XCO:0000905
name: castor oil
def: "Any condition in which the main influencing factor is castor oil, a mixture of triglycerides obtained by pressing the seeds of the castor oil plant, Ricinus communis It is used as a cathartic and as a plasticizer." [CHEBI:140618, MESH:D002368]
synonym: "oil of Palma Christi" EXACT []
synonym: "Ricinus communis oil" EXACT []
synonym: "Ricinus oil" EXACT []
synonym: "tangantangan oil" EXACT []
xref: PMID:10023637
is_a: XCO:0000774 ! oil
created_by: slaulede
creation_date: 2021-10-12T18:50:59Z

[Term]
id: XCO:0000906
name: ovalbumin
def: "This is any condition in which the main influencing factor is ovalbumin, the main protein found in egg white. Ovalbumin displays sequence and three-dimensional homology to the serpin superfamily, but unlike most serpins it is not a serine protease inhibitor." [https://en.wikipedia.org/wiki/Ovalbumin, ISBN-13:9780781733908]
synonym: "OVA" EXACT []
xref: https://en.wikipedia.org/wiki/Ovalbumin
is_a: XCO:0000193 ! peptide/protein
created_by: slaulede
creation_date: 2021-10-14T16:18:19Z

[Term]
id: XCO:0000907
name: liraglutide
def: "Any condition in which the main influencing factor is liraglutide, a lipopeptide that is an analogue of human GLP-1 and an agonist of the GLP-1 receptor. Liraglutide is used as a hypoglycemic agent and supplemental therapy in the treatment of diabetes mellitus." [CHEBI:71193, MESH:D000069450]
synonym: "NN-2211" EXACT []
synonym: "Saxenda" EXACT []
synonym: "Victoza" EXACT []
xref: PMID:29976929
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0000407 ! hypoglycemic agent
created_by: slaulede
creation_date: 2021-10-15T10:42:36Z

[Term]
id: XCO:0000908
name: potassium aluminium sulfate
def: "A condition in which the main influencing factor is a metal sulfate composed of potassium, aluminium and sulfate ions in the ratio 1:1:2." [CHEBI:86463]
synonym: "AlK(SO4)2" EXACT []
synonym: "alum" EXACT []
synonym: "aluminium potassium sulfate" EXACT []
synonym: "aluminum sulfate" EXACT []
synonym: "potassium alum" EXACT []
xref: CHEBI:26218
xref: MESH:C041524
is_a: XCO:0000909 ! potassium salt
created_by: slaulede
creation_date: 2021-10-21T15:54:45Z

[Term]
id: XCO:0000909
name: potassium salt
def: "A condition in which the main influencing factor is any alkali metal salt having potassium(1+) as the cation." [CHEBI:26218]
synonym: "Kaliumsalz" EXACT []
synonym: "potassium salts" EXACT []
xref: CHEBI:26218
is_a: XCO:0000150 ! potassium ion
created_by: slaulede
creation_date: 2021-10-21T16:00:13Z

[Term]
id: XCO:0000910
name: controlled dehydroepiandrosterone content diet
def: "A regimen of solid food in which the amount of dehydroepiandrosterone consumed is controlled." [PMID:9415976]
synonym: "controlled androstenolone content diet" EXACT []
synonym: "controlled DHEA content diet" EXACT []
xref: CHEBI:28689
xref: MESH:D003687
xref: PMID:9415976
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0000865 ! dehydroepiandrosterone
created_by: slaulede
creation_date: 2021-10-25T15:20:22Z

[Term]
id: XCO:0000911
name: sodium bicarbonate
def: "This is any condition in which the main influencing factor is sodium bicarbonate, a white, crystalline powder that is commonly used as a pH buffering agent, an electrolyte replenisher, systemic alkalizer and in topical cleansing solutions." [MESH:D017693]
synonym: "baking soda" EXACT []
synonym: "bicarbonate of soda" EXACT []
synonym: "sodium hydrogen carbonate" EXACT []
synonym: "sodium hydrogencarbonate" EXACT []
xref: PMID:29168078
relationship: has_component XCO:0000253 ! sodium ion
created_by: slaulede
creation_date: 2021-10-25T17:24:20Z

[Term]
id: XCO:0000912
name: controlled exposure to red light
def: "Condition in which the environmental level and/or time of exposure to red light (wavelength range of 630–740 nm) is controlled." [https://en.wikipedia.org/wiki/Red]
xref: PMID:28341233
is_a: XCO:0000284 ! controlled visible light exposure
created_by: slaulede
creation_date: 2021-10-26T18:33:13Z

[Term]
id: XCO:0000913
name: ethosuximide
def: "Any condition in which the main influencing factor is ethosuximide, a dicarboximide that is pyrrolidine-2,5-dione in which the hydrogens at position 3 are substituted by one methyl and one ethyl group. Ethosuximide is an antiepileptic used in the treatment of absence seizures and potentially myoclonic seizures, but is ineffective against tonic-clonic seizures." [CHEBI:4887]
synonym: "3-ethyl-3-methylpyrrolidine-2,5-dione" EXACT []
synonym: "Zarontin" EXACT []
xref: MESH:D005013
xref: PMID:30408474
is_a: XCO:0000269 ! calcium channel inhibitor
created_by: slaulede
creation_date: 2021-10-29T11:04:35Z

[Term]
id: XCO:0000914
name: cafeteria diet
def: "A dietary regimen in which access to food is unlimited and consists of energy-dense, highly palatable food. The diet is technically undefined as to ratio of components, but recapitulates the orosensory properties (such as smell and texture) and palatability of foodstuffs that promote overconsumption (voluntary hyperphagia). It has been proven to not only increase body weight and induce obesity, but to also cause metabolic syndrome, severe diabetic symptoms, liver inflammation, and other metabolic dysregulations." [PMID:33309818]
synonym: "junk food diet" EXACT []
synonym: "supermarket diet" EXACT []
synonym: "Western diet" EXACT []
is_a: XCO:0000019 ! solid diet
created_by: slaulede
creation_date: 2021-10-29T14:53:10Z

[Term]
id: XCO:0000915
name: controlled ethanol content drinking water used as vehicle
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of ethanol, serving as a control condition for some chemical delivered in ethanol and drinking water." [https://www.merriam-webster.com/]
xref: PMID:30621358
is_a: XCO:0000023 ! controlled ethanol content drinking water
created_by: slaulede
creation_date: 2021-11-01T12:46:32Z

[Term]
id: XCO:0000916
name: gelled diet
def: "This is a regimen of semisolid food in which the amount of solid elements and water in the diet are controlled. The diet resembles jelly in consistency and is about 62.5% H2O, 37.5% synthetic food (Ziegler Bros., formula 53140000),0.3% NaCl, and 0.3% agar wt/wt." [PMID:12684228]
synonym: "gel-agar diet" RELATED []
synonym: "gel diet" EXACT []
synonym: "semisolid diet" RELATED []
is_a: XCO:0000013 ! diet
created_by: slaulede
creation_date: 2021-11-30T17:49:55Z

[Term]
id: XCO:0000917
name: distilled water
def: "This is any condition in which the main influencing factor is distilled water, which is purified by successive evaporation and condensation. It is experimentally provided for hydration or as a vehicle control for some dissolved substance." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "clarified water" RELATED []
synonym: "dH2O" EXACT []
synonym: "distilled H2O" EXACT []
synonym: "purified water" RELATED []
xref: PMID:12684228
is_a: XCO:0000021 ! water
created_by: slaulede
creation_date: 2021-11-30T18:14:19Z

[Term]
id: XCO:0000918
name: ambient air
def: "This is any condition in which the major influencing factor is atmospheric air in its natural state. The composition of ambient air varies depending on the elevation above sea level, but is typically 78% nitrogen and 21% oxygen." [https://www.thermofisher.com]
synonym: "atmospheric air" EXACT []
synonym: "room air" EXACT []
relationship: part_of XCO:0001244 ! ambient environment
created_by: slaulede
creation_date: 2021-12-07T15:31:29Z

[Term]
id: XCO:0000919
name: N-nitroso-N-methyl-4-aminobutyric acid
def: "A nitrosamine that has methyl and 3-carboxypropyl substituents. It is a tobacco-derived nitrosamino acid that is a known animal and potential human carcinogen. It induces bladder transitional cell carcinomas in rats and has recently been identified as a contaminant in certain blood pressure medications." [CHEBI:176579]
synonym: "4-[methyl(nitroso)amino]butanoic acid" EXACT []
synonym: "NMBA" EXACT []
synonym: "N-nitrosomethylaminobutyric acid" EXACT []
synonym: "N-nitrosomethylbenzylamine" EXACT []
xref: PMID:32123074
xref: pubchem.compound:13643
is_a: XCO:0000089 ! neoplasm-inducing chemical
created_by: slaulede
creation_date: 2022-02-03T13:23:56Z

[Term]
id: XCO:0000920
name: controlled mineral content diet
def: "A regimen of solid food in which the amount of an inorganic element or compound containing a metal, nonmetal, radical, or phosphate that is needed for proper body function and maintenance of health, is controlled." [https://www.merriam-webster.com, ISBN-13:9780781733908]
xref: PMID:32123074
is_a: XCO:0000014 ! controlled content diet
created_by: slaulede
creation_date: 2022-02-03T13:41:46Z

[Term]
id: XCO:0000921
name: controlled zinc content diet
def: "A regimen of solid food in which the amount of zinc is controlled." [https://www.merriam-webster.com, ISBN-13:9780781733908]
synonym: "controlled Zn content diet" EXACT []
is_a: XCO:0000920 ! controlled mineral content diet
created_by: slaulede
creation_date: 2022-02-03T13:49:41Z

[Term]
id: XCO:0000922
name: semaxanib
def: "An oxindole that is 3-methyleneoxindole in which one of the hydrogens of the methylene group is replaced by a 3,5-dimethylpyrrol-2-yl group. It has been used to produce pulmonary arterial hypertension in animal models." [CHEBI:91083]
synonym: "(3Z)-3-[(3,5-dimethyl-1H-pyrrol-2-yl)methylidene]-1,3-dihydro-2H-indol-2-one" EXACT []
synonym: "SU" EXACT []
synonym: "SU 5416" EXACT []
synonym: "SU5416" EXACT []
xref: PMID:24113457
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0000259 ! disease-inducing chemical
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulede
creation_date: 2022-02-03T14:10:08Z

[Term]
id: XCO:0000923
name: isolated lung perfusion with Hespan buffer
def: "This is an experimental condition consisting of right or left thoracotomy with cannulation of pulmonary artery and vein, perfusion via artery with Hespan buffer, and collection of effluent from pulmonary vein to prevent systemic circulation of treatment or vehicle." [PMID:10155362, PMID:7818325]
synonym: "isolated lung perfusion with HB" EXACT []
xref: PMID:7818325
is_a: XCO:0000875 ! isolated lung perfusion
is_a: XCO:0000877 ! Hespan buffer
created_by: slaulede
creation_date: 2022-02-08T16:35:19Z

[Term]
id: XCO:0000924
name: isolated lung perfusion with floxuridine
def: "This is an experimental condition consisting of right or left thoracotomy with cannulation of pulmonary artery and vein, perfusion via artery with a solution containing floxuridine, and collection of effluent from pulmonary vein to prevent systemic circulation of treatment or vehicle." [ISBN-13:9780781733908, PMID:7818325]
synonym: "isolated lung perfusion with FUDR" EXACT []
synonym: "PMID:7818325" EXACT []
is_a: XCO:0000875 ! isolated lung perfusion
is_a: XCO:0000876 ! floxuridine
created_by: slaulede
creation_date: 2022-02-08T16:41:10Z

[Term]
id: XCO:0000925
name: bumetanide
def: "Bumetanide is a member of the class of benzoic acids, and a diuretic used for treatment of edema associated with congestive heart failure, hepatic and renal disease." [CHEBI:3213]
synonym: "3-(Butylamino)-4-phenoxy-5-sulfamoylbenzoic aci" EXACT []
synonym: "Bumex" EXACT []
synonym: "Burinex" EXACT []
xref: MESH:D002034
xref: PMID:30385718
is_a: XCO:0000122 ! diuretic
created_by: slaulede
creation_date: 2022-03-01T17:38:17Z

[Term]
id: XCO:0000926
name: polyethylene glycol
def: "This is any condition in which the main influencing factor is a polyether compound, composed of repeating ethyleneoxy units, and derived from petroleum. Polyethylene glycol has many applications, including medical uses like in the composition of some laxatives." [CHEBI:46793, https://en.wikipedia.org/wiki/Polyethylene_glycol]
synonym: "PEG" EXACT []
synonym: "PEO" EXACT []
synonym: "POE" EXACT []
synonym: "poly(ethylene oxide)" EXACT []
synonym: "poly(oxyethylene)" EXACT []
synonym: "polyethylene oxide" EXACT []
synonym: "polyoxyethylene" EXACT []
xref: PMID:32084371
is_a: XCO:0000927 ! hydroxypolyether
created_by: slaulede
creation_date: 2022-03-07T11:51:41Z

[Term]
id: XCO:0000927
name: hydroxypolyether
def: "A hydroxyether compound containing more than one ether group." [CHEBI:46789]
xref: PMID:32084371
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulede
creation_date: 2022-03-07T11:58:38Z

[Term]
id: XCO:0000928
name: ColonLYTELY
def: "This is a colonoscopy prep composed of 5.9% Macrogol 3350 (polyethylene glycol) and electrolytes." [https://www.colonprep.com.au]
synonym: "Macrogol 3350" NARROW []
relationship: has_component XCO:0000926 ! polyethylene glycol
created_by: slaulede
creation_date: 2022-03-07T12:43:59Z

[Term]
id: XCO:0000929
name: controlled ColonLYTELY content drinking water
def: "Thia is a drink made up of water and a specified amount of ColonLYTELY (5.9% Macrogol 3350 solution) in which the amount of ColonLYTELY consumed is maintained at a specified level." [https://www.colonprep.com.au, PMID:32084371]
synonym: "controlled Macrogol 3350 content drinking water" NARROW []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000928 ! ColonLYTELY
created_by: slaulede
creation_date: 2022-03-07T12:52:46Z

[Term]
id: XCO:0000930
name: renal denervation
def: "This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and the kidneys. It is followed by painting of the renal blood vessels with a solution of 10% phenol." [https://www.merriam-webster.com/, ISBN-13:978-0781733908]
synonym: "denervation of kidneys" EXACT []
synonym: "RDN" EXACT []
synonym: "surgical denervation of kidneys" EXACT []
xref: PMID:15894899
is_a: XCO:0000373 ! surgical denervation
created_by: slaulede
creation_date: 2022-04-26T15:38:47Z

[Term]
id: XCO:0000931
name: celiac artery and superior mesenteric artery constriction
def: "This is any condition in which the main influencing factor is surgical narrowing of the lumen of the celiac artery and superior mesenteric artery." [https://www.merriam-webster.com/, ISBN-13:978-0781733908]
xref: PMID:15894899
is_a: XCO:0000596 ! blood vessel constriction
created_by: slaulede
creation_date: 2022-04-26T16:02:24Z

[Term]
id: XCO:0000932
name: vasopressin
def: "This is a family of cyclic nonapeptide hormones found in most mammals. Synthesized in the hypothalamus and stored in the post-pituitary, vasopressins play a key role in homeostasis, particularly in regulating the body's water content. Vasopressin acts as a vasoconstrictor to increase blood pressure, blood volume, and water reabsorption by the renal collecting ducts." [CHEBI:9937, MESH:D014667]
synonym: "ADH" EXACT []
synonym: "antidiuretic hormone" EXACT []
synonym: "AVP" EXACT []
is_a: XCO:0000228 ! peptide hormone
created_by: slaulede
creation_date: 2022-04-26T16:45:16Z

[Term]
id: XCO:0000933
name: argipressin
def: "This molecule is the predominant form of mammalian vasopressin (antidiuretic hormone). It is a nonapeptide containing an arginine at residue 8 and two disulfide-linked cysteines at residues of 1 and 6." [CHEBI:34543, MESH:D001127]
synonym: "Arg8-vasopressin" EXACT []
synonym: "arginine vasopressin" EXACT []
synonym: "arg-vasopressin" EXACT []
is_a: XCO:0000932 ! vasopressin
created_by: slaulede
creation_date: 2022-04-26T16:50:12Z

[Term]
id: XCO:0000934
name: bilateral renal denervation
def: "This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and both kidneys. It is followed by painting of the renal blood vessels with a solution of 10% phenol." [https://www.merriam-webster.com/, ISBN-13:978-0781733908]
synonym: "denervation of both kidneys" EXACT []
xref: PMID:15894899
is_a: XCO:0000930 ! renal denervation
created_by: slaulede
creation_date: 2022-04-28T16:36:07Z

[Term]
id: XCO:0000935
name: unilateral renal denervation
def: "This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and only one kidney, left or right. It is followed by painting of the renal blood vessels with a solution of 10% phenol." [https://www.merriam-webster.com/, ISBN-13:978-0781733908]
synonym: "denervation of a single kidney" EXACT []
xref: PMID:15894899
is_a: XCO:0000930 ! renal denervation
created_by: slaulede
creation_date: 2022-04-28T16:39:29Z

[Term]
id: XCO:0000936
name: left kidney denervation
def: "This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and the kidney on the left side of the body. It is followed by painting of the left side renal blood vessels with a solution of 10% phenol." [https://www.merriam-webster.com/, ISBN-13:978-0781733908]
synonym: "left side renal denervation" EXACT []
xref: PMID:15894899
is_a: XCO:0000935 ! unilateral renal denervation
created_by: slaulede
creation_date: 2022-04-28T16:47:06Z

[Term]
id: XCO:0000937
name: right kidney denervation
def: "This is the resection or complete surgical removal of the nerves that convey impulses between the central nervous system and the kidney on the right side of the body. It is followed by painting of the right side renal blood vessels with a solution of 10% phenol." [https://www.merriam-webster.com/, ISBN-13:978-0781733908]
synonym: "right side renal denervation" EXACT []
xref: PMID:15894899
is_a: XCO:0000935 ! unilateral renal denervation
created_by: slaulede
creation_date: 2022-04-28T16:51:47Z

[Term]
id: XCO:0000938
name: bovine serum albumin
def: "This is a serum albumin protein derived from cow blood. It is used as an enzyme-stabilizing agent, a blocking reagent, etc. for laboratory experiments." [https://en.wikipedia.org/wiki/Bovine_serum_albumin, ISBN-13:978-0781733908]
synonym: "BSA" EXACT []
synonym: "Fraction V" EXACT []
synonym: "https://en.wikipedia.org/wiki/Bovine_serum_albumin" EXACT []
xref: PMID:15894899
is_a: XCO:0000193 ! peptide/protein
created_by: slaulede
creation_date: 2022-04-28T17:42:46Z

[Term]
id: XCO:0000939
name: JTT-608
def: "This is a hypoglycemic drug which enhances glucose-stimulated insulin secretion." [PMID:10323602]
synonym: "4-(4beta-Methylcyclohexane-1-yl)-4-oxobutanoic acid" EXACT []
synonym: "4-(4-Methylcyclohexyl)-4-oxobutanoic acid" EXACT []
synonym: "Cyclohexanebutanoic acid, 4-methyl-gamma-oxo-, trans-" EXACT []
synonym: "trans&#8201;-&#8201;4&#8201;-&#8201;(4&#8201;-&#8201;methylcyclohexyl)&#8201;-&#8201;4&#8201;-&#8201;oxobutyric acid" EXACT []
is_a: XCO:0000251 ! secretagogue
is_a: XCO:0000407 ! hypoglycemic agent
created_by: slaulede
creation_date: 2022-05-02T16:49:07Z

[Term]
id: XCO:0000940
name: controlled ex vivo pancreas condition
def: "This is an experimental condition in which the internal or external environment of a pancreas, the combined endocrine/exocrine gland situated transversely behind the stomach, between the spleen and the duodenum, is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body." [https://www.merriam-webster.com/, ISBN-13:978-0781733908]
xref: PMID:10323602
is_a: XCO:0000464 ! controlled ex vivo organ condition
created_by: slaulede
creation_date: 2022-05-05T16:23:16Z

[Term]
id: XCO:0000941
name: controlled ex vivo pancreas perfusion
def: "This is an experimental condition consisting of perfusion of the isolated pancreas with some physiological buffer (consisting of controlled solute composition and specific flow rate) in through the celiac artery and out through a portal vein." [https://www.merriam-webster.com/, ISBN-13:978-0781733908]
xref: PMID:10323602
xref: PMID:1097860
is_a: XCO:0000940 ! controlled ex vivo pancreas condition
created_by: slaulede
creation_date: 2022-05-05T16:44:35Z

[Term]
id: XCO:0000942
name: controlled saxagliptin content diet
def: "A solid diet in which the amount of saxagliptin, an oral antidiabetic drug in the dipeptidyl peptidase-4 (DPP-4) inhibitor class, is maintained at a specified level." [https://en.wikipedia.org/wiki/Saxagliptin, https://www.merriam-webster.com/]
synonym: "controlled 3-hydroxyadamantylglycine-4,5-methanoprolinenitrile hydrate content diet" EXACT []
synonym: "controlled Onglyza content diet" EXACT []
xref: CHEBI:71272
xref: MESH:C502994
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0000632 ! saxagliptin
created_by: slaulede
creation_date: 2022-05-27T17:31:25Z

[Term]
id: XCO:0000943
name: controlled glucosamine content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of glucosamine in which the amount of glucosamine consumed is maintained at a specified level." [https://www.merriam-webster.com/]
synonym: "controlled 2-amino-2-deoxyglucose content drinking water" EXACT []
xref: CHEBI:5417
xref: PMID:22446865
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000557 ! glucosamine
created_by: slaulede
creation_date: 2022-06-03T16:16:44Z

[Term]
id: XCO:0000944
name: controlled alendronate content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of alendronate in which the amount of alendronate consumed is maintained at a specified level." [http://en.wikipedia.org/wiki/Alendronic_acid, https://www.merriam-webster.com/]
synonym: "controlled alendronic acid content drinking water" RELATED []
synonym: "controlled Fosamax content drinking water" EXACT []
synonym: "controlled sodium alendronate content drinking water" EXACT []
xref: PMID:22446865
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000474 ! alendronate
created_by: slaulede
creation_date: 2022-06-03T16:38:25Z

[Term]
id: XCO:0000945
name: controlled taxifolin content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of taxifolin in which the amount of taxifolin consumed is maintained at a specified level." [https://en.wikipedia.org/wiki/Taxifolin, https://www.merriam-webster.com/]
synonym: "controlled catechin hydrate content drinking water" EXACT []
synonym: "controlled DHQ content drinking water" EXACT []
synonym: "controlled dihydroquercetin content drinking water" EXACT []
xref: CHEBI:38747
xref: PMID:22446865
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000558 ! taxifolin
created_by: slaulede
creation_date: 2022-06-03T16:45:16Z

[Term]
id: XCO:0000946
name: midafotel
def: "This is a member of the class of piperazines that is piperazine substituted by a carboxy group at position 2R and a (1E)-1-phosphonoprop-1-en-3-yl group at position 4. It is an antagonist of N-methyl-D-aspartate receptors (NMDARs) and originally designed as a potential therapy for excitotoxicity, epilepsy or neuropathic pain." [CHEBI:180900, https://en.wikipedia.org/wiki/Midafotel]
synonym: "(2R4-[(2E)-3-phosphonoprop-2-en-1-yl]piperazine-2-carboxylic acid" EXACT []
synonym: "CPPene" EXACT []
synonym: "D-Cpp-ene" EXACT []
synonym: "SDZ EAA 494" EXACT []
xref: PMID:32507787
xref: pubchem.compound:6435801
is_a: XCO:0000947 ! NMDA receptor antagonist
created_by: slaulede
creation_date: 2022-06-09T14:54:14Z

[Term]
id: XCO:0000947
name: NMDA receptor antagonist
def: "This is a condition in which the main influencing factor is a drug or agent that inhibits the action of N-methyl-D-aspartate (NMDA) receptors. They tend to induce a state known as dissociative anesthesia, marked by catalepsy, amnesia, and analgesia, while side effects can include hallucinations, nightmares, and confusion. Due to their psychotomimetic effects, many NMDA receptor antagonists are used as recreational drugs." [CHEBI:60643]
synonym: "NMDAR antagonist" EXACT []
synonym: "N-methyl-D-aspartate receptor antagonist" EXACT []
xref: PMID:32507787
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulede
creation_date: 2022-06-09T15:08:40Z

[Term]
id: XCO:0000948
name: Ro 25-6981
def: "This is a condition in which the main influencing factor is a member of the class of piperidines that is 4-benzylpiperidine substituted by a 3-hydroxy-3-(4-hydroxyphenyl)-2-methylpropyl group at position 1 (the 1R,2S-stereoisomer). It is a potent antagonist of the GluN2B subunit of the N-methyl-D-aspartate (NMDA) receptor." []
synonym: "4-[(1R,2S)-3-(4-benzylpiperidin-1-yl)-1-hydroxy-2-methylpropyl]phenol" EXACT []
xref: MESH:C109643
xref: PMID:32507787
is_a: XCO:0000947 ! NMDA receptor antagonist
created_by: slaulede
creation_date: 2022-06-09T15:23:24Z

[Term]
id: XCO:0000949
name: PPDA
def: "This is any condition in which the main influencing factor is PPDA, a subtype-selective NMDA receptor antagonist that preferentially binds to GluN2C/GluN2D (NR2C/NR2D) containing receptors." [CHEBI:189866]
synonym: "(2S*,3R*)-1-(Phenanthren-2-carbonyl)piperazine-2,3-dicarboxylic acid" EXACT []
synonym: "cis-piperidine dicarboxylic acid" EXACT []
synonym: "Cis-PPDA" EXACT []
xref: CAS:684283-16-7
xref: PMID:32507787
is_a: XCO:0000947 ! NMDA receptor antagonist
created_by: slaulede
creation_date: 2022-06-09T15:28:58Z

[Term]
id: XCO:0000950
name: anticonvulsant
def: "This is any condition in which the main influencing factor is a drug or agent used to prevent seizures or reduce their severity. Anticonvulsants suppress the excessive rapid firing of neurons during seizures and prevent the spread of the seizure within the brain." [CHEBI:35623, https://en.wikipedia.org/wiki/Anticonvulsant]
synonym: "antiepileptic" EXACT []
synonym: "antiepileptic drug" EXACT []
synonym: "antiseizure drug" EXACT []
synonym: "Not4Curation" RELATED []
xref: MESH:D000927
xref: PMID:32507787
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: slaulede
creation_date: 2022-06-09T15:44:11Z

[Term]
id: XCO:0000951
name: 2,3-Dioxo-6-nitro-7-sulfamoylbenzo(f)quinoxaline
def: "This is a condition in which the main influencing factor is an AMPA and KA receptor antagonist and a neuroprotectant for cerebral ischemia." [MESH:C062865, PMID:32507787]
synonym: "6-nitro-7-sulfamoylbenzo(f)quinoxaline-2,3-dione" EXACT []
synonym: "NBQX" EXACT []
xref: CAS:118876-58-7
xref: CHEBI:31073
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0000950 ! anticonvulsant
created_by: slaulede
creation_date: 2022-06-09T15:57:30Z

[Term]
id: XCO:0000952
name: controlled perindopril content drinking water
def: "This is a condition in which the main influencing factor is a drink made up of water and a specified amount of perindopril consumed by an organism as part of an experiment. Perindopril is a nonsulfhydryl prodrug that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications. It is rapidly metabolized in the liver to perindoprilat, a potent, competitive inhibitor of ACE." [https://www.drugbank.ca/drugs/DB00790, https://www.merriam-webster.com/]
synonym: "controlled Aceon content drinking water" EXACT []
synonym: "controlled Coversum content drinking water" EXACT []
synonym: "controlled Coversyl content drinking water" EXACT []
xref: CHEBI:8024
xref: MESH:D020913
xref: PMID:12376396
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000588 ! perindopril
created_by: slaulede
creation_date: 2022-06-10T15:10:29Z

[Term]
id: XCO:0000953
name: controlled reserpine content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of reserpine consumed by an organism as part of an experiment. Reserpine is an indole alkaloid which irreversibly blocks the vesicular monoamine transporters (VMATs), SLC18A1 and SLC18A2, and has been used as both an antihypertensive drug and an antipsychotic drug." [https://en.wikipedia.org/wiki/Reserpine, https://www.drugbank.ca/drugs/DB00206]
synonym: "controlled Serpasil content drinking water" EXACT []
xref: CHEBI:28487
xref: PMID:21107278
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000550 ! reserpine
created_by: slaulede
creation_date: 2022-06-10T16:51:15Z

[Term]
id: XCO:0000954
name: glucosamine - alendronate
def: "This is a condition in which the main influencing factor is an aqueous mix of glucosamine and alendronic acid (the acid form of alendronate), two chemicals used to promote bone health." [PMID:22446865]
synonym: "GA" EXACT []
synonym: "glucosamine alendronate" EXACT []
xref: CHEBI:50647
xref: CHEBI:5417
relationship: has_component XCO:0000474 ! alendronate
relationship: has_component XCO:0000557 ! glucosamine
created_by: slaulede
creation_date: 2022-06-16T17:17:55Z

[Term]
id: XCO:0000955
name: controlled glucosamine - alendronate content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of glucosamine - alendronate in which the amount of glucosamine - alendronate consumed is maintained at a specified level." [https://www.merriam-webster.com/, PMID:22446865]
synonym: "CHEBI:50647" EXACT []
synonym: "CHEBI:5417" EXACT []
synonym: "controlled GA content drinking water" EXACT []
synonym: "controlled glucosamine alendronate content drinking water" EXACT []
is_a: XCO:0000943 ! controlled glucosamine content drinking water
is_a: XCO:0000944 ! controlled alendronate content drinking water
created_by: slaulede
creation_date: 2022-06-16T17:23:21Z

[Term]
id: XCO:0000956
name: artificial cerebrospinal fluid with 0.14 M sodium
def: "This is any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF) with a concentration of 0.14 M sodium ions. Artificial cerebrospinal fluid (aCSF) is a buffer solution prepared with a composition representative of cerebrospinal fluid." [https://en.wikipedia.org/wiki/Artificial_cerebrospinal_fluid, PMID:15458950]
synonym: "aCSF with 0.14 M Na+" EXACT []
synonym: "aCSF with 0.14 M sodium" EXACT []
synonym: "artificial cerebrospinal fluid with 0.14 M Na+" EXACT []
xref: PMID:15458950
is_a: XCO:0000830 ! artificial cerebrospinal fluid
created_by: slaulede
creation_date: 2022-06-30T16:30:19Z

[Term]
id: XCO:0000957
name: artificial cerebrospinal fluid with 0.15 M sodium
def: "This is any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF) with a concentration of 0.15 M sodium ions. Artificial cerebrospinal fluid (aCSF) is a buffer solution prepared with a composition representative of cerebrospinal fluid." [https://en.wikipedia.org/wiki/Artificial_cerebrospinal_fluid, PMID:15458950]
synonym: "aCSF with 0.15 M Na+" EXACT []
synonym: "aCSF with 0.15 M sodium" EXACT []
synonym: "artificial cerebrospinal fluid with 0.15 M Na+" EXACT []
xref: PMID:15458950
is_a: XCO:0000830 ! artificial cerebrospinal fluid
created_by: slaulede
creation_date: 2022-06-30T17:02:45Z

[Term]
id: XCO:0000958
name: artificial cerebrospinal fluid with 0.16 M sodium
def: "This is any condition in which the main influencing factor is artificial cerebrospinal fluid (aCSF) with a concentration of 0.16 M sodium ions. Artificial cerebrospinal fluid (aCSF) is a buffer solution prepared with a composition representative of cerebrospinal fluid." [https://en.wikipedia.org/wiki/Artificial_cerebrospinal_fluid, PMID:15458950]
synonym: "aCSF with 0.16 M Na+" EXACT []
synonym: "aCSF with 0.16 M sodium" EXACT []
synonym: "artificial cerebrospinal fluid with 0.16 M Na+" EXACT []
xref: PMID:15458950
is_a: XCO:0000830 ! artificial cerebrospinal fluid
created_by: slaulede
creation_date: 2022-06-30T17:07:23Z

[Term]
id: XCO:0000959
name: Guanabenz
def: "This is any condition in which the main influencing factor is a dichlorobenzene derivative that is a cell-permeable α2-adrenoceptor agonist used as an antihypertensive agent." [CHEBI:5553, MESH:D006143]
synonym: "2,6-Dichlorobenzylideneaminoguanidine" EXACT []
xref: PMID:15458950
is_a: XCO:0000673 ! alpha-adrenergic agonist
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulede
creation_date: 2022-07-11T17:40:30Z

[Term]
id: XCO:0000960
name: 10% CO2, 20% O2, 70% N2
def: "This is a condition in which the level of carbon dioxide (10%), oxygen (20%), and nitrogen (70%) in the air surrounding the organism or breathed by the organism is controlled as part of the experiment." [https://www.merriam-webster.com/, PMID:21421817]
xref: PMID:21421817
is_a: XCO:0000010 ! controlled air oxygen content
is_a: XCO:0000012 ! controlled air carbon dioxide content
is_a: XCO:0001403 ! controlled air nitrogen content
created_by: slaulede
creation_date: 2022-07-18T18:12:29Z

[Term]
id: XCO:0000961
name: controlled ex vivo heart condition
def: "This is an experimental condition in which the internal or external environment of a heart is experimentally manipulated or regulated, for example through perfusion, increased or decreased blood flow, etc. after removal from the body." [https://www.merriam-webster.com, ISBN-13:978-0781733908]
synonym: "controlled isolated heart condition" EXACT []
is_a: XCO:0000464 ! controlled ex vivo organ condition
created_by: slaulede
creation_date: 2022-10-10T11:29:50Z

[Term]
id: XCO:0000962
name: controlled ex vivo heart perfusion
def: "This is an experimental condition consisting of perfusion (retrograde or forward) of the isolated heart with some physiological buffer (consisting of controlled solute composition and specific flow rate) through the aorta. In retrograde perfusion the backwards pressure causes the aortic valve to shut, forcing the solution into the coronary vessels, which normally supply the heart tissue with blood." [https://www.harvardapparatus.com/physiology/isolated-organ-perfusion-studies/isolated-heart-perfusion-systems.html, https://www.merriam-webster.com]
synonym: "biventricular working heart perfusion" NARROW []
synonym: "Langendorff heart perfusion" NARROW []
synonym: "working (ejecting) heart perfusion" NARROW []
is_a: XCO:0000961 ! controlled ex vivo heart condition
created_by: slaulede
creation_date: 2022-10-10T12:35:44Z

[Term]
id: XCO:0000963
name: controlled NG-nitroarginine methyl ester content in acidified drinking water
def: "This is a drink made up of acidified water (pH 2.4-2.8) and a specified amount of the basic amino acid commonly known as L-NAME and used as a non-selective inhibitor of nitric oxide synthase, consumed by an organism as part of an experiment." [ISBN-13:978-0781733908, MESH:D019331]
synonym: "controlled L-NAME content in acidified drinking water" EXACT []
is_a: XCO:0000285 ! controlled NG-nitroarginine methyl ester content drinking water
created_by: slaulede
creation_date: 2022-10-18T11:24:31Z

[Term]
id: XCO:0000964
name: perfluorooctanoic acid
def: "This is any condition in which the main influencing factor is perfluorooctanoic acid, a fluoroalkanoic acid." [CHEBI:35549]
synonym: "pentadecafluorooctanoic acid" EXACT []
synonym: "perfluorinated octanoic acid" EXACT []
synonym: "PFOA" EXACT []
xref: https://www.cancer.org
xref: MESH:C023036
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000757 ! surfactant
is_a: XCO:0001559 ! per- and polyfluoroalkyl substances
created_by: slaulede
creation_date: 2023-02-14T11:34:01Z

[Term]
id: XCO:0000965
name: controlled in vitro cell condition
def: "This is any experimental condition in which cells derived from a multicellular organism are cultured and experimentally manipulated or regulated, for example through drug treatment or nutrient availability, in an artificial environment outside the living body." [https://www.merriam-webster.com, ISBN-13:978-0781733908]
synonym: "controlled petri dish condition" EXACT []
synonym: "controlled test tube condition" EXACT []
is_a: XCO:0000000 ! experimental condition
created_by: slaulede
creation_date: 2023-02-14T12:04:36Z

[Term]
id: XCO:0000966
name: controlled serum-free condition
def: "This is any experimental condition in which cultured cells are grown in a defined medium without added animal serum." [https://www.merriam-webster.com, ISBN-13:978-0781733908]
synonym: "condition of growth medium without serum" EXACT []
synonym: "serum starvation" EXACT []
is_a: XCO:0000965 ! controlled in vitro cell condition
created_by: slaulede
creation_date: 2023-02-14T12:17:04Z

[Term]
id: XCO:0000967
name: gastric bypass
def: "This is any condition in which the main influencing factor is a gastric bypass, a type of weight-loss surgery that involves creating a small pouch from the stomach and connecting the newly created pouch directly to the small intestine. After gastric bypass, swallowed food will go into this small pouch of stomach and then directly into the small intestine, thereby bypassing most of the stomach and the first section of the small intestine." [https://www.mayoclinic.org/tests-procedures/gastric-bypass-surgery/about/pac-20385189, https://www.merriam-webster.com]
synonym: "gastric bypass surgery" EXACT []
synonym: "Roux-en-Y gastric bypass" EXACT []
synonym: "Roux-en-Y gastric bypass surgery" EXACT []
is_a: XCO:0001436 ! gastrointestinal bypass
created_by: slaulede
creation_date: 2023-02-27T18:10:08Z

[Term]
id: XCO:0000968
name: experimental traumatic brain injury
def: "This is a condition induced by an experimental surgical procedure involving fluid percussion, cortical impact, or weight drop/impact acceleration to produce controlled injury to the surface of the brain." [PMID:21876530]
synonym: "experimental TBI" EXACT []
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulede
creation_date: 2023-02-27T18:45:54Z

[Term]
id: XCO:0000969
name: lateral fluid percussion injury
def: "This is an experimental injury condition produced by a pendulum-and-piston-based device applying a brief fluid pressure pulse onto the intact dura after performing a craniectomy on the head of the subject." [PMID:19022291, PMID:21876530]
synonym: "lateral fluid-percussion injury" EXACT []
synonym: "LFPI" EXACT []
synonym: "parasagittal fluid percussion injury" EXACT []
is_a: XCO:0000968 ! experimental traumatic brain injury
created_by: slaulede
creation_date: 2023-03-02T13:40:02Z

[Term]
id: XCO:0000970
name: protein kinase inhibitor
def: "This is any condition in which the main influencing factor is a chemical which decreases or interferes with the activity of a protein kinase inhibitor. A protein kinase is an enzyme that regulates the biological activity of proteins by phosphorylation of specific amino acids with ATP as the source of phosphate, thereby inducing a conformational change from an inactive to an active form of the protein." [https://en.wikipedia.org/wiki/Protein_kinase, https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/protein-kinases]
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulede
creation_date: 2023-03-02T14:39:02Z

[Term]
id: XCO:0000971
name: SB525334
def: "This is any condition in which the main influencing factor is the chemical SB525334, which decreases or interferes with the activity of the serine/threonine protein kinase Alk5 (activin receptor-like kinase-5)." [RGD:733386]
synonym: "6-(2-(tert-Butyl)-5-(6-methylpyridin-2-yl)-1H-imidazol-4-yl)quinoxaline" EXACT []
synonym: "SB 525334" EXACT []
synonym: "SB-525334" EXACT []
synonym: "TGF- beta RI Kinase Inhibitor VIII" EXACT []
xref: CID:9967941
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulede
creation_date: 2023-03-02T14:58:14Z

[Term]
id: XCO:0000972
name: nintedanib
def: "This is any condition in which the main influencing factor is the chemical nintedanib, a member of the class of oxindoles that is a multi-kinase inhibitor used for the treatment of idiopathic pulmonary fibrosis and cancer." [CHEBI:85164]
synonym: "(Z)-Methyl 3-(((4-(N-methyl-2-(4-methylpiperazin-1-yl)acetamido)phenyl)amino)(phenyl)methylene)-2-oxoindoline-6-carboxylate" EXACT []
synonym: "Intedanib" EXACT []
synonym: "methyl (3Z)-3-[(4-{methyl[(4-methylpiperazin-1-yl)acetyl]amino}anilino)(phenyl)methylidene]-2-oxo-2,3-dihydro-1H-indole-6-carboxylate" EXACT []
synonym: "Ofev" EXACT []
synonym: "Vargatef" EXACT []
xref: MESH:C530716
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulede
creation_date: 2023-03-02T15:05:33Z

[Term]
id: XCO:0000973
name: sorafenib
def: "This is any condition in which the main influencing factor is the chemical sorafenib, a member of the class of phenylureas that are multi-kinase inhibitors and anti-neoplastic agents." [CHEBI:50924]
synonym: "4-(4-(3-(4-CHLORO-3-(TRIFLUOROMETHYL)PHENYL)UREIDO)PHENOXY)-N-METHYLPICOLINAMIDE" EXACT []
synonym: "4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide" EXACT []
synonym: "BAY 43-9006" EXACT []
synonym: "Nexavar" EXACT []
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulede
creation_date: 2023-03-02T15:15:18Z

[Term]
id: XCO:0000974
name: bile duct ligation
def: "This is a condition in which the main influencing factor is a surgical procedure causing blockage of the bile duct by suture ligation, which leads to acute obstructive jaundice and eventually to liver fibrosis." [https://www.sciencedirect.com/topics/medicine-and-dentistry/bile-duct-ligation]
synonym: "CBDL" EXACT []
synonym: "common bile duct ligation" EXACT []
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulede
creation_date: 2023-03-02T15:29:13Z

[Term]
id: XCO:0000975
name: carbon tetrachloride
def: "This is any condition in which the main influencing factor is carbon tetrachloride, a chlorocarbon that is methane in which all the hydrogens have been replaced by chloro groups. It is a solvent for oils, fats, lacquers, varnishes, rubber waxes, and resins, and a starting material in the manufacturing of organic compounds." [CHEBI:27385, MESH:D002251]
synonym: "CCl4" EXACT []
synonym: "tetrachloromethane" EXACT []
xref: CHEBI:27385
xref: MESH:D002251
is_a: XCO:0000239 ! toxic substance
is_a: XCO:0001231 ! solvent
created_by: slaulede
creation_date: 2023-03-06T12:33:48Z

[Term]
id: XCO:0000976
name: trichlorethylene
def: "This is a chloroethene that is ethene substituted by chlorides at positions 1, 1 and 2. It is a highly volatile inhalation anesthetic used mainly in short surgical procedures where light anesthesia with good analgesia is required. It is also used as an industrial solvent." [CHEBI:16602, MESH:D014241]
synonym: "1,1,2-trichloroethene" EXACT []
synonym: "trichloroethene" EXACT []
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000276 ! hydrocarbon
created_by: slaulede
creation_date: 2023-03-06T13:54:06Z

[Term]
id: XCO:0000977
name: supplemented Williams' E Medium
def: "This is any experimental condition in which cells derived from a multicellular organism are cultured in medium enriched in amino acids, glucose, and other unique ingredients and supplemented with dexamethasone, penicillin/streptomycin, ITS+, GlutaMAX and HEPES; Gibco #CM4000. William's E Medium was originally developed by Williams and Gunn as reduced serum-supplemented medium for long-term cell cultures of adult rat liver epithelial cells." [https://www.thermofisher.com/order/catalog/product/12551032, PMID:31501904]
synonym: "supplemented William’s E Medium" EXACT []
xref: PMID:31501904
is_a: XCO:0000965 ! controlled in vitro cell condition
created_by: slaulede
creation_date: 2023-03-06T14:19:01Z

[Term]
id: XCO:0000978
name: acetyl-L-carnitine
def: "This is any condition in which the main influencing factor is an acetylated form of L-carnitine. It is naturally produced by the human body, and it is available as a dietary supplement. Acetyl-L-carnitine is broken down in the blood by plasma esterases to carnitine which is used by the body to transport fatty acids into the mitochondria for breakdown." [https://en.wikipedia.org/wiki/Acetylcarnitine]
synonym: "acetylcarnitine" EXACT []
synonym: "ALC" EXACT []
synonym: "ALCAR" EXACT []
synonym: "LAC" EXACT []
synonym: "L-ACETYLCARNITINE" EXACT []
synonym: "L-acetyl-carnitine" EXACT []
synonym: "O-Acetyl-L-carnitine" EXACT []
xref: CHEBI:57589
xref: MESH:D000108
is_a: XCO:0000561 ! antidepressant
created_by: slaulede
creation_date: 2023-03-09T13:05:38Z

[Term]
id: XCO:0000979
name: controlled acetyl-L-carnitine content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of acetyl-L-carnitine in which the amount of acetyl-L-carnitine consumed is maintained at a specified level." [https://www.merriam-webster.com, ISBN-13:978-0781733908]
synonym: "controlled acetylcarnitine content drinking water" EXACT []
synonym: "controlled ALCAR content drinking water" EXACT []
synonym: "controlled ALC content drinking water" EXACT []
synonym: "controlled LAC content drinking water" EXACT []
synonym: "controlled L-acetyl-carnitine content drinking water" EXACT []
synonym: "controlled L-ACETYLCARNITINE L-ACETYLCARNITINE content drinking water" EXACT []
synonym: "controlled O-Acetyl-L-carnitine content drinking water" EXACT []
xref: CHEBI:57589
xref: MESH:D000108
is_a: XCO:0000163 ! controlled content drinking water
is_a: XCO:0000978 ! acetyl-L-carnitine
created_by: slaulede
creation_date: 2023-03-09T13:19:08Z

[Term]
id: XCO:0000980
name: controlled content gelled diet
def: "This is an experimental regimen of gelled food in which the amount of solid elements, water, and some other component(s) in the diet are controlled." [https://www.merriam-webster.com, PMID:12684228]
synonym: "controlled content gel-agar diet" RELATED []
synonym: "controlled content gel diet" EXACT []
synonym: "controlled content semisolid diet" RELATED []
is_a: XCO:0000916 ! gelled diet
created_by: slaulede
creation_date: 2023-03-09T13:43:10Z

[Term]
id: XCO:0000981
name: controlled lithium chloride content gelled diet
def: "This is an experimental regimen of gelled food in which the amount of solid elements, water, and lithium chloride in the diet are controlled." [PMID:12684228, PMID:31146973]
synonym: "controlled LiCl content gelled diet" EXACT []
is_a: XCO:0000980 ! controlled content gelled diet
created_by: slaulede
creation_date: 2023-03-09T13:47:41Z

[Term]
id: XCO:0000982
name: gene transfer using a lentivirus vector
def: "This is a condition in which gene transfer has been performed using a lentivirus as the carrier of the genetic material. Lentivirus is a genus of retroviruses that cause chronic and deadly diseases characterized by long incubation periods, in humans and other mammalian species. Lentiviruses are distributed worldwide, and are known to be hosted in apes, cows, goats, horses, cats, and sheep as well as several other mammals." [https://en.wikipedia.org/wiki/Lentivirus, ISBN-13:978-0781733908]
synonym: "lentiviral gene transfer" EXACT []
synonym: "lentivirus transfer" EXACT []
is_a: XCO:0000528 ! gene transfer
created_by: slaulede
creation_date: 2023-03-13T13:28:54Z

[Term]
id: XCO:0000983
name: gene transfer of the EGFP gene using a lentivirus vector
def: "This is a condition in which the enhanced green fluorescent protein (EGFP) gene has been (transiently or stably) transferred into a cell or organism using an lentivirus carrier in order to induce synthesis of EGFP in the recipient cell or organism." [https://www.merriam-webster.com, PMID:28241067]
synonym: "gene transduction of the enhanced green fluorescent protein gene using a lentivirus vector" EXACT []
synonym: "gene transfer of the eGFP gene using a lentivirus vector" EXACT []
synonym: "gene transfer of the enhanced green fluorescent protein gene using a lentivirus vector" EXACT []
synonym: "lentiviral transfer of the EGFP gene" EXACT []
synonym: "transduction of recombinant lentivirus containing the EGFP gene" EXACT []
synonym: "transfer of recombinant lentivirus containing the EGFP gene" EXACT []
is_a: XCO:0000982 ! gene transfer using a lentivirus vector
created_by: slaulede
creation_date: 2023-03-13T13:41:04Z

[Term]
id: XCO:0000984
name: gene transfer of the rat wild type Ccny gene using a lentivirus vector
def: "This is a condition in which the rat wild type cyclin Y gene (Ccny) has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of rat cyclin Y in the recipient cell or organism." [PMID:26220330]
synonym: "lentiviral transfer of the rat wild type Ccny gene" EXACT []
synonym: "transfer of recombinant lentivirus containing the rat wild type Ccny gene" EXACT []
is_a: XCO:0000982 ! gene transfer using a lentivirus vector
created_by: slaulede
creation_date: 2023-03-13T14:07:11Z

[Term]
id: XCO:0000985
name: transfer of rat wild type Ccny-specific shRNA using a lentivirus vector
def: "This is a condition in which the rat wild type cyclin Y gene short hairpin RNA (Ccny-shRNA) has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to reduce synthesis of rat wild type cyclin Y in the recipient cell or organism." [https://www.merriam-webster.com, PMID:28241067]
synonym: "lentiviral transfer of the rat wild type Ccny-specific shRNA" EXACT []
synonym: "transduction of recombinant lentivirus containing the rat wild type Ccny-specific shRNA" EXACT []
synonym: "transfer of recombinant lentivirus containing the rat wild type-specific shRNA" EXACT []
is_a: XCO:0001537 ! transfer of shRNA using a lentivirus vector
created_by: slaulede
creation_date: 2023-03-13T14:27:37Z

[Term]
id: XCO:0000986
name: transfer of the rat wild type Ccny-specific shRNA and EGFP gene using a lentivirus vector
def: "This is a condition in which the rat wild type cyclin Y gene short hairpin RNA (Ccny-shRNA) and enhanced green fluorescent protein (EGFP) gene have been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to reduce synthesis of rat wild type cyclin Y while inducing EGFP synthesis in the recipient cell or organism." [https://www.merriam-webster.com, PMID:28241067]
synonym: "lentiviral transfer of the rat wild type Ccny-specific shRNA and the EGFP gene" EXACT []
synonym: "transduction of recombinant lentivirus containing the rat wild type-specific shRNA and the EGFP gene" EXACT []
synonym: "transfer of recombinant lentivirus containing the rat wild type-specific shRNA and the EGFP gene" EXACT []
is_a: XCO:0000983 ! gene transfer of the EGFP gene using a lentivirus vector
is_a: XCO:0000985 ! transfer of rat wild type Ccny-specific shRNA using a lentivirus vector
created_by: slaulede
creation_date: 2023-03-13T14:36:52Z

[Term]
id: XCO:0000987
name: gene transfer of the rat wild type Ccny gene and EGFP gene using a lentivirus vector
def: "This is a condition in which the rat wild type cyclin Y gene (Ccny-WT) and enhanced green fluorescent protein (EGFP) gene have been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of both rat wild type cyclin Y and EGFP in the recipient cell or organism." [https://www.merriam-webster.com, PMID:28241067]
synonym: "lentiviral transfer of the rat wild type Ccny gene and the EGFP gene" EXACT []
synonym: "transduction of recombinant lentivirus containing the rat wild type Ccny gene and the EGFP gene" EXACT []
synonym: "transfer of recombinant lentivirus containing the rat wild type Ccny gene and the EGFP gene" EXACT []
is_a: XCO:0000983 ! gene transfer of the EGFP gene using a lentivirus vector
is_a: XCO:0000984 ! gene transfer of the rat wild type Ccny gene using a lentivirus vector
created_by: slaulede
creation_date: 2023-03-13T14:42:14Z

[Term]
id: XCO:0000988
name: Dulbecco's Modified Eagle's Medium
def: "This is any experimental condition in which the main influencing factor is Dulbecco's Modified Eagle's Medium. Typically, cells derived from a multicellular organism are cultured in this synthetic medium originally formulated by Dulbecco and Freeman and based on Eagle's Minimal Essential Medium." [https://en.wikipedia.org/wiki/Eagle%27s_minimal_essential_medium, https://www.thermofisher.com/us/en/home/technical-resources/media-formulation.48.html]
synonym: "DMEM" EXACT []
synonym: "DMEM, low glucose, pyruvate" NARROW []
is_a: XCO:0000966 ! controlled serum-free condition
created_by: slaulede
creation_date: 2023-03-14T11:55:08Z

[Term]
id: XCO:0000989
name: fetal bovine serum
def: "This is any experimental condition in which the main influencing factor is fetal bovine serum. Fetal bovine serum is the most widely used serum-supplement for the in vitro cell culture of eukaryotic cells. Fetal bovine serum is derived from the blood drawn from a bovine fetus via a closed system of collection at a slaughterhouse." [https://en.wikipedia.org/wiki/Fetal_bovine_serum, PMID:13598821]
synonym: "FBS" EXACT []
synonym: "fetal calf serum" EXACT []
relationship: part_of XCO:0000965 ! controlled in vitro cell condition
created_by: slaulede
creation_date: 2023-03-14T12:20:39Z

[Term]
id: XCO:0000990
name: Neurobasal medium
def: "This is any experimental condition in which the main influencing factor is Neurobasal medium, a culture medium formulated to meet the special requirements of neuronal cells. This medium allows for the long-term maintenance of normal phenotype and growth of neuronal cells, and the maintenance of pure populations of neuronal cells without the need of an astrocyte feeder layer." [https://www.thermofisher.com/us/en/home/technical-resources/media-formulation.251.html]
xref: PMID:26640375
is_a: XCO:0000966 ! controlled serum-free condition
created_by: slaulede
creation_date: 2023-03-14T12:39:34Z

[Term]
id: XCO:0000991
name: GlutaMAX-I
def: "This is any experimental condition in which the main influencing factor is GlutaMAX-I, a dipeptide (L-alanyl-L-glutamine) substitute for L-glutamine that can be used as a direct substitute for L-Glutamine at equimolar concentrations in mammalian and stem cell culture with minimal or no adaptation. L-alanyl-L-glutamine eliminates problems associated with the spontaneous breakdown of L-glutamine during incubation, is highly soluble in aqueous solution, and is heat stable." [https://www.fishersci.com]
synonym: "L-alanyl-L-glutamine" EXACT []
xref: PMID:26640375
relationship: part_of XCO:0000965 ! controlled in vitro cell condition
created_by: slaulede
creation_date: 2023-03-14T14:17:15Z

[Term]
id: XCO:0000992
name: B-27
def: "This is any experimental condition in which the main influencing factor is B-27, an optimized serum-free supplement used to support the low- or high-density growth and short- or long-term viability of embryonic, post-natal, and adult hippocampal and other CNS neurons. It is meant to supplement a basal medium such as Neurobasal medium." [https://www.thermofisher.com/order/catalog/product/17504044]
xref: PMID:26640375
relationship: part_of XCO:0000965 ! controlled in vitro cell condition
created_by: slaulede
creation_date: 2023-03-14T14:27:51Z

[Term]
id: XCO:0000993
name: controlled humidity
def: "This is any experimental condition in which the main influencing factor is a controlled level of moisture in the air provided to an organism, ex vivo tissue, or cultured cells." [https://www.merriam-webster.com]
synonym: "air H2O content" EXACT []
synonym: "controlled H2O content air" EXACT []
synonym: "controlled water content air" EXACT []
xref: PMID:26640375
is_a: XCO:0000009 ! controlled air content
created_by: slaulede
creation_date: 2023-03-14T14:39:30Z

[Term]
id: XCO:0000994
name: StemPro NSC SFM
def: "This is any experimental condition in which the main influencing factor is StemPro NSC SFM, a serum-free culture medium formulated to meet the special requirements of neuronal stem cells. This medium supports expansion of both adherent and spheroid cultures, and differentiation capability into astrocytes, oligodendrocytes and neurons." [https://www.thermofisher.com/order/catalog/product/A1050901]
synonym: "neuralstem cell serum free medium" EXACT []
xref: PMID:2664037
is_a: XCO:0000966 ! controlled serum-free condition
created_by: slaulede
creation_date: 2023-03-14T14:52:39Z

[Term]
id: XCO:0000995
name: PDGF-AA
def: "This is any experimental condition in which the main influencing factor is a dimeric isoform of platelet-derived growth factor (PDGF-AA). All PDGF isoforms are potent mitogens for connective tissue cells, including dermal fibroblasts, glial cells, arterial smooth muscle cells and some epithelial and endothelial cells. PDGF appears to be ubiquitous in neurons throughout the CNS, where it is suggested to play an important role in neuron survival and regeneration, and in mediation of glial cell proliferation and differentiation." [https://www.thermofisher.com/antibody/product/Human-PDGF-AA-Animal-Free-Recombinant-Protein/AF-100-13A-1MG]
synonym: "platelet-derived growth factor-AA" EXACT []
synonym: "platelet-derived growth factor-AA isoform" EXACT []
synonym: "platelet-derived growth factor-alpha/alpha isoform" EXACT []
xref: PMID:26640375
relationship: part_of XCO:0000965 ! controlled in vitro cell condition
created_by: slaulede
creation_date: 2023-03-14T15:14:58Z

[Term]
id: XCO:0000996
name: transfer of CHAER1 siRNA using Lipofectamine reagent
def: "This is any condition in which the main influencing factor is CHAER1 (cardiac hypertrophy associated epigenetic regulator 1) siRNA (small interfering RNA) transfected by Lipofectamine. Small interfering RNA (siRNA) is a class of double-stranded RNA (20-24bp) that acts in the RNA interference pathway, by interfering with the expression of genes with complementary nucleotide sequence to that of siRNA, inducing mRNA degradation. CHAER1 is an ncRNA involved in epigenetic regulation of gene expression. Lipofectamine is a proprietary formulation for transfecting small RNAs into cultured eukaryotic cells." [https://en.wikipedia.org/wiki/Small_interfering_RNA, https://www.thermofisher.com/us/en/home/life-science/cell-culture/transfection/transfection-reagents/lipofectamine-rnaimax-reagent.html]
synonym: "transfection of CHAER1 short interfering RNA using Lipofectamine reagent" EXACT []
synonym: "transfection of CHAER1 silencing RNA using Lipofectamine reagent" EXACT []
synonym: "transfection of CHAER1 siRNA using Lipofectamine reagent" EXACT []
synonym: "transfection of CHAER1 small interfering RNA using Lipofectamine reagent" EXACT []
xref: PMID:27618650
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulede
creation_date: 2023-03-23T13:58:48Z

[Term]
id: XCO:0000997
name: transfer of negative control siRNA using Lipofectamine reagent
def: "This is any condition in which the main influencing factor is transfer of negative control siRNA (small interfering RNA) delivered with Lipofectamine. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences. Lipofectamine is a proprietary formulation for transfecting small RNAs into cultured eukaryotic cells." [https://en.wikipedia.org/wiki/Small_interfering_RNA, https://www.thermofisher.com/us/en/home/life-science/cell-culture/transfection/transfection-reagents/lipofectamine-rnaimax-reagent.html]
synonym: "transfection of negative control short interfering RNA using Lipofectamine reagent" EXACT []
synonym: "transfection of negative control silencing RNA using Lipofectamine reagent" EXACT []
synonym: "transfection of negative control siRNA using Lipofectamine reagent" EXACT []
synonym: "transfection of negative control small interfering RNA using Lipofectamine reagent" EXACT []
xref: PMID:27618650
is_a: XCO:0001510 ! transfer of negative control siRNA
created_by: slaulede
creation_date: 2023-03-23T14:11:37Z

[Term]
id: XCO:0000998
name: controlled breathing condition
def: "This is any condition in which the main influencing factor is control of the process of breathing, whether by the control of the volume of air breathed or by control of the contents of the breathed air. This may be for the treatment of disease or for the experimental study of physiology or pathology." [https://www.merriam-webster.com]
is_a: XCO:0000000 ! experimental condition
created_by: slaulede
creation_date: 2023-03-23T14:43:17Z

[Term]
id: XCO:0000999
name: mechanical ventilation
def: "This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator. The controlled parameters may be volume, pressure, and/or air component content." [https://my.clevelandclinic.org/health/treatments/15368-mechanical-ventilation, ISBN-13:978-0781733908]
synonym: "controlled mechanical ventilation" EXACT []
is_a: XCO:0000998 ! controlled breathing condition
created_by: slaulede
creation_date: 2023-03-23T14:49:38Z

[Term]
id: XCO:0001000
name: mechanical ventilation with assist/control
def: "This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator with assist/control (A/C), meaning the breathing rate is set and the tidal volume or pressure is set. When the subject triggers a breath, a full set tidal volume (or pressure) breath is delivered. When the vent delivers a subject-triggered breath, the next breath is timed in relation to this." [https://ventbasics.com/modes/modes-overview/, ISBN-13:978-0781733908]
synonym: "A/C" EXACT []
synonym: "assist/control" EXACT []
synonym: "volume controlled ventilation" NARROW []
synonym: "volume-controlled ventilation with constant tidal volumes" NARROW []
is_a: XCO:0000999 ! mechanical ventilation
created_by: slaulede
creation_date: 2023-03-23T15:26:05Z

[Term]
id: XCO:0001001
name: synchronized intermittent mandatory ventilation
def: "This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator with synchronized intermittent mandatory ventilation, meaning the breathing rate is set and the tidal volume is set with pressure support. The subject receives a set minimum number of breaths (the set rate) and any additional breaths are determined by the subject." [https://ventbasics.com/modes/modes-overview/, ISBN-13:978-0781733908]
synonym: "SIMV" EXACT []
is_a: XCO:0000999 ! mechanical ventilation
created_by: slaulede
creation_date: 2023-03-23T15:36:28Z

[Term]
id: XCO:0001002
name: variable ventilation
def: "This is any condition in which the main influencing factor is control of the process of breathing by a mechanical ventilator using variable tidal volume, or variable pressure support, and/or variable respiratory rate." [ISBN-13:978-0781733908, PMID:26979175]
synonym: "mechanical ventilation with variable tidal volume" NARROW []
is_a: XCO:0000999 ! mechanical ventilation
created_by: slaulede
creation_date: 2023-03-23T17:26:15Z

[Term]
id: XCO:0001003
name: magnetic field
def: "This is any condition in which the main influencing factor is a magnetic field, a vector field in the neighborhood of a magnet, electric current, or changing electric field in which magnetic forces are observable." [https://byjus.com/physics/, https://www.merriam-webster.com]
xref: PMID:24407149
is_a: XCO:0000965 ! controlled in vitro cell condition
created_by: slaulede
creation_date: 2023-03-24T14:19:32Z

[Term]
id: XCO:0001004
name: uniform magnetic field
def: "This is any condition in which the main influencing factor is a uniform magnetic field. A uniform magnetic field may be generated by an apparatus such as a Halbach cylinder. A Halbach cylinder is a magnetized cylinder composed of ferromagnetic material which can produce a uniform magnetic field across a plate of cultured cells which is surrounded by the cylinder." [https://en.wikipedia.org/wiki/Halbach_array, https://en.wikipedia.org/wiki/Magnetism]
xref: PMID:24407149
is_a: XCO:0001003 ! magnetic field
created_by: slaulede
creation_date: 2023-03-24T14:51:33Z

[Term]
id: XCO:0001005
name: transfer of PIWIL1 siRNA using pSUPER plasmid
def: "This is any condition in which the main influencing factor is PIWIL1 (piwi-like RNA-mediated gene silencing 1) siRNA. The PIWIL1 protein may play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. The pSUPER plasmid was designed for eukaryotic expression/RNAi." [https://www.addgene.org, PMID:26104391]
synonym: "PIWIL1 siRNA transfection" BROAD []
synonym: "transfection of PIWIL1 siRNA using pSUPER plasmid" EXACT []
xref: PMID:26104391
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulede
creation_date: 2023-03-28T17:14:00Z

[Term]
id: XCO:0001006
name: transfer of negative control siRNA using pSUPER plasmid
def: "This is any condition in which the main influencing factor is negative control siRNA delivered with a pSUPER plasmid. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental siRNA used." [https://www.addgene.org, PMID:26104391]
synonym: "negative control siRNA transfection" BROAD []
synonym: "scrambled siRNA transfection" BROAD []
synonym: "transfection of negative control siRNA using pSUPER plasmid" EXACT []
is_a: XCO:0001510 ! transfer of negative control siRNA
created_by: slaulede
creation_date: 2023-03-28T17:21:28Z

[Term]
id: XCO:0001007
name: transfer of negative control shRNA using a lentivirus vector
def: "This is any condition in which the main influencing factor is negative control shRNA delivered with a lentivirus vector. Negative control shRNA is an shRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental shRNA used." [https://www.origene.com/products/cdna-clones/lentiviral-particles/control-particles, PMID:31606248]
synonym: "transduction of negative control shRNA using a lentivirus" EXACT []
synonym: "transduction of negative control shRNA using a lentivirus vector" EXACT []
synonym: "transfer of negative control shRNA using a lentiviral vector" EXACT []
is_a: XCO:0001537 ! transfer of shRNA using a lentivirus vector
created_by: slaulede
creation_date: 2023-03-31T11:00:04Z

[Term]
id: XCO:0001008
name: transfer of Pum2 shRNA using a lentivirus vector
def: "This is any condition in which the main influencing factor is Pum2 (pumilio RNA-binding family member 2) shRNA. Pum2 is a protein that exhibits lncRNA binding, miRNA binding, and mRNA 3'-UTR binding. Pum2 is involved in negative regulation of gene expression and regulation of intracellular mRNA localization." [https://blog.addgene.org, PMID:31606248]
synonym: "transduction of Pum2 shRNA using a lentivirus" EXACT []
synonym: "transduction of Pum2 shRNA using a lentivirus vector" EXACT []
synonym: "transfer of Pum2 shRNA using a lentiviral vector" EXACT []
is_a: XCO:0001537 ! transfer of shRNA using a lentivirus vector
created_by: slaulede
creation_date: 2023-03-31T11:37:24Z

[Term]
id: XCO:0001009
name: Media 199
def: "This is any experimental condition in which the main influencing factor is M199 medium, which is useful across a wide range of species and applications but is particularly suitable for the culturing of non-transformed cells. M199 medium ingredients may include Earle’s salts and a bicarbonate/carbonic acid buffering system for the maintenance of pH in a CO2 incubator or Hank’s salts with salt solutions designed for atmospheric equilibrium." [https://www.thermofisher.com]
synonym: "M199" EXACT []
synonym: "M199 media" EXACT []
synonym: "M199 medium" EXACT []
synonym: "Medium 199" EXACT []
xref: PMID:31283468
is_a: XCO:0000966 ! controlled serum-free condition
created_by: slaulede
creation_date: 2023-04-06T12:56:12Z

[Term]
id: XCO:0001010
name: glutamine
def: "This is any experimental condition in which the main influencing factor is glutamine, an alpha-amino acid that consists of butyric acid bearing an amino substituent at position 2 and a carbamoyl substituent at position 4. Glutamine is used as a supplement in cell culture media." [CHEBI:28300, https://www.merriam-webster.com]
synonym: "L-glutamine" EXACT []
xref: CHEBI:28300
is_a: XCO:0000119 ! amino acid
relationship: part_of XCO:0000965 ! controlled in vitro cell condition
created_by: slaulede
creation_date: 2023-04-06T13:12:19Z

[Term]
id: XCO:0001011
name: penicillin-streptomycin
def: "This is any experimental condition in which the main influencing factor is a mixture of penicillin G and streptomycin (penicillin-streptomycin) that is widely used in mammalian cell culture media to prevent bacterial contamination. The solution contains 5,000 units of penicillin G (sodium salt) which acts as the active base, and 5,000 micrograms of streptomycin (sulfate) (base per milliliter), formulated in 0.85% saline." [https://en.wikipedia.org/wiki/Pen-Strep]
synonym: "Pen-Strep" EXACT []
xref: PMID:31283468
relationship: has_component XCO:0001202 ! penicillin
relationship: part_of XCO:0000965 ! controlled in vitro cell condition
created_by: slaulede
creation_date: 2023-04-06T13:28:20Z

[Term]
id: XCO:0001012
name: gene transfer of the rat Rbpms gene using a lentivirus vector
def: "This is a condition in which the rat Rbpms (RNA binding protein, mRNA processing factor) gene has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of Rbpms in the recipient cell or organism." [https://www.merriam-webster.com, PMID:31283468]
synonym: "gene transfer of rat Rbpms using a lentivirus vector" EXACT []
synonym: "gene transfer of the rat Rbpms gene using a lentiviral vector" EXACT []
synonym: "transduction of rat Rbpms using a lentiviral vector" EXACT []
synonym: "transduction of rat Rbpms using a lentivirus vector" EXACT []
is_a: XCO:0000982 ! gene transfer using a lentivirus vector
created_by: slaulede
creation_date: 2023-04-06T14:09:22Z

[Term]
id: XCO:0001013
name: transfer of rat RBPMS siRNA using a lentivirus vector
def: "This is any condition in which the main influencing factor is rat RBPMS (RNA binding protein, mRNA processing factor)-specific siRNA. This siRNA has been transferred into a cell or organism using a lentivirus carrier in order to block synthesis of RBPMS in the recipient cell or organism." [https://en.wikipedia.org/wiki/Small_interfering_RNA, PMID:31283468]
synonym: "transduction of RBPMS siRNA using a lentivirus vector" EXACT []
synonym: "transfer of rat RBPMS short interfering RNA using a lentivirus vector" EXACT []
synonym: "transfer of rat RBPMS siRNA using a lentiviral vector" EXACT []
synonym: "transfer of rat RBPMS small interfering RNA using a lentivirus vector" EXACT []
xref: PMID:31283468
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulede
creation_date: 2023-04-06T14:34:10Z

[Term]
id: XCO:0001014
name: transfer of negative control siRNA using a lentiviral vector
def: "This is any condition in which the main influencing factor is negative control siRNA delivered with a lentivirus vector. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental siRNA used." [https://www.origene.com/products/cdna-clones/lentiviral-particles/control-particles, PMID:31283468]
synonym: "transduction of negative control siRNA using a lentivirus" EXACT []
synonym: "transduction of negative control siRNA using a lentivirus vector" EXACT []
synonym: "transfer of negative control siRNA using a lentivirus" EXACT []
is_a: XCO:0001510 ! transfer of negative control siRNA
created_by: slaulede
creation_date: 2023-04-06T14:42:17Z

[Term]
id: XCO:0001015
name: myectomy
def: "This is any condition in which the main influencing factor is creating a volumetric muscle loss (VML) of 20% or more of the total amount of mass in the targeted muscle through surgical removal (myectomy)." [https://study.com/, PMID:34146835]
xref: PMID:29531830
is_a: XCO:0000026 ! surgical removal
created_by: slaulede
creation_date: 2023-04-06T16:01:25Z

[Term]
id: XCO:0001016
name: minced muscle graft
def: "This is any condition in which the main influencing factor is implantation of a minced muscle graft. It is a surgical procedure intended to induce healing of a skeletal muscle injured by volumetric muscle loss." [PMID:29531830]
synonym: "autologous minced muscle graft" EXACT []
synonym: "MMG" EXACT []
xref: PMID:29531830
is_a: XCO:0000027 ! surgical implantation
created_by: slaulede
creation_date: 2023-04-06T16:32:30Z

[Term]
id: XCO:0001017
name: cocaine
def: "This is a bitter crystalline alkaloid C17H21NO4 obtained from coca leaves that is used especially in the form of its hydrochloride medically as a topical anesthetic and illicitly for its euphoric effects and that may result in a compulsive psychological need." [https://www.merriam-webster.com]
synonym: "(1R,2R,3S,5S)-2-(methoxycarbonyl)tropan-3-yl benzoate" EXACT []
xref: CHEBI:27958
xref: MESH:D003042
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000141 ! vasoconstrictor
is_a: XCO:0000511 ! ester
is_a: XCO:0000618 ! sodium channel inhibitor
created_by: slaulede
creation_date: 2023-04-27T12:51:11Z

[Term]
id: XCO:0001018
name: WIN 55,212-2
def: "This is an organic heterotricyclic compound that is 5-methyl-3-(morpholin-4-ylmethyl)-2,3-dihydro[1,4]oxazino[2,3,4-hi]indole substituted at position 6 by a 1-naphthylcarbonyl group." [CHEBI:73295]
synonym: "[(3R)-5-methyl-3-(morpholin-4-ylmethyl)-2,3-dihydro[1,4]oxazino[2,3,4-hi]indol-6-yl](1-naphthyl)methanone" EXACT []
synonym: "WIN 55,212" EXACT []
xref: MESH:C070417
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000269 ! calcium channel inhibitor
created_by: slaulede
creation_date: 2023-04-27T13:02:47Z

[Term]
id: XCO:0001019
name: olanzapine
def: "This is any condition in which the main influencing factor is olanzapine, a benzodiazepine derivative that binds SEROTONIN RECEPTORS; MUSCARINIC RECEPTORS; HISTAMINE H1 RECEPTORS; ADRENERGIC ALPHA-1 RECEPTORS; and DOPAMINE RECEPTORS. It is an antipsychotic agent used in the treatment of SCHIZOPHRENIA; BIPOLAR DISORDER; and MAJOR DEPRESSIVE DISORDER; it may also reduce nausea and vomiting in patients undergoing chemotherapy." [MESH:D000077152]
synonym: "2-methyl-4-(4-methylpiperazin-1-yl)-10H-thieno[2,3-b][1,5]benzodiazepine" EXACT []
xref: CHEBI:7735
xref: MESH:D000077152
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulede
creation_date: 2023-05-02T13:01:59Z

[Term]
id: XCO:0001020
name: docosahexaenoic acid
def: "This is any condition in which the main influencing factor is docosahexaenoic acid, a C22 polyunsaturated fatty acid containing six double bonds." [CHEBI:36005]
synonym: "cervonic acid" EXACT []
synonym: "DHA" EXACT []
xref: CHEBI:36005
is_a: XCO:0000776 ! fatty acid
created_by: slaulede
creation_date: 2023-05-02T13:31:17Z

[Term]
id: XCO:0001021
name: controlled docosahexaenoic acid content diet
def: "This is any condition in which the main influencing factor is a solid diet in which the amount of docosahexaenoic acid, a C22 polyunsaturated fatty acid containing six double bonds, is maintained at a specified level." [CHEBI:36005]
synonym: "controlled DHA content diet" EXACT []
xref: CHEBI:36005
xref: PMID:27322469
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0001020 ! docosahexaenoic acid
created_by: slaulede
creation_date: 2023-05-02T13:37:56Z

[Term]
id: XCO:0001022
name: flaxseed oil
def: "This is any condition in which the main influencing factor is flaxseed oil, an edible oil in demand as a dietary supplement, as a source of &#945;-Linolenic acid, an omega-3 fatty acid." [https://en.wikipedia.org/wiki/Linseed_oil]
synonym: "flax oil" EXACT []
synonym: "linseed oil" EXACT []
is_a: XCO:0000774 ! oil
created_by: slaulede
creation_date: 2023-05-02T13:50:29Z

[Term]
id: XCO:0001023
name: controlled flaxseed oil content diet
def: "This is any condition in which the main influencing factor is a solid diet in which the amount of flaxseed oil, an edible oil rich in &#945;-Linolenic acid (an omega-3 fatty acid), is maintained at a specified level." [https://en.wikipedia.org/wiki/Linseed_oil]
synonym: "controlled flaxs oil content diet" EXACT []
synonym: "controlled linseed oil content diet" EXACT []
xref: PMID:27322469
is_a: XCO:0000454 ! controlled oil content diet
relationship: has_component XCO:0001022 ! flaxseed oil
created_by: slaulede
creation_date: 2023-05-02T13:57:19Z

[Term]
id: XCO:0001024
name: BNTA
def: "This is any condition in which the main influencing factor is BNTA, a small molecule with ECM modulatory and anti-inflammatory properties that is a potential therapeutic agent for osteoarthritis." [PMID:31015473]
synonym: "N-(2-bromo-4-(phenylsulfonyl)thiophen-3-yl)-2-chlorobenzamide" EXACT []
synonym: "N-[2-bromo-4-(phenylsulfonyl)-3-thienyl]-2-chlorobenzamide" EXACT []
synonym: "N-[4-(benzenesulfonyl)-2-bromothiophen-3-yl]-2-chlorobenzamide" EXACT []
xref: CID:2819453
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulede
creation_date: 2023-05-09T14:19:20Z

[Term]
id: XCO:0001025
name: UNC0638
def: "This is any condition in which the main influencing factor is UNC0638, a histone methyltransferase Inhibitor that is a trial drug for cancer." [https://www.sigmaaldrich.com/US/en/product/mm/382192]
synonym: "2-Cyclohexyl-N-(1-isopropylpiperidin-4-yl)-6-methoxy-7-(3-(pyrrolidin-1-yl)propoxy)quinazolin-4-amine" EXACT []
synonym: "DNA Methyltransferase Inhibitor III" EXACT []
synonym: "DNA MTase Inhibitor III" EXACT []
synonym: "EHMT1/GLP Inhibitor II" EXACT []
synonym: "EHMT2/G9a Inhibitor IV" EXACT []
synonym: "HMTase Inhibitor IV" EXACT []
xref: PMID:26551542
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulede
creation_date: 2023-05-09T15:04:55Z

[Term]
id: XCO:0001026
name: spinal nerve ligation
def: "This is any condition in which the main influencing factor is the tight ligation of one or more segmental spinal nerves at a point before the spinal nerve joins a common nerve (most commonly: ligation of L5 and/or L6 nerves which, with L4, make up the sciatic nerve in rats). This is a model of chronic neuropathic pain." [https://link.springer.com/referenceworkentry/10.1007/978-3-540-29805-2_2683, PMID:1333581]
synonym: "Chung model" RELATED []
synonym: "SNL" EXACT []
synonym: "SNL model" RELATED []
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulede
creation_date: 2023-05-09T16:38:20Z

[Term]
id: XCO:0001027
name: gene transfer of the Rpl10a gene using a lentivirus vector
def: "This is a condition in which the Rpl10a (ribosomal protein L10A) gene has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of Rpl10a in the recipient cell or organism." [https://www.merriam-webster.com, PMID:31825308]
synonym: "gene transfer of Rpl10a using a lentivirus vector" EXACT []
synonym: "transduction of ribosomal protein L10A using a lentiviral vector" EXACT []
synonym: "transduction of ribosomal protein L10A using a lentivirus vector" EXACT []
synonym: "transduction of Rpl10a using a lentiviral vector" EXACT []
is_a: XCO:0000982 ! gene transfer using a lentivirus vector
created_by: slaulede
creation_date: 2023-05-11T15:08:39Z

[Term]
id: XCO:0001028
name: gene transfer of the EYFP gene using a lentivirus vector
def: "This is a condition in which the enhanced yellow fluorescent protein (EYFP) gene has been (transiently or stably) transferred into a cell or organism using an lentivirus carrier in order to induce synthesis of EYFP in the recipient cell or organism." [https://www.merriam-webster.com, PMID:31825308]
synonym: "gene transduction of the enhanced yellow fluorescent protein gene using a lentivirus vector" EXACT []
synonym: "gene transfer of the EYFP gene using a lentiviral vector" EXACT []
synonym: "lentiviral transfer of the EYFP gene" EXACT []
synonym: "transduction of recombinant lentivirus containing the EYFP gene" EXACT []
synonym: "transfer of recombinant lentivirus containing the EYFP gene" EXACT []
is_a: XCO:0000982 ! gene transfer using a lentivirus vector
created_by: slaulede
creation_date: 2023-05-11T15:33:38Z

[Term]
id: XCO:0001029
name: gene transfer of the Rpl10a gene and EYFP gene using a lentivirus vector
def: "This is a condition in which the Rpl10a (ribosomal protein L10A) gene and enhanced yellow fluorescent protein (EYFP) gene have been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of both rat wild type cyclin Y and EGFP in the recipient cell or organism." [https://www.merriam-webster.com, PMID:31825308]
synonym: "lentiviral transfer of the Rpl10a gene and the EYFP gene" EXACT []
synonym: "transduction of recombinant lentivirus containing the Rpl10a gene and the EYFP gene" EXACT []
synonym: "transfer of recombinant lentivirus containing the Rpl10a gene and the EYFP gene" EXACT []
is_a: XCO:0001027 ! gene transfer of the Rpl10a gene using a lentivirus vector
is_a: XCO:0001028 ! gene transfer of the EYFP gene using a lentivirus vector
created_by: slaulede
creation_date: 2023-05-11T15:56:41Z

[Term]
id: XCO:0001030
name: acupuncture
def: "This is any condition in which the main influencing factor is acupuncture, a technique in which practitioners insert fine needles into the skin to treat health problems. The needles may be manipulated manually or stimulated with small electrical currents (electroacupuncture). Acupuncture has been in use in some form for at least 2,500 years." [https://www.nccih.nih.gov/health/acupuncture-what-you-need-to-know]
synonym: "acupotomy" EXACT []
synonym: "acupuncture treatment" EXACT []
synonym: "pharmacoacupuncture therapy" NARROW []
synonym: "pharmacoacupuncture treatment" NARROW []
xref: MESH:D015670
is_a: XCO:0000000 ! experimental condition
created_by: slaulede
creation_date: 2023-05-12T14:51:55Z

[Term]
id: XCO:0001031
name: electroacupuncture
def: "This is any condition in which the main influencing factor is electroacupuncture, a form of acupuncture where a small electric current is passed between pairs of acupuncture needles. According to some acupuncturists, this practice augments the use of regular acupuncture, can restore health and well-being, and is particularly good for treating pain." [https://en.wikipedia.org/wiki/Electroacupuncture]
synonym: "electro-acupuncture" EXACT []
xref: MESH:D015671
xref: PMID:24722278
is_a: XCO:0001030 ! acupuncture
created_by: slaulede
creation_date: 2023-05-12T14:58:31Z

[Term]
id: XCO:0001032
name: human neural progenitor cells
def: "This is any condition in which the main influencing factor is neural progenitor cells, which are isolated from embryonic or fetal CNS tissue and can be expanded in culture for prolonged periods using genetic or epigenetic approaches. Expanded cells have the capacity to differentiate into neurons, oligodendrocytes, or astrocytes." [PMID:18341406]
synonym: "hNPCs" EXACT []
is_a: XCO:0001393 ! human stem cells
created_by: slaulede
creation_date: 2023-05-18T14:23:53Z

[Term]
id: XCO:0001033
name: balanced salt solution cell carrying medium
def: "This is any condition in which the main influencing factor is a balanced salt solution-based medium for the delivery of a suspension of cells." [PMID:27217715]
synonym: "BSS cell carrying medium" EXACT []
is_a: XCO:0000154 ! ion/salt solution
created_by: slaulede
creation_date: 2023-05-18T14:35:36Z

[Term]
id: XCO:0001034
name: hawk tea extract
def: "This is any condition in which the main influencing factor is hawk tea extract (HTE), a potential cholesterol-lowering agent and antioxidant. Hawk tea is a medicinal herbal and caffeine-free drink popular in China." [PMID:31098406]
synonym: "HTE" EXACT []
synonym: "Litsea coreana extract" EXACT []
synonym: "Litsea coreana Levl. var. lanuginose extract" EXACT []
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000680 ! antilipemic agent
created_by: slaulede
creation_date: 2023-05-19T13:15:55Z

[Term]
id: XCO:0001035
name: controlled HTE content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of hawk tea extract consumed by an organism as part of an experiment. Hawk tea extract is a potential cholesterol-lowering agent and antioxidant. Hawk tea is a traditional herbal and caffeine-free drink popular in China." [PMID:31098406]
synonym: "controlled hawk tea extract content drinking water" EXACT []
synonym: "controlled Litsea coreana extract content drinking water" EXACT []
xref: PMID:23618259
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001034 ! hawk tea extract
created_by: slaulede
creation_date: 2023-05-19T13:25:24Z

[Term]
id: XCO:0001036
name: peripheral myelin protein 2 peptide 53-78
def: "This is any condition in which the major influencing factor is the peptide (TESPFKNTEISFKLGQEFEETTADNR) representing residues 53 to 78 of peripheral myelin protein 2, a fatty acid and cholesterol binding protein which together with myelin basic protein constitutes a major fraction of the peripheral nervous system myelin proteins." [PMID:31344254]
synonym: "Pmp2 peptide 53-78" EXACT []
synonym: "TESPFKNTEISFKLGQEFEETTADNR" EXACT []
is_a: XCO:0000290 ! peripheral myelin protein 2
created_by: slaulede
creation_date: 2023-05-19T13:48:55Z

[Term]
id: XCO:0001037
name: Mycobacterium tuberculosis H37Ra
def: "This is any condition in which the main influencing factor is Mycobacterium tuberculosis H37Ra (a high G+C gram-positive bacteria) introduced externally or internally, alive or dead, to a subject to effect a change in phenotype of the subject. Mycobacterium tuberculosis H37Ra is an avirulent strain derived from its virulent parent strain H37." [https://www.ebi.ac.uk/ena/browser/view/GCA_000016145.1, NCBI:txid419947]
synonym: "Mycobacterium tuberculosis ATCC 25177" EXACT []
synonym: "Mycobacterium tuberculosis strain H37Ra" EXACT []
synonym: "MYCTA" EXACT []
xref: PMID:31344254
xref: UniProt:419947
is_a: XCO:0001212 ! bacteria
created_by: slaulede
creation_date: 2023-05-19T14:35:05Z

[Term]
id: XCO:0001038
name: PBS-filled liposomes
def: "This is any condition in which the main influencing factor is PBS-filled liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and containing phosphate buffered saline." [PMID:30485549]
synonym: "PBS containing liposomes" EXACT []
synonym: "PBS-liposomes" EXACT []
synonym: "phosphate buffered saline-filled liposomes" EXACT []
is_a: XCO:0000780 ! liposomes
created_by: slaulede
creation_date: 2023-05-19T16:16:35Z

[Term]
id: XCO:0001039
name: Clodronate-filled liposomes
def: "This is any condition in which the main influencing factor is clodronate-filled liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and containing clodronate." [PMID:30485549]
synonym: "clodronate containing liposomes" EXACT []
synonym: "clodronate liposomes" EXACT []
xref: http://clodronateliposomes.com/
is_a: XCO:0000648 ! clodronic acid
is_a: XCO:0000780 ! liposomes
created_by: slaulede
creation_date: 2023-05-19T16:23:46Z

[Term]
id: XCO:0001040
name: (R)-lipoic acid
def: "This is any condition in which the main influencing factor is (R)-lipoic acid, the (R)-enantiomer of lipoic acid. Lipoic acid is a vitamin-like, C8 thia fatty acid with anti-oxidant properties." [CHEBI:30314]
synonym: "R-&#945;-lipoic acid" EXACT []
xref: MESH:D008063
xref: PMID:24104204
is_a: XCO:0000777 ! lipoic acid
created_by: slaulede
creation_date: 2023-05-23T16:56:01Z

[Term]
id: XCO:0001041
name: experimental spinal cord contusion
def: "This is any condition in which the main influencing factor is an experimental surgical procedure involving laminectomy and delivery of a controlled contusion of the spinal cord by a mechanical apparatus." [PMID:15629760]
synonym: "spinal cord injury" BROAD []
xref: PMID:15629760
xref: PMID:28106101
is_a: XCO:0001091 ! experimental spinal cord injury
created_by: slaulede
creation_date: 2023-05-26T10:20:43Z

[Term]
id: XCO:0001042
name: T9 spinal cord contusion
def: "This is any condition in which the main influencing factor is an experimental surgical procedure involving laminectomy of the ninth thoracic vertebra and delivery of a controlled contusion of the spinal cord by a mechanical apparatus." [PMID:15629760]
synonym: "spinal cord contusion at T9" EXACT []
synonym: "spinal cord injury at T9" BROAD []
synonym: "spinal cord injury at  the ninth thoracic vertebra" BROAD []
is_a: XCO:0001041 ! experimental spinal cord contusion
created_by: slaulede
creation_date: 2023-05-26T10:31:57Z

[Term]
id: XCO:0001043
name: laminectomy
def: "This is any condition in which the main influencing factor is surgical removal of the lamina (dorsal part of vertebra) of one or more vertebrae. This procedure can serve as sham condition for a spinal cord contusion study." [https://www.mayoclinic.org/tests-procedures/laminectomy/about/pac-20394533, PMID:15629760]
synonym: "dorsal laminectomy" EXACT []
synonym: "surgical removal of vertebral lamina" EXACT []
xref: PMID:15629760
is_a: XCO:0000026 ! surgical removal
created_by: slaulede
creation_date: 2023-05-26T10:55:47Z

[Term]
id: XCO:0001044
name: T9 laminectomy
def: "This is any condition in which the main influencing factor is surgical removal of the lamina (dorsal part of vertebra) of the ninth thoracic vertebra." [https://www.mayoclinic.org/tests-procedures/laminectomy/about/pac-20394533, PMID:15629760]
synonym: "surgical removal of the lamina of the ninth thoracic vertebra" EXACT []
xref: PMID:15629760
is_a: XCO:0001043 ! laminectomy
created_by: slaulede
creation_date: 2023-05-26T11:29:44Z

[Term]
id: XCO:0001045
name: Walker 256 cells
def: "This is any condition in which the main influencing factor is Walker 256, a rat mammary gland carcinoma cell line." [https://www.atcc.org/products/ccl-38, https://www.merriam-webster.com]
synonym: "LLC-WRC 256 cells" EXACT []
synonym: "W256 cells" EXACT []
xref: Cellosaurus:CVCL_3537
xref: PMID:32209134
is_a: XCO:0000709 ! cancer cells
created_by: slaulede
creation_date: 2023-05-26T12:12:33Z

[Term]
id: XCO:0001046
name: Dnmt3a gapmer antisense oligonucleotide
def: "This is any condition in which the main influencing factor is a Dnmt3a gapmer (Dnmt3a-targeting antisense oligonucleotide). Gapmers are mRNA-targeting, short DNA antisense oligonucleotide structures with RNA-like segments on both sides of the sequence." [https://en.wikipedia.org/wiki/Gapmer]
synonym: "DNA methyltransferase 3 alpha GapmeR" EXACT []
synonym: "DNA methyltransferase 3 alpha gapmer antisense oligonucleotide" EXACT []
synonym: "Dnmt3a GapmeR" EXACT []
xref: PMID:30354815
is_a: XCO:0000234 ! deoxyribonucleic acid
created_by: slaulede
creation_date: 2023-06-01T15:19:05Z

[Term]
id: XCO:0001047
name: Tet3 gapmer antisense oligonucleotide
def: "This is any condition in which the main influencing factor is a Tet3 gapmer (Tet3-targeting antisense oligonucleotide). Gapmers are mRNA-targeting, short DNA antisense oligonucleotide structures with RNA-like segments on both sides of the sequence." [https://en.wikipedia.org/wiki/Gapmer]
synonym: "Tet3 GapmeR" EXACT []
synonym: "tet methylcytosine dioxygenase 3 GapmeR" EXACT []
synonym: "tet methylcytosine dioxygenase 3 gapmer antisense oligonucleotide" EXACT []
xref: PMID:30354815
is_a: XCO:0000234 ! deoxyribonucleic acid
created_by: slaulede
creation_date: 2023-06-01T15:28:16Z

[Term]
id: XCO:0001048
name: scrambled gapmer antisense oligonucleotide
def: "This is any condition in which the main influencing factor is a negative control gapmer. A negative control gapmer is a gapmer with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental gapmer used." [https://en.wikipedia.org/wiki/Gapmer, PMID:30354815]
synonym: "control GapmeR" EXACT []
synonym: "scrambled GapmeR" EXACT []
synonym: "scrambled GapmeR antisense oligonucleotide" EXACT []
synonym: "SCR GapmeR" EXACT []
xref: PMID:30354815
is_a: XCO:0000585 ! scrambled control oligodeoxynucleotide
created_by: slaulede
creation_date: 2023-06-01T15:36:36Z

[Term]
id: XCO:0001049
name: nicotine
def: "This is any condition in which the main influencing factor is nicotine, a highly toxic alkaloid. Nicotine is a racemate composed of equimolar amounts of (R)- and (S)-nicotine. It is the prototypical agonist at nicotinic cholinergic receptors where it dramatically stimulates neurons and ultimately blocks synaptic transmission." [CHEBI:18723, MESH:D009538]
synonym: "(R,S)-nicotine" EXACT []
synonym: "(RS)-nicotine" EXACT []
synonym: "rac-3-(1-methylpyrrolidin-2-yl)pyridine" EXACT []
xref: PMID:23874651
is_a: XCO:0000496 ! neurotoxin
is_a: XCO:0000693 ! cholinergic agonist
created_by: slaulede
creation_date: 2023-06-01T17:01:56Z

[Term]
id: XCO:0001050
name: T8/T9 laminectomy
def: "This is any condition in which the main influencing factor is surgical removal of the lamina (dorsal part of vertebra) from both the eighth and the ninth thoracic vertebrae." [https://www.mayoclinic.org/tests-procedures/laminectomy/about/pac-20394533, PMID:26546062]
synonym: "surgical removal of the lamina of the eighth and ninth thoracic vertebrae" EXACT []
xref: PMID:26546062
relationship: has_component XCO:0001044 ! T9 laminectomy
created_by: slaulede
creation_date: 2023-06-02T14:15:42Z

[Term]
id: XCO:0001051
name: controlled soy protein isolate content diet
def: "This is any condition in which the main influencing factor is a solid diet in which the amount of soy protein isolate, usually containing 85%–90% protein (dry basis), is maintained at a specified level. Soy protein isolates (SPI) are prepared by separating the fibers and insoluble carbohydrates from soy protein concentrate." [https://www.sciencedirect.com/topics/agricultural-and-biological-sciences/soy-protein-isolate]
synonym: "controlled SPI content diet" EXACT []
is_a: XCO:0000014 ! controlled content diet
created_by: slaulede
creation_date: 2023-06-06T15:19:14Z

[Term]
id: XCO:0001052
name: 5-aza-2&#8242;-deoxycytidine
def: "This is any condition in which the main influencing factor is a 2'-deoxyribonucleoside that has formula C8H12N4O4. 5-aza-2&#8242;-deoxycytidine is a chemotherapeutic pyrimidine nucleoside analogue that integrates into cellular DNA and inhibits the action of DNA methyltransferases." [CID:451668, https://go.drugbank.com/drugs/DB01262]
synonym: "2'-Deoxy-5-azacytidine" EXACT []
synonym: "4-amino-1-(2-deoxy-beta-D-erythro-pentofuranosyl)-1,3,5-triazin-2(1H)-one" EXACT []
synonym: "5-AzaD" EXACT []
synonym: "5AzadC" EXACT []
synonym: "Dacogen" EXACT []
synonym: "decitabine" EXACT []
xref: PMID:37288607
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulede
creation_date: 2023-06-19T13:59:50Z

[Term]
id: XCO:0001053
name: surgical closure
def: "This is any condition in which the main influencing factor is closure of a wound, body parts, or anatomical orifices by the use of sutures, staples, or surgical adhesive/sealant." [https://www.merriam-webster.com, https://www.sciencedirect.com/topics/medicine-and-dentistry/surgical-glue]
synonym: "surgical gluing" NARROW []
synonym: "surgical stapling" NARROW []
synonym: "surgical suturing" NARROW []
xref: GEO:GSE72787
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulede
creation_date: 2023-06-20T15:13:05Z

[Term]
id: XCO:0001054
name: Qingda granule
def: "This is any condition in which the main influencing factor is Qingda granule, derived from Qingxuan Jiangya Decoction (QXJYD), which has been in usage for a long time as a traditional Chinese medicine formula." [PMID:32199989]
synonym: "QDG" EXACT []
synonym: "Qingda granules" EXACT []
xref: GEO:GSE144548
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulede
creation_date: 2023-06-20T16:42:57Z

[Term]
id: XCO:0001055
name: luteolin
def: "This is any condition in which the main influencing factor is luteolin, a tetrahydroxyflavone in which the four hydroxy groups are located at positions 3', 4', 5 and 7. It is thought to play an important role in the human body as an antioxidant, a free radical scavenger, an anti-inflammatory agent and an immune system modulator as well as being active against several cancers. Luteolin is a common flavonoid abundantly present in several plant products, including broccoli, pepper, thyme, and celery." [CHEBI:15864, https://www.sciencedirect.com/topics/pharmacology-toxicology-and-pharmaceutical-science/luteolin]
synonym: "2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one" EXACT []
synonym: "3',4',5,7-Tetrahydroxyflavone" EXACT []
xref: CHEBI:15864
xref: MESH:D047311
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000470 ! flavonoid
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulede
creation_date: 2023-06-22T14:33:16Z

[Term]
id: XCO:0001056
name: methylglyoxal
def: "This is any condition in which the main influencing factor is methylglyoxal, a 2-oxo aldehyde derived from propanal. Methylglyoxal is an organic compound used often as a reagent in organic synthesis, as a flavoring agent, in tanning and as an experimental antidepressant. It has been demonstrated as an intermediate in the metabolism of acetone and its derivatives in isolated cell preparations, in various culture media, and in vivo in certain animals." [CHEBI:17158, MESH:D011765]
synonym: "2-Oxopropanal" EXACT []
synonym: "MGO" EXACT []
synonym: "pyruvaldehyde" EXACT []
xref: GEO:GSE119482
is_a: XCO:0000561 ! antidepressant
created_by: slaulede
creation_date: 2023-06-22T14:51:02Z

[Term]
id: XCO:0001057
name: corticosterone
def: "This is any condition in which the main influencing factor is corticosterone, a 21-carbon adrenocortical steroid hormone that has modest but significant activities as both a mineralocorticoid and a glucocorticoid." [ISBN:978-1455756438, MESH:D003345]
synonym: "11beta,21-dihydroxypregn-4-ene-3,20-dione" EXACT []
xref: CHEBI:16827
is_a: XCO:0000229 ! steroid hormone
created_by: slaulede
creation_date: 2023-06-23T14:29:08Z

[Term]
id: XCO:0001058
name: controlled corticosterone content drinking water
def: "This is an experimental condition in which the main influencing factor is a drink made up of water and a specified amount of corticosterone in which the amount of corticosterone consumed is maintained at a specified level." [https://www.merriam-webster.com, MESH:D003345]
xref: CHEBI:16827
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001057 ! corticosterone
created_by: slaulede
creation_date: 2023-06-23T14:40:29Z

[Term]
id: XCO:0001059
name: controlled content saline drink
def: "This is any condition in which the main influencing factor is a drink made up of saline (0.9% sodium chloride solution) and a specified amount of one or more solutes." [https://www.merriam-webster.com, ISBN:978-1455756438]
synonym: "controlled content 0.9% sodium chloride drink" EXACT []
synonym: "controlled content drinking saline" EXACT []
synonym: "controlled content normal saline drink" EXACT []
xref: PMID:30364965
is_a: XCO:0000020 ! drink
is_a: XCO:0000156 ! 0.9% sodium chloride solution
created_by: slaulede
creation_date: 2023-06-23T14:54:26Z

[Term]
id: XCO:0001060
name: controlled corticosterone content saline drink
def: "This is any condition in which the main influencing factor is a drink made up of normal saline (0.9% sodium chloride) and a specified amount of corticosterone in which the amount of corticosterone consumed is maintained at a specified level." [https://www.merriam-webster.com, ISBN:978-1455756438]
synonym: "controlled corticosterone content 0.9% sodium chloride drink" EXACT []
synonym: "controlled corticosterone content normal saline drink" EXACT []
xref: PMID:30364965
is_a: XCO:0001059 ! controlled content saline drink
relationship: has_component XCO:0001057 ! corticosterone
created_by: slaulede
creation_date: 2023-06-23T15:03:59Z

[Term]
id: XCO:0001061
name: oligosaccharide
def: "This is any condition in which the main influencing factor is an oligosaccharide, a compound in which a small number of monosaccharide units (2-10) are joined by alpha- or beta-glycosidic linkages." [ISBN:978-1455756438, MESH:D009844]
synonym: "oligosaccharides" EXACT []
xref: CHEBI:50699
xref: MESH:D009844
is_a: XCO:0000172 ! carbohydrate
created_by: slaulede
creation_date: 2023-06-23T15:27:30Z

[Term]
id: XCO:0001062
name: 2-hydroxypropyl-&#946;-cyclodextrin
def: "This is any condition in which the main influencing factor is 2-hydroxypropyl-&#946;-cyclodextrin, a hydroxypropyl-substituted heptasaccharide made up of a ring of seven glucose subunits joined by &#945;-1,4 glycosidic bonds." [https://en.wikipedia.org/wiki/Cyclodextrin]
synonym: "2 Hydroxylpropyl beta cyclodextrin" EXACT []
synonym: "2-Hydroxylpropyl-beta-cyclodextrin" EXACT []
synonym: "HP&#946;CD" EXACT []
synonym: "HP-beta-CD" EXACT []
xref: CHEBI:495055
xref: MESH:C031215
is_a: XCO:0001061 ! oligosaccharide
created_by: slaulede
creation_date: 2023-06-23T15:43:12Z

[Term]
id: XCO:0001063
name: pinealectomy
def: "This is any condition in which the main influencing factor is the surgical excision of the pineal body, a midline, cone-like structure located in the dorso-caudal roof of the 3rd ventricle, attached by peduncles to the habenular and posterior commissures." [https://www.merriam-webster.com, UBERON:0001905]
is_a: XCO:0000026 ! surgical removal
created_by: slaulede
creation_date: 2023-06-26T17:12:25Z

[Term]
id: XCO:0001064
name: 5/6 nephrectomy
def: "This is any condition in which the main influencing factor is a 5/6 nephrectomy, which is an experimental procedure performed to produce an animal model of chronic kidney disease in rodents. Typically, the right kidney is removed and the poles of the left kidney are removed to produce a total renal system which is 1/6 of original capacity. The animal is typically allowed to recover for a week between the total and partial nephrectomy." [ISBN:978-1455756438, PMID:32001792]
synonym: "5/6 Nx" EXACT []
synonym: "five-sixths partial nephrectomy" EXACT []
synonym: "subtotal 5/6 nephrectomy" EXACT []
synonym: "subtotal nephrectomy" EXACT []
synonym: "two-step subtotal nephrectomy" EXACT []
xref: PMID:28760335
is_a: XCO:0000017 ! nephrectomy
created_by: slaulede
creation_date: 2023-06-26T18:07:22Z

[Term]
id: XCO:0001065
name: scrambled control LNA-modified oligonucleotide
def: "This is any condition in which the main influencing factor is a control locked nucleic acid (LNA)–modified oligonucleotide with a non-specific scrambled sequence. A locked nucleic acid (LNA), also known as bridged nucleic acid (BNA), and often referred to as inaccessible RNA, is a modified RNA nucleotide in which the ribose moiety is modified with an extra bridge connecting the 2' oxygen and 4' carbon. LNAs provide structural stability and nuclease resistance to the oligonucleotide." [https://en.wikipedia.org/wiki/Locked_nucleic_acid, https://www.idtdna.com/pages/technology/custom-dna-rna/locked-nucleic-acids]
synonym: "scrambled control BNA oligonucleotide" EXACT []
synonym: "scrambled control LNA oligonucleotide" EXACT []
synonym: "scrambled control locked nucleic acid oligonucleotide" EXACT []
xref: PMID:28760335
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulede
creation_date: 2023-06-27T13:16:05Z

[Term]
id: XCO:0001066
name: LNA-modified anti–rno-miR-21-5p oligonucleotide
def: "This is any condition in which the main influencing factor is a control locked nucleic acid (LNA)–modified oligonucleotide with an anti–rat miR-21-5p sequence. A locked nucleic acid (LNA), also known as bridged nucleic acid (BNA), and often referred to as inaccessible RNA, is a modified RNA nucleotide in which the ribose moiety is modified with an extra bridge connecting the 2' oxygen and 4' carbon. LNAs provide structural stability and nuclease resistance to the oligonucleotide." [https://en.wikipedia.org/wiki/Locked_nucleic_acid, https://www.idtdna.com/pages/technology/custom-dna-rna/locked-nucleic-acids]
synonym: "BNA-modified anti–rno-miR-21-5p oligonucleotide" EXACT []
synonym: "LNA-modified anti-microRNA-21-5p oligonucleotide" EXACT []
xref: PMID:28760335
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulede
creation_date: 2023-06-27T14:04:55Z

[Term]
id: XCO:0001067
name: nitroglycerin
def: "This is any condition in which the main influencing factor is nitroglycerin, a volatile vasodilator which relieves angina pectoris by stimulating guanylate cyclase and lowering cytosolic calcium. It is also sometimes used for tocolysis." [MESH:D005996]
synonym: "1,2,3-trinitrooxypropane" EXACT []
xref: CHEBI:28787
is_a: XCO:0000140 ! vasodilator
created_by: slaulede
creation_date: 2023-07-06T16:25:28Z

[Term]
id: XCO:0001068
name: sleep
def: "This is any condition in which the main influencing factor is sleep, the natural, easily reversible periodic state of many living things that is marked by the absence of wakefulness and by the loss of consciousness of one's surroundings, is accompanied by a typical body posture (such as lying down with the eyes closed), the occurrence of dreaming, and changes in brain activity and physiological functioning." [https://www.merriam-webster.com]
synonym: "napping" EXACT []
synonym: "slumber" EXACT []
synonym: "snoozing" EXACT []
is_a: XCO:0000000 ! experimental condition
created_by: slaulede
creation_date: 2023-07-17T17:37:42Z

[Term]
id: XCO:0001069
name: sleep restriction
def: "This is any condition in which the main influencing factor is sleep restriction, a state caused by inadequate quantity or quality of sleep, including voluntary or involuntary sleeplessness and circadian rhythm sleep. Sleep restriction may be caused by stress, school or job requirements, poor sleeping habits, or an experimentally arranged situation." [https://www.betterhealth.vic.gov.au/health/conditionsandtreatments/sleep-deprivation]
synonym: "insomnia" RELATED []
synonym: "sleep deprivation" EXACT []
xref: PMID:32040351
is_a: XCO:0001068 ! sleep
created_by: slaulede
creation_date: 2023-07-17T17:58:29Z

[Term]
id: XCO:0001070
name: papain
def: "This is any condition in which the main influencing factor is papain, a cysteine protease present in papaya (Carica papaya) and mountain papaya (Vasconcellea cundinamarcensis). In addition to experimental uses in biology research, it has wide ranging commercial applications in the leather, cosmetic, textiles, detergents, food and pharmaceutical industries." [https://en.wikipedia.org/wiki/Papain]
synonym: "papaya proteinase 1" EXACT []
xref: EC:3.4.22.2
xref: MESH:D010206
is_a: XCO:0000176 ! enzyme
created_by: slaulede
creation_date: 2023-07-18T14:25:07Z

[Term]
id: XCO:0001071
name: L-cysteine
def: "This is any condition in which the main influencing factor is L-cysteine, an optically active form of cysteine having the L-configuration at the alpha-carbon. It is a thiol-containing non-essential amino acid that is oxidized to form cystine." [CHEBI:17561, MESH:D003545]
synonym: "half-cystine" EXACT []
xref: PMID:31950348
is_a: XCO:0000119 ! amino acid
created_by: slaulede
creation_date: 2023-07-18T16:58:46Z

[Term]
id: XCO:0001072
name: gene transfer of the sTGF&#946;R2 gene using an adenovirus vector
def: "This is any condition in which the main influencing factor is the soluble transforming growth factor-beta receptor 2 gene (sTGF&#946;R2) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [PMID:31950348]
synonym: "gene transfer of the soluble transforming growth factor-beta receptor 2 gene using a adenoviral vector" EXACT []
synonym: "gene transfer of the sTGF&#946;R2 gene using an adenoviral vector" EXACT []
synonym: "transduction of sTGF&#946;R2 using an adenoviral vector" EXACT []
synonym: "transduction of sTGF&#946;R2 using an adenovirus vector" EXACT []
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulede
creation_date: 2023-07-20T14:03:21Z

[Term]
id: XCO:0001073
name: gene transfer of the KL gene using an adenovirus vector
def: "This is any condition in which the main influencing factor is the klotho gene (KL) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [PMID:31950348]
synonym: "gene transfer of the alpha klotho gene using an adenoviral vector" EXACT []
synonym: "gene transfer of the KL gene using an adenoviral vector" EXACT []
synonym: "gene transfer of the klotho gene using an adenoviral vector" EXACT []
synonym: "transduction of KL using an adenoviral vector" EXACT []
synonym: "transduction of KL using an adenovirus vector" EXACT []
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulede
creation_date: 2023-07-20T14:15:01Z

[Term]
id: XCO:0001074
name: ureter ligation
def: "This is a condition in which the main influencing factor is an experimental surgical procedure causing blockage of one or both ureters. Ureters are the muscular ducts that propel urine from the kidneys to the urinary bladder." [ISBN:978-1455756438, UBERON:0000056]
synonym: "UO" RELATED []
synonym: "ureteral obstruction" RELATED []
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulede
creation_date: 2023-08-01T13:28:25Z

[Term]
id: XCO:0001075
name: unilateral ureter ligation
def: "This is a condition in which the main influencing factor is an experimental surgical procedure causing blockage of one ureter. Unilateral ureter ligation is used in experimental animals to create a model of unilateral ureteral obstruction and renal fibrosis." [ISBN:978-1455756438, PMID:28912732]
synonym: "unilateral ureteral obstruction" RELATED []
synonym: "UUO" RELATED []
is_a: XCO:0001074 ! ureter ligation
created_by: slaulede
creation_date: 2023-08-01T14:00:10Z

[Term]
id: XCO:0001076
name: bilateral ureter ligation
def: "This is a condition in which the main influencing factor is an experimental surgical procedure causing blockage of both ureters. Bilateral ureter ligation (BUL) is used in experimental animals to create a model of renal failure." [ISBN:978-1455756438, PMID:20797570]
synonym: "bilateral ureteral obstruction" RELATED []
synonym: "BUL" EXACT []
synonym: "BUO" RELATED []
is_a: XCO:0001074 ! ureter ligation
created_by: slaulede
creation_date: 2023-08-01T14:15:15Z

[Term]
id: XCO:0001077
name: bisphenol F
def: "This is any condition in which the main influencing factor is bisphenol F, an organic compound with the chemical formula (HOC6H4)2CH2. It is structurally related to bisphenol A (BPA), a popular precursor for forming plastics, as both belong to the category of molecules known as bisphenols, which feature two phenol groups connected via a linking group." [https://en.wikipedia.org/wiki/Bisphenol_F]
synonym: "4-(4-hydroxybenzyl)phenol" EXACT []
synonym: "4,4&#8242;-Dihydroxydiphenylmethane" EXACT []
synonym: "4,4&#8242;-Methylenediphenol" EXACT []
synonym: "4,4'-bisphenol F" EXACT []
synonym: "BPF" EXACT []
xref: CHEBI:34575
xref: MESH:C008745
is_a: XCO:0000396 ! phenolic/phenol derivative
created_by: slaulede
creation_date: 2023-08-08T16:49:17Z

[Term]
id: XCO:0001078
name: controlled bisphenol F content drinking water
def: "This is any condition in which the main influencing factor is bisphenol F in a drink made up of water and a specified amount of bisphenol F consumed by an organism as part of an experiment. Bisphenol F is an organic compound with the chemical formula (HOC6H4)2CH2." [https://en.wikipedia.org/wiki/Bisphenol_F, https://www.merriam-webster.com/]
synonym: "controlled 4,4&#8242;-Dihydroxydiphenylmethane content drinking water" EXACT []
synonym: "controlled 4,4&#8242;-Methylenediphenol content drinking water" EXACT []
synonym: "controlled BPF content drinking water" EXACT []
xref: CHEBI:34575
xref: MESH:C008745
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001077 ! bisphenol F
created_by: slaulede
creation_date: 2023-08-08T17:13:41Z

[Term]
id: XCO:0001079
name: adenine
def: "This is any condition in which the main influencing factor is adenine, the parent compound of the 6-aminopurines, composed of a purine having an amino group at C-6. Adenine is one of the five constituent bases of nucleic acids.The shape of adenine is complementary to either thymine in DNA or uracil in RNA." [CHEBI:16708, https://en.wikipedia.org/wiki/Adenine]
synonym: "1H-Purin-6-amine" EXACT []
synonym: "6-Aminopurine" EXACT []
synonym: "9H-purin-6-amine" EXACT []
xref: MESH:D000225
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulede
creation_date: 2023-09-14T15:58:46Z

[Term]
id: XCO:0001080
name: monoiodoacetate
def: "This is any condition in which the main influencing factor is monoiodoacetate, a haloacetate(1-) resulting from the deprotonation of the carboxy group of iadoacetic acid." [CHEBI:23123]
synonym: "iodoacetate" EXACT []
synonym: "MIA" EXACT []
is_a: XCO:0000149 ! ion/salt
is_a: XCO:0000261 ! arthritis inducing chemical
created_by: slaulede
creation_date: 2023-10-02T13:55:23Z

[Term]
id: XCO:0001081
name: SBFI-103
def: "This is any condition in which the main influencing factor is SBFI-103, a selective FABP5 inhibitor. It is an experimental drug for treatment of cancer and osteoarthritis." [https://synapse.patsnap.com/drug/8addafe1559d4e20a32638b36f0515ec, PMID:35650684]
synonym: "9-Fluorenylmethyl a-3-hydroxycarbonyl-2,4-di(2-methoxylphenyl)-cyclobutane-1-carboxylate" EXACT []
synonym: "alpha-SBFI-103" EXACT []
synonym: "FABP5-IN-1" EXACT []
synonym: "SB-FI-103" EXACT []
xref: CAS:2132990-98-6
is_a: XCO:0000120 ! inhibitor
created_by: slaulede
creation_date: 2023-10-02T14:40:38Z

[Term]
id: XCO:0001082
name: bovine type II collagen
def: "This is any condition in which the major influencing factor is the fibrillar collagen which comprises the main component of cartilage and is also found in the vitreous humor of the eye. Collagens are a family of extracellular, closely related proteins occurring as a major component of connective tissue, giving it strength and flexibility." [http://en.wikipedia.org/wiki/Collagen, ISBN:978-1455756438]
synonym: "Bos taurus type II collagen" EXACT []
synonym: "cattle type II collagen" EXACT []
is_a: XCO:0000281 ! type II collagen
created_by: slaulede
creation_date: 2023-10-03T13:13:21Z

[Term]
id: XCO:0001083
name: imperatorin
def: "This is any condition in which the main influencing factor is imperatorin, a member of the class of psoralens that is psoralen substituted by a prenyloxy group at position 8. Isolated from Angelica dahurica and Angelica koreana, it acts as a acetylcholinesterase inhibitor." [CHEBI:5885]
synonym: "9-[(3-methylbut-2-en-1-yl)oxy]-7H-furo[3,2-g]chromen-7-one" EXACT []
synonym: "IMP" EXACT []
xref: CAS:482-44-0
xref: MESH:C031534
xref: PMID:32392637
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulede
creation_date: 2023-10-03T13:24:53Z

[Term]
id: XCO:0001084
name: beta-Sitosterol
def: "This is any condition in which the main influencing factor is beta-Sitosterol, one of several phytosterols (plant sterols) with chemical structures similar to that of cholesterol. It is a white, waxy powder with a characteristic odor, and is one of the components of the food additive E499." [https://en.wikipedia.org/wiki/Beta-Sitosterol]
synonym: "beta-sitosterol" EXACT []
xref: CAS:83-46-5
xref: PMID:32392637
is_a: XCO:0000091 ! steroid
created_by: slaulede
creation_date: 2023-10-03T14:44:34Z

[Term]
id: XCO:0001085
name: experimental epidural spinal cord compression
def: "This is a condition induced by an experimental surgical procedure involving disruption of CSF circulation in the spinal cord. This artificial compression is intended to mimic the human disease canalicular syringomyelia." [PMID:37275526]
synonym: "experimental extradural spinal cord compression" EXACT []
is_a: XCO:0001091 ! experimental spinal cord injury
created_by: slaulederkind
creation_date: 2023-10-27T17:01:49Z

[Term]
id: XCO:0001086
name: TRV023
def: "This is any condition in which the main influencing factor is TRV023, an angiotensin analogue which is a beta-arrestin selective signaling AGTR1 agonist. It is a biased ligand because it does not affect G-protein signaling by AGTR1." [PMID:32259102, PMID:34201646]
synonym: "Sar-Arg-Val-Tyr-Lys-His-Pro-Ala-OH" EXACT []
synonym: "TRV" EXACT []
is_a: XCO:0000135 ! receptor agonist
created_by: slaulederkind
creation_date: 2023-10-31T13:11:19Z

[Term]
id: XCO:0001087
name: limited bedding and nesting
def: "This is any condition in which the main influencing factor is limited bedding and nesting, a housing condition designed to create a model of early life adversity. The minimum bedding/nesting may be as little as a paper towel in a plain, unadorned cage." [PMID:35102257]
synonym: "early-life adversity" RELATED []
synonym: "ELA" RELATED []
synonym: "LBN" EXACT []
synonym: "limited bedding/nesting model" EXACT []
synonym: "limited bedding and nesting model" EXACT []
is_a: XCO:0000033 ! housing condition
created_by: slaulederkind
creation_date: 2023-10-31T13:46:58Z

[Term]
id: XCO:0001088
name: cefuroxime
def: "This is any condition in which the main influencing factor is cefuroxime, a broad-spectrum cephalosporin antibiotic resistant to beta-lactamase. Cefuroxime has been proposed for treatment of infections of gram-negative organisms, gram-positive organisms, gonorrhea, and haemophilus." [MESH:D002444]
synonym: "3-[(carbamoyloxy)methyl]-7beta-[(2Z)-2-(furan-2-yl)-2-(methoxyimino)acetamido]-3,4-didehydrocepham-4-carboxylic acid" EXACT []
synonym: "CHEBI:3515" EXACT []
synonym: "CID:5479529" EXACT []
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2023-11-02T12:28:19Z

[Term]
id: XCO:0001089
name: hirudin
def: "This is any condition in which the main influencing factor is a hirudin, a single-chain polypeptide of about 65 amino acids (7 kDa) found in leech saliva, that has a neutral hydrophobic N terminus, an acidic hydrophilic C terminus, and a compact, hydrophobic core region. Hirudins, both natural and synthetic, are inhibitors of thrombin." [MESH:D006629]
synonym: "hirudins" BROAD []
xref: MESH:C074619
xref: MESH:C083544
xref: PMID:34621173
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0001090 ! anticoagulant
created_by: slaulederkind
creation_date: 2023-11-02T13:01:47Z

[Term]
id: XCO:0001090
name: anticoagulant
def: "This is any condition in which the main influencing factor is an anticoagulant, a substance that hinders the clotting of blood." [https://www.merriam-webster.com/, ISBN:978-1455756438]
synonym: "Not4Curation" RELATED []
xref: CHEBI:50249
xref: MESH:D000925
xref: PMID:34621173
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: slaulederkind
creation_date: 2023-11-02T13:12:35Z

[Term]
id: XCO:0001091
name: experimental spinal cord injury
def: "This is any condition in which the main influencing factor is experimental spinal cord injury, a penetrating or non-penetrating injury to the spinal cord resulting from experimentally controlled trauma." [https://www.merriam-webster.com/, MESH:D013119]
xref: DOID:9000039
xref: GEO:GSE149657
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2023-11-02T13:45:26Z

[Term]
id: XCO:0001092
name: sciatic nerve crush
def: "This is any condition in which the main influencing factor is an experimentally controlled sciatic nerve crush, which is used as a model of sciatic neuropathy, Wallerian degeneration, and axonal regeneration." [PMID:35768768]
xref: GEO:GSE149657
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2023-11-02T13:57:14Z

[Term]
id: XCO:0001093
name: epigallocatechin-3-gallate
def: "This is any condition in which the main influencing factor is epigallocatechin-3-gallate, a gallate ester which is an antimutagen found in tea (Camellia sinensis) with the highest concentration in green tea." [MESH:C045651]
synonym: "(-)-epigallocatechin 3-gallate" EXACT []
synonym: "EGCG" EXACT []
synonym: "epigallocatechin gallate" EXACT []
xref: CHEBI:4806
is_a: XCO:0000435 ! antineoplastic agent
created_by: slaulederkind
creation_date: 2023-11-03T14:46:21Z

[Term]
id: XCO:0001094
name: CFT&#8208;1 tea infusion
def: "This is any condition in which the main influencing factor is CFT-1, a green tea variety called Camellia sinensis (L.) O. Kuntze cv. CFT&#8208;1, which is rich in EGCG (antimutagen epigallocatechin-3-gallate)." [https://en.wikipedia.org/wiki/Camellia_sinensis, PMID:31428352]
synonym: "Camellia sinensis (L.) O. Kuntze cv. CFT&#8208;1" EXACT []
synonym: "Camellia sinensis CV.CFT&#8208;1 tea" EXACT []
synonym: "CFT&#8208;1 green tea infusion" EXACT []
synonym: "CFT-1" EXACT []
synonym: "EGCG&#8208;rich tea" EXACT []
is_a: XCO:0000075 ! tea
created_by: slaulederkind
creation_date: 2023-11-03T15:30:13Z

[Term]
id: XCO:0001095
name: FYT tea infusion
def: "This is any condition in which the main influencing factor is FYT, a common green tea variety called Camellia sinensis (L.) O. Kuntze cv. Fuyun6." [https://en.wikipedia.org/wiki/Camellia_sinensis, PMID:31428352]
synonym: "Camellia sinensis (L.) O. Kuntze cv. Fuyun6" EXACT []
synonym: "Camellia sinensis (L.) O. Kuntze cv. FYT" EXACT []
synonym: "Camellia sinensis CV.FYT tea" EXACT []
synonym: "Fuyun6 green tea" EXACT []
synonym: "FYT" EXACT []
synonym: "FYT green tea infusion" EXACT []
is_a: XCO:0000075 ! tea
created_by: slaulederkind
creation_date: 2023-11-03T15:57:46Z

[Term]
id: XCO:0001096
name: sodium taurocholate
def: "This is any condition in which the main influencing factor is sodium taurocholate, the sodium salt of taurocholic acid. Sodium taurocholate is the chief ingredient of the bile of carnivorous animals. It is used experimentally to induce severe acute pancreatitis in laboratory animals." [MESH:D013656, PMID:35496266]
synonym: "sodium 2-[(3alpha,7alpha,12alpha-trihydroxy-24-oxo-5beta-cholan-24-yl)amino]ethanesulfonate" EXACT []
synonym: "Taurocholate sodium salt" EXACT []
xref: CAS:145-42-6
xref: CID:23666345
is_a: XCO:0000259 ! disease-inducing chemical
created_by: slaulederkind
creation_date: 2023-11-06T16:23:56Z

[Term]
id: XCO:0001097
name: JZL184
def: "This is any condition in which the main influencing factor is JZL184, an irreversible inhibitor of monoacylglycerol lipase (MAGL), the primary enzyme responsible for degrading the endocannabinoid 2-arachidonoylglycerol (2-AG)." [https://en.wikipedia.org/wiki/JZL184]
synonym: "4-Nitrophenyl 4-[di(2H-1,3-benzodioxol-5-yl)(hydroxy)methyl]piperidine-1-carboxylate" EXACT []
xref: CAS:1101854-58-3
xref: CID:25021165
xref: PMID:35496266
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-11-06T16:56:32Z

[Term]
id: XCO:0001098
name: crystalline silica
def: "This is any condition in which the main influencing factor is crystalline silica. Silica is synonymous with silicon dioxide (SiO2) and commonly found in nature as sand. Silica exists mainly as crystalline silica (mostly in the form of quartz)." [https://safesilica.eu/crystalline-silica-the-science/, https://www.merriam-webster.com/]
synonym: "fracking sand dust" NARROW []
synonym: "fracking sand particles" NARROW []
synonym: "FSD" NARROW []
synonym: "FSP" NARROW []
synonym: "respirable crystalline silica" NARROW []
xref: CHEBI:30563
xref: CHEBI:46727
xref: MESH:D011791
xref: MESH:D012822
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2023-11-09T10:09:39Z

[Term]
id: XCO:0001099
name: controlled air crystalline silica content
def: "This is any condition in which the main influencing factor is respirable crystalline silica, which is breathable silica dust. The level of crystalline silica in the air surrounding an organism or breathed by an organism is determined by environmental conditions, work conditions, or controlled as part of an experiment." [https://leadlab.com/what-is-crystalline-silica-testing/, https://www.merriam-webster.com/]
synonym: "air crystalline silica content" EXACT []
synonym: "controlled air fracking sand dust content" NARROW []
synonym: "controlled air fracking sand particle content" NARROW []
synonym: "controlled air FSD content" NARROW []
synonym: "respirable crystalline silica content" EXACT []
xref: CHEBI:30563
xref: CHEBI:46727
xref: MESH:D011791
xref: MESH:D012822
is_a: XCO:0000009 ! controlled air content
is_a: XCO:0001098 ! crystalline silica
created_by: slaulederkind
creation_date: 2023-11-09T10:36:46Z

[Term]
id: XCO:0001100
name: physical manipulation
def: "This is any condition in which the main influencing factor is the use of manual or mechanical, non-surgical means to aid a patient or experimental animal in performing some biological activity for the purpose of examination, collection of samples, drug administration, therapy, or experimental manipulation. This may or may not require the use of tools or devices." [https://anti-doping.government.bg/en/m2-khimicheski-i-fizicheski-manipulatsii_p58.html, https://www.merriam-webster.com/]
xref: PMID:35627209
is_a: XCO:0000000 ! experimental condition
created_by: slaulederkind
creation_date: 2023-11-09T13:03:47Z

[Term]
id: XCO:0001101
name: urinary catheterization
def: "This is any condition in which the main influencing factor is urinary catheterization, the insertion of a tune through the urethra into the bladder to allow urine to drain from the bladder for collection or to allow injection of some substance." [https://en.wikipedia.org/wiki/Urinary_catheterization, ISBN-13:978-1455756438]
synonym: "Foley catheter" NARROW []
synonym: "Robinson catheter" NARROW []
synonym: "urethra catheterization" EXACT []
synonym: "urethral catheterization" EXACT []
is_a: XCO:0001100 ! physical manipulation
created_by: slaulederkind
creation_date: 2023-11-09T13:23:26Z

[Term]
id: XCO:0001102
name: serotonin hydrochloride
def: "This is any condition in which the main influencing factor is serotonin hydrochloride, the hydrochloride form of a primary amino compound (serotonin) that is the 5-hydroxy derivative of tryptamine." [CHEBI:28790]
synonym: "3-(2-aminoethyl)-1H-indol-5-ol;hydrochloride" EXACT []
synonym: "5-HT hydrochloride" EXACT []
synonym: "5-Hydroxytryptamine hydrochloride" EXACT []
synonym: "Serotonin HCl" EXACT []
xref: CHEBI:181195
is_a: XCO:0000144 ! neurotransmitter
created_by: slaulederkind
creation_date: 2023-11-09T14:26:08Z

[Term]
id: XCO:0001103
name: 17beta-estradiol 3-benzoate
def: "This is any condition in which the main influencing factor is 17beta-estradiol 3-benzoate, the C17&#946; benzoate ester of estradiol." [CID:222757]
synonym: "&#946;-estradiol 3-benzoate" EXACT []
synonym: "(17beta)-17-hydroxyestra-1(10),2,4-trien-3-yl benzoate" EXACT []
synonym: "estradiol 3-benzoate" EXACT []
synonym: "estradiol benzoate" EXACT []
xref: CHEBI:77006
is_a: XCO:0000092 ! 17 beta-estradiol
created_by: slaulederkind
creation_date: 2023-11-09T14:47:50Z

[Term]
id: XCO:0001104
name: QUAN-0808
def: "This is any condition in which the main influencing factor is Q808, an experimental phthalazine tetrazole derivative being tested for effectiveness as an anti-inflammatory, anticonvulsant, and analgesic drug." [ISBN-13:978-1455756438, PMID:23238472]
synonym: "6-(4-chlorophenoxy)-tetrazolo[5,1-a]phthalazine" EXACT []
synonym: "QUAN0808" EXACT []
xref: PMID:35831127
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000950 ! anticonvulsant
created_by: slaulederkind
creation_date: 2023-11-10T15:07:40Z

[Term]
id: XCO:0001105
name: controlled in situ ophthalmic condition
def: "This is any condition in which the main influencing factor is a controlled in situ ophthalmic condition, an experimental or medical condition in which the internal or external environment of the eye(s) is altered." [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "controlled in situ eye condition" EXACT []
is_a: XCO:0000166 ! controlled in situ organ condition
created_by: slaulederkind
creation_date: 2023-11-10T15:50:43Z

[Term]
id: XCO:0001106
name: retinal reperfusion
def: "This is any condition in which the main influencing factor is retinal reperfusion, the flow of blood to the retina being restored after a period of blood vessel occlusion occurring experimentally." [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "retina ischemia/reperfusion" EXACT []
synonym: "retina ischemia-reperfusion" EXACT []
synonym: "retinal ischemia-reperfusion" EXACT []
xref: DOID:9001725
is_a: XCO:0001105 ! controlled in situ ophthalmic condition
created_by: slaulederkind
creation_date: 2023-11-10T15:57:47Z

[Term]
id: XCO:0001107
name: polymer
def: "This is any condition in which the main influencing factor is a polymer, any of a class of natural or synthetic substances composed of very large molecules, called macromolecules, which are multiples of simpler chemical units called monomers." [https://www.britannica.com/science/polymer]
xref: PMID:36693849
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2023-11-13T12:40:55Z

[Term]
id: XCO:0001108
name: alginate
def: "This is any condition in which the main influencing factor is alginate, a naturally occurring anionic polymer typically obtained from brown seaweed. It is used as a wound dressing to keep the wound area moist." [PMID:22125349]
xref: PMID:36693849
is_a: XCO:0001107 ! polymer
created_by: slaulederkind
creation_date: 2023-11-13T12:50:44Z

[Term]
id: XCO:0001109
name: glycosaminoglycan
def: "This is any condition in which the main influencing factor is a glycosaminoglycan, any polysaccharide composed of repeating disaccharide units and containing a substantial proportion of amino monosaccharide residues. Glycosaminoglycans are constituents of mucoproteins, glycoproteins, and blood-group substances." [CHEBI:18085, https://www.merriam-webster.com/, https://www.ncbi.nlm.nih.gov/books/NBK544295/]
synonym: "GAG" EXACT []
synonym: "mucopolysaccharide" EXACT []
synonym: "s-GAG" NARROW []
synonym: "snail glycosaminoglycan" NARROW []
xref: PMID:36693849
relationship: has_component XCO:0000556 ! amino monosaccharide
created_by: slaulederkind
creation_date: 2023-11-13T13:21:20Z

[Term]
id: XCO:0001110
name: d-SMG
def: "This is any condition in which the main influencing factor is dried snail-mucus gel (SMG), a natural substance derived from mucus harvested from snails (Achatina fulica or Helix lucorum). The chemical composition of SMG includes a high percentage of heparin-like glycosaminoglycan." [https://www.merriam-webster.com/, PMID:36693849]
synonym: "dried SMG" EXACT []
synonym: "dried snail-mucus gel" EXACT []
synonym: "dried snail-mucus glue" EXACT []
xref: PMID:36693849
is_a: XCO:0000761 ! biologics and probiotics
created_by: slaulederkind
creation_date: 2023-11-13T14:10:33Z

[Term]
id: XCO:0001111
name: mercury dichloride
def: "This is any condition in which the main influencing factor is mercury dichloride, a mercury coordination entity made up of linear triatomic molecules in which a mercury atom is bonded to two chlorines. Water-soluble, it is highly toxic. Once used in a wide variety of applications, its use has markedly declined as less toxic alternatives have been developed." [CHEBI:31823]
synonym: "HgCl2" EXACT []
synonym: "Mercuric chloride" EXACT []
synonym: "mercury(2+) chloride" EXACT []
xref: MESH:D008627
xref: PMID:32599119
is_a: XCO:0001112 ! nephrotoxic chemical
is_a: XCO:0001549 ! inorganic chloride
created_by: slaulederkind
creation_date: 2023-11-14T09:45:49Z

[Term]
id: XCO:0001112
name: nephrotoxic chemical
def: "This is any condition in which the main influencing factor is a nephrotoxic substance that causes injury to the kidney or damages its function." [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "kidney toxicity-inducing chemical" EXACT []
synonym: "nephrotoxic agent" BROAD []
synonym: "nephrotoxicity-inducing chemical" EXACT []
synonym: "renal toxicity-inducing chemical" EXACT []
xref: CHEBI:50909
xref: PMID:32599119
is_a: XCO:0000259 ! disease-inducing chemical
created_by: slaulederkind
creation_date: 2023-11-14T13:26:51Z

[Term]
id: XCO:0001113
name: folic acid
def: "This is any condition in which the main influencing factor is folic acid, an N-acyl-amino acid that is a form of the water-soluble vitamin B9." [CHEBI:27470, https://www.merriam-webster.com/]
synonym: "folate" RELATED []
synonym: "folicin" EXACT []
synonym: "pteroylglutamic acid" EXACT []
synonym: "vitamin B9" EXACT []
xref: MESH:D005492
xref: PMID:33375730
is_a: XCO:0000119 ! amino acid
is_a: XCO:0000377 ! vitamin
created_by: slaulederkind
creation_date: 2023-11-14T14:00:24Z

[Term]
id: XCO:0001114
name: controlled folic acid content diet
def: "This is any condition in which the main influencing factor is a controlled folic acid content diet, a solid diet in which the amount of folic acid is maintained at a specified level. Folic acid is an N-acyl-amino acid that is a form of the water-soluble vitamin B9." [CHEBI:27470, https://www.merriam-webster.com/]
synonym: "controlled folicin content diet" EXACT []
synonym: "controlled  pteroylglutamic acid content diet" EXACT []
synonym: "controlled vitamin B9 content diet" EXACT []
xref: MESH:D005492
xref: PMID:33375730
is_a: XCO:0000690 ! controlled vitamin content diet
is_a: XCO:0001113 ! folic acid
created_by: slaulederkind
creation_date: 2023-11-14T14:18:28Z

[Term]
id: XCO:0001115
name: (6S)-5-methyltetrahydrofolic acid
def: "This is any condition in which the main influencing factor is (6S)-5-methyltetrahydrofolic acid, the primary biologically active form of folate (vitamin B9)." [CHEBI:136009, https://en.wikipedia.org/wiki/Levomefolic_acid]
synonym: "(6S)-5-MTHF" EXACT []
synonym: "Levomefolic acid" EXACT []
synonym: "N-[4-({[(6S)-2-amino-5-methyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid" EXACT []
xref: CHEBI:136009
xref: CID:135398561
xref: PMID:33375730
is_a: XCO:0000377 ! vitamin
created_by: slaulederkind
creation_date: 2023-11-14T16:20:34Z

[Term]
id: XCO:0001116
name: controlled (6S)-5-methyltetrahydrofolic acid content diet
def: "This is any condition in which the main influencing factor is a controlled (6S)-5-methyltetrahydrofolic acid content diet, a solid diet in which the amount of (6S)-5-methyltetrahydrofolic acid is maintained at a specified level. (6S)-5-methyltetrahydrofolic acid is the primary biologically active form of folate (vitamin B9)." [https://en.wikipedia.org/wiki/Levomefolic_acid, PMID:35999905]
synonym: "controlled (6S)-5-MTHF content diet" EXACT []
synonym: "controlled 5-MTHF content diet" EXACT []
xref: CHEBI:136009
xref: PMID:33375730
is_a: XCO:0000690 ! controlled vitamin content diet
is_a: XCO:0001115 ! (6S)-5-methyltetrahydrofolic acid
created_by: slaulederkind
creation_date: 2023-11-14T16:35:06Z

[Term]
id: XCO:0001117
name: pefloxacin
def: "This is any condition in which the main influencing factor is pefloxacin, a substituted quinolone that is an antibacterial agent and inhibitor of DNA biosynthesis." [CHEBI:50199]
synonym: "1-ethyl-6-fluoro-7-(4-methylpiperazin-1-yl)-4-oxo-1,4-dihydroquinoline-3-carboxylic acid" EXACT []
synonym: "pefloxacinium" EXACT []
xref: MESH:D015366
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-11-14T17:41:45Z

[Term]
id: XCO:0001118
name: experimental unilateral anterior crossbite
def: "This is any condition in which the main influencing factor is the use of a prosthetic device to generate a unilateral anterior crossbite in laboratory animals. A unilateral anterior crossbite is a specific type of dental malocclusion that creates temporomandibular joint osteoarthritis via biomechanical stress in the experimental subject or patient." [ISBN-13:978-1455756438, PMID:26746151]
synonym: "experimental UAC" EXACT []
xref: PMID:37919852
is_a: XCO:0001100 ! physical manipulation
created_by: slaulederkind
creation_date: 2023-11-16T12:12:51Z

[Term]
id: XCO:0001119
name: deionized water
def: "This is any condition in which the main influencing factor is deionized water, a form of purified water that is filtered through one or two tanks of ion-exchange resin which replaces cations with hydrogen (H+) ions and anions with hydroxyl (OH-) ions, leaving a mineral-free water." [https://www.merriam-webster.com/, https://www.waterdropfilter.com/blogs/water]
synonym: "deionized H2O" EXACT []
synonym: "pure water" BROAD []
xref: PMID:32745584
is_a: XCO:0000021 ! water
created_by: slaulederkind
creation_date: 2023-11-16T13:38:37Z

[Term]
id: XCO:0001120
name: almorexant
def: "This is any condition in which the main influencing factor is almorexant, an experimental drug developed to combat insomnia. Almorexant is a competitive, dual OX1 and OX2 receptor antagonist and selectively inhibits the functional consequences of OX1 and OX2 receptor activation, such as intracellular Ca2+ mobilization." [https://en.wikipedia.org/wiki/Almorexant]
synonym: "(2R)-2-[(1S)-6,7-dimethoxy-1-[2-[4-(triluoromethyl)phenyl]ethyl]-3,4-dihydro-1H-isoquinolin-2-yl]-N-methyl-2-phenylacetamide" EXACT []
synonym: "ACT-078573" EXACT []
xref: PMID:32066707
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulederkind
creation_date: 2023-11-16T14:00:56Z

[Term]
id: XCO:0001121
name: PEG 400
def: "This is any condition in which the main influencing factor is polyethylene glycol 400, a polymer composed of repeating ethyleneoxy units with an average molecular weight of 400. PEG 400 is a clear, colorless, liquid with low toxicity, affording wide use in a variety of pharmaceutical formulations." [CHEBI:46793, https://en.wikipedia.org/wiki/PEG_400]
synonym: "polyethylene glycol 400" EXACT []
xref: CHEBI:46793
is_a: XCO:0000926 ! polyethylene glycol
created_by: slaulederkind
creation_date: 2023-11-16T14:17:21Z

[Term]
id: XCO:0001122
name: antianxiety agent
def: "This is any condition in which the main influencing factor is an anti-anxiety agent, a medication or other intervention that reduces anxiety. Anxiolytic medications are used for the treatment of anxiety disorders and their related psychological and physical symptoms." [https://en.wikipedia.org/wiki/Anxiolytic, https://www.merriam-webster.com/]
synonym: "anti-anxiety agent" EXACT []
synonym: "anti-anxiety drug" EXACT []
synonym: "antianxiety drug" EXACT []
synonym: "antipanic agent" EXACT []
synonym: "anxiolytic" EXACT []
synonym: "anxiolytic medication" EXACT []
synonym: "Not4Curation" RELATED []
xref: MESH:D014151
xref: PMID:37966567
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: slaulederkind
creation_date: 2023-11-17T10:05:28Z

[Term]
id: XCO:0001123
name: alpidem
def: "This is any condition in which the main influencing factor is alpidem, a drug formerly used to treat anxiety disorders but its medical use was discontinued due to liver toxicity." [https://en.wikipedia.org/wiki/Alpidem]
xref: CHEBI:135649
xref: MESH:C052036
xref: PMID:32119089
is_a: XCO:0001122 ! antianxiety agent
created_by: slaulederkind
creation_date: 2023-11-17T10:28:29Z

[Term]
id: XCO:0001124
name: amiodarone
def: "This is any condition in which the main influencing factor is amiodarone, an antianginal and class III antiarrhythmic drug that increases the duration of ventricular and atrial muscle action by inhibiting potassium channels and voltage-gated sodium channels. Following the channel inhibition is a resulting decrease in heart rate and in vascular resistance." [MESH:D000638]
synonym: "(2-butyl-1-benzofuran-3-yl){4-[2-(diethylamino)ethoxy]-3,5-diiodophenyl}methanone" EXACT []
synonym: "Amiodarona" EXACT []
synonym: "Amiodaronum" EXACT []
synonym: "Cordarone" EXACT []
xref: CHEBI:2663
xref: PMID:32119089
is_a: XCO:0000225 ! potassium channel inhibitor
is_a: XCO:0000618 ! sodium channel inhibitor
created_by: slaulederkind
creation_date: 2023-11-17T11:29:29Z

[Term]
id: XCO:0001125
name: amoxicillin
def: "This is any condition in which the main influencing factor is amoxicillin, a penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-(4-hydroxyphenyl)acetamido group. Amoxicillin is a broad-spectrum semisynthetic antibiotic similar to AMPICILLIN except that its resistance to gastric acid permits higher serum levels with oral administration." [CHEBI:2676, MESH:D000658]
synonym: "amox" EXACT []
synonym: "amoxycillin" EXACT []
xref: PMID:32119089
is_a: XCO:0001202 ! penicillin
created_by: slaulederkind
creation_date: 2023-11-17T12:03:49Z

[Term]
id: XCO:0001126
name: curcumin
def: "This is any condition in which the main influencing factor is curcumin , a beta-diketone that is obtained from tumeric, the powdered root of Curcuma longa. Curcumin appears to possess a spectrum of pharmacological properties, due primarily to its inhibitory effects on metabolic enzymes." [CHEBI:3962, MESH:D003474]
synonym: "(1E,6E)-1,7-bis(4-hydroxy-3-methoxyphenyl)hepta-1,6-diene-3,5-dione" EXACT []
synonym: "Diferuloylmethane" EXACT []
xref: PMID:37916359
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulederkind
creation_date: 2023-11-17T14:16:02Z

[Term]
id: XCO:0001127
name: Buyang Huanwu decoction
def: "This is any condition in which the main influencing factor is BHD (Buyang Huanwu Decoction), a multi-herbal composition (classic traditional chinese medicine formula) commonly prescribed in the treatment of cerebrovascular diseases." [PMID:32171896]
synonym: "BHD" EXACT []
synonym: "BHF" EXACT []
synonym: "Boyang Hwano Decoction" EXACT []
synonym: "Buyang Huanwu Formula" EXACT []
synonym: "Bu Yang Huan WU Tang" EXACT []
synonym: "Buyang Huanwu Tang" EXACT []
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2023-11-17T14:41:23Z

[Term]
id: XCO:0001128
name: polysaccharide derivative
def: "This is any condition in which the main influencing factor is a polysaccharide derivative, a carbohydrate derivative that is any derivative of a polysaccharide (a biomacromolecule consisting of large numbers of monosaccharide residues linked glycosidically). Various molecules can be covalently attached to the hydroxyl groups of polysaccharides and thus form polysaccaride derivatives." [CHEBI:65212, https://en.wikipedia.org/wiki/Polysaccharide#Derivatives]
synonym: "polycarbohydrate derivative" EXACT []
xref: PMID:32119089
is_a: XCO:0000173 ! polysaccharide
created_by: slaulederkind
creation_date: 2023-11-17T18:00:43Z

[Term]
id: XCO:0001129
name: carboxymethylcellulose
def: "This is any condition in which the main influencing factor is carboxymethylcellulose, a polysaccharide derivative that is cellulose in which carboxymethyl groups are bound to some of the hydroxyl groups of the glucopyranose monomers." [CHEBI:85146, https://en.wikipedia.org/wiki/Carboxymethyl_cellulose]
synonym: "carboxymethyl cellulose" EXACT []
synonym: "cellulose gum" EXACT []
synonym: "CMC" EXACT []
xref: PMID:32119089
is_a: XCO:0001128 ! polysaccharide derivative
is_a: XCO:0001232 ! emulsifier
created_by: slaulederkind
creation_date: 2023-11-17T18:06:34Z

[Term]
id: XCO:0001130
name: amprenavir
def: "This is any condition in which the main influencing factor is amprenavir, a protease inhibitor designed to treat HIV infections. Amprenavir has been replaced by fosamprenavir, a prodrug of amprenavir." [https://en.wikipedia.org/wiki/Amprenavir]
synonym: "[(3S)-oxolan-3-yl] N-[(2S,3R)-4-[(4-aminophenyl)sulfonyl-(2-methylpropyl)amino]-3-hydroxy-1-phenylbutan-2-yl]carbamate" EXACT []
xref: CHEBI:40050
xref: MESH:C095108
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000657 ! antiviral agent
created_by: slaulederkind
creation_date: 2023-11-20T18:47:45Z

[Term]
id: XCO:0001131
name: azithromycin
def: "This is any condition in which the main influencing factor is azithromycin, a semi-synthetic, broad-spectrum, macrolide antibiotic structurally related to erythromycin. It has been used in the treatment of various types of bacterial infections." [https://en.wikipedia.org/wiki/Azithromycin, MESH:D017963]
synonym: "9-deoxo-9a-aza-9a-methyl-9a-homoerythromycin" EXACT []
synonym: "Azasite" NARROW []
synonym: "Zithromax" NARROW []
xref: CHEBI:2955
xref: PMID:32119089
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2023-11-21T10:56:37Z

[Term]
id: XCO:0001132
name: sesame oil
def: "This is any condition in which the main influencing factor is sesame oil, an edible vegetable oil derived from sesame seeds. Sesame oil can be used as a solvent for an injected drug or an intravenous drip." [https://en.wikipedia.org/wiki/Sesame_oil]
synonym: "sesame seed oil" EXACT []
xref: PMID:32119089
is_a: XCO:0000774 ! oil
created_by: slaulederkind
creation_date: 2023-11-21T14:26:20Z

[Term]
id: XCO:0001133
name: bardoxolone
def: "This is any condition in which the main influencing factor is bardoxolone, a synthetic triterpenoid compound with potential antineoplastic and anti-inflammatory activities. Bardoxolone blocks the synthesis of inducible nitric oxide synthase (iNOS) and inducible cyclooxygenase (COX-2), two enzymes involved in inflammation and carcinogenesis." [NCI:C48382]
synonym: "(4aS,6aR,6bS,8aR,12aS,14aR,14bS)-11-cyano-2,2,6a,6b,9,9,12a-heptamethyl-10,14-dioxo-1,3,4,5,6,7,8,8a,14a,14b-decahydropicene-4a-carboxylic acid" EXACT []
synonym: "CDDO" EXACT []
synonym: "RTA 401" EXACT []
synonym: "RTA-401" EXACT []
xref: CHEBI:177450
xref: CID:400010
xref: PMID:32119089
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulederkind
creation_date: 2023-11-21T14:43:36Z

[Term]
id: XCO:0001134
name: caffeine
def: "This is any condition in which the main influencing factor is caffeine, a methylxanthine naturally occurring in some beverages and also used as a pharmacological agent. Caffeine's most notable pharmacological effect is as a central nervous system stimulant, increasing alertness and producing agitation." [MESH:D002110]
synonym: "MESH:D002110" EXACT []
xref: CHEBI:27732
is_a: XCO:0000122 ! diuretic
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-11-27T18:04:45Z

[Term]
id: XCO:0001135
name: carbamazepine
def: "This is any condition in which the main influencing factor is carbamazepine, a dibenzazepine that acts as a sodium channel blocker. Carbamazepine is used as an anticonvulsant and it may also be used in the management of bipolar disorder and neuropathic pain." [https://en.wikipedia.org/wiki/Carbamazepine, MESH:D002220]
synonym: "5H-dibenzo[b,f]azepine-5-carboxamide" EXACT []
synonym: "CBZ" EXACT []
synonym: "Tegretol" EXACT []
xref: CHEBI:3387
xref: CID:2554
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000618 ! sodium channel inhibitor
is_a: XCO:0000950 ! anticonvulsant
created_by: slaulederkind
creation_date: 2023-11-30T14:31:38Z

[Term]
id: XCO:0001136
name: propylene glycol
def: "This is any condition in which the main influencing factor is propylene glycol, a synthetic small organic alcohol that is hydrophylic. Propylene glycol has various laboratory, pharmaceutical, and industrial uses." [CID:1030, https://en.wikipedia.org/wiki/Propylene_glycol]
synonym: "1,2-dihydroxypropane" EXACT []
synonym: "1,2-propanediol" EXACT []
synonym: "MESH:D019946" EXACT []
synonym: "methyl glycol" EXACT []
synonym: "trimethyl glycol" EXACT []
is_a: XCO:0000323 ! alcohol
created_by: slaulederkind
creation_date: 2023-11-30T14:55:03Z

[Term]
id: XCO:0001137
name: carisoprodol
def: "This is any condition in which the main influencing factor is carisoprodol, a carbamate ester which is a centrally acting skeletal muscle relaxant whose mechanism of action may be related to its sedative actions. Carisoprodol is used for the relief of discomfort associated with acute, painful musculoskeletal conditions." [https://www.ncbi.nlm.nih.gov/books/NBK553077, MESH:D002328]
synonym: "2-[(carbamoyloxy)methyl]-2-methylpentyl propan-2-ylcarbamate" EXACT []
synonym: "Carisoprodate" EXACT []
synonym: "Isomeprobamate" EXACT []
xref: CHEBI:3419
is_a: XCO:0000511 ! ester
created_by: slaulederkind
creation_date: 2023-11-30T15:30:53Z

[Term]
id: XCO:0001138
name: cefprozil
def: "This is any condition in which the main influencing factor is cefprozil, a semisynthetic, second-generation cephalosporin. Cefprozil is used to treat bronchitis as well as ear, skin and other bacterial infections." [CHEBI:3506, CID:5281006]
synonym: "Cefzil" EXACT []
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2023-11-30T15:49:04Z

[Term]
id: XCO:0001139
name: chloramphenicol
def: "This is any condition in which the main influencing factor is chloramphenicol, a topical,broad-spectrum antibiotic first isolated from cultures of Streptomyces venequelae but now produced synthetically. Chloramphenicol act s by interfering with bacterial protein synthesis" [MESH:D002701]
synonym: "2,2-dichloro-N-[(1R,2R)-2-hydroxy-1-(hydroxymethyl)-2-(4-nitrophenyl)ethyl]acetamide" EXACT []
xref: CHEBI:17698
xref: CID:5959
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2023-12-01T08:16:50Z

[Term]
id: XCO:0001140
name: chlormezanone
def: "This is any condition in which the main influencing factor is chlormezanone, an anxiolytic drug, a muscle relaxant and an antipsychotic agent whose clinical use was discontinued because of rare but serious cutaneous reactions." [CHEBI:3619]
synonym: "Chlormethazanone" EXACT []
synonym: "Chlormethazone" EXACT []
synonym: "Clormetazanone" EXACT []
xref: CID:2717
is_a: XCO:0001122 ! antianxiety agent
created_by: slaulederkind
creation_date: 2023-12-01T08:45:42Z

[Term]
id: XCO:0001141
name: scrambled control oligonucleotide
def: "This is any condition in which the main influencing factor is a negative control oligonucleotide. A negative control oligonucleotide is an oligonucleotide with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental oligonucleotide used." [https://en.wikipedia.org/wiki/Oligonucleotide, https://www.oligotherapeutics.org/april-2019-paper-of-the-month/]
synonym: "scrambled control RNA oligomer" EXACT []
synonym: "scrambled control RNA oligonucleotide" EXACT []
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulederkind
creation_date: 2023-12-01T09:58:36Z

[Term]
id: XCO:0001142
name: transfer of MIR143 mimic
def: "This is any condition in which the main influencing factor is a MIR143 mimic transferred into an organism or cell culture. MIR143 mimic is a chemically modified double-stranded RNA molecule designed to mimic endogenous MIR143 function. MIR143 is associated with cardiovascular and other diseases." [https://www.thermofisher.com/us/en/home/life-science/epigenetics-noncoding-rna-research/mirna-analysis/mirna-mimics-inhibitors.html, RGD:1346221]
synonym: "transfection of MIR-143 mimic" EXACT []
synonym: "transfection of MIR143 mimic" EXACT []
synonym: "transfer of MIR-143 mimic" EXACT []
synonym: "transfer of miR143 mimic" EXACT []
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulederkind
creation_date: 2023-12-01T09:58:47Z

[Term]
id: XCO:0001143
name: Limosilactobacillus reuteri
def: "This is any condition in which the main influencing factor is Limosilactobacillus reuteri (a lactic acid bacterium). L. reuteri is a probiotic bacterium found in a variety of natural environments, including the gastrointestinal tract of humans and other animals." [https://en.wikipedia.org/wiki/Limosilactobacillus_reuteri, PMID:35336098]
synonym: "L. reuteri" EXACT []
synonym: "Lactobacillus fermentum biotype II" EXACT []
synonym: "Lactobacillus reuteri" EXACT []
xref: PMID:37422471
is_a: XCO:0001212 ! bacteria
created_by: slaulederkind
creation_date: 2023-12-01T11:19:30Z

[Term]
id: XCO:0001144
name: chlorpropamide
def: "Thhis is any condition in which the main influencing factor is chlorpropamide, an N-sulfonylurea that is a hypoglycaemic agent used in the treatment of type 2 (non-insulin-dependent) diabetes mellitus not responding to dietary modification." [CHEBI:3650, MESH:D002747]
synonym: "Chloropropamide" EXACT []
synonym: "CID:2727" EXACT []
xref: PMID:32119089
is_a: XCO:0000407 ! hypoglycemic agent
created_by: slaulederkind
creation_date: 2023-12-04T11:26:47Z

[Term]
id: XCO:0001145
name: cimetidine
def: "This is any condition in which the main influencing factor is cimetidine, an H2-receptor antagonist that inhibits gastric acid secretion, as well as pepsin and gastrin output." [MESH:D002927]
synonym: "2-cyano-1-methyl-3-(2-{[(5-methyl-1H-imidazol-4-yl)methyl]sulfanyl}ethyl)guanidine" EXACT []
synonym: "Tagamet" EXACT []
xref: CHEBI:3699
xref: CID:2756
xref: PMID:32119089
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulederkind
creation_date: 2023-12-04T11:54:03Z

[Term]
id: XCO:0001146
name: clarithromycin
def: "This is any condition in which the main influencing factor is clarithromycin, a synthetic macrolide antibiotic used in the treatment of respiratory-tract, skin and soft-tissue infections. Clarithromycin is derived from erythromycin and is a protein synthesis inhibitor in bacteria." [CHEBI:3732, MESH:D017291]
synonym: "Clarithromycine" EXACT []
synonym: "Clathromycin" EXACT []
xref: CID:84029
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000532 ! protein synthesis inhibitor
created_by: slaulederkind
creation_date: 2023-12-04T13:52:47Z

[Term]
id: XCO:0001147
name: clofibrate
def: "This is any condition whose main influencing factor is clofibrate, a fibric acid derivative used in the treatment of hyperlipoproteinemia type III and severe hypertriglyceridemia." [MESH:D002994]
synonym: "ethyl 2-(4-chlorophenoxy)-2-methylpropanoate" EXACT []
synonym: "ethyl clofibrate" EXACT []
xref: CHEBI:3750
xref: CID:2796
xref: PMID:32119089
is_a: XCO:0000680 ! antilipemic agent
created_by: slaulederkind
creation_date: 2023-12-04T14:05:02Z

[Term]
id: XCO:0001148
name: clopidogrel
def: "This is any condition whose main influencing factor is clopidogrel, a ticlopidine analog and platelet P2Y12 receptor antagonist that inhibits adenosine diphosphate-mediated platelet aggregation. It is used to prevent thromboembolism in patients with arterial occlusive diseases." [MESH:D000077144]
synonym: "methyl (2S)-(2-chlorophenyl)(6,7-dihydrothieno[3,2-c]pyridin-5(4H)-yl)acetate" EXACT []
synonym: "Plavix" EXACT []
xref: CHEBI:37941
xref: PMID:32119089
is_a: XCO:0001238 ! ticlopidine
created_by: slaulederkind
creation_date: 2023-12-04T14:19:35Z

[Term]
id: XCO:0001149
name: clozapine
def: "This is any condition whose main influencing factor is clozapine, a tricylic dibenzodiazepinethat binds several types of central nervous system receptors. Clozapine is a serotonin antagonist, with strong binding to 5-HT 2A/2C receptor subtype. It also displays strong affinity to several dopaminergic receptors, but shows only weak antagonism at the dopamine D2 receptor." [MESH:D003024]
synonym: "8-chloro-11-(4-methylpiperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine" EXACT []
xref: CHEBI:3766
xref: PMID:32119089
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulederkind
creation_date: 2023-12-04T14:30:46Z

[Term]
id: XCO:0001150
name: compound Z
def: "This is any condition whose main influencing factor is compound Z, a pterin phosphate that is an oxidation product of cPMP (fosdenopterin). It is functionally related to a neopterin. Compound Z is a pharmacologically inactive product of fosdenopterin metabolism." [CID:135889290]
synonym: "2-amino-6-{[(4S,5R)-2,5-dihydroxy-2-oxido-1,3,2-dioxaphosphinan-4-yl]carbonyl}pteridin-4(3H)-one" EXACT []
xref: CHEBI:60211
xref: PMID:32119089
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2023-12-04T14:51:06Z

[Term]
id: XCO:0001151
name: Augmentin
def: "This is any condition whose main influencing factor is Augmentin, a fixed-ratio combination of amoxicillin trihydrate and potassium clavulanate. Augmentin is a broad-spectrum antibiotic." [MESH:D019980]
synonym: "Amoxicillin clavulanate potassium" EXACT []
synonym: "Amoxicillin-Clavulanic Acid" EXACT []
synonym: "Amoxycillin-Clavulanic Acid" EXACT []
synonym: "Clavamox" EXACT []
synonym: "co-amoxiclav" EXACT []
xref: CID:23665637
xref: MESH:D019980
xref: PMID:32119089
relationship: has_component XCO:0001125 ! amoxicillin
created_by: slaulederkind
creation_date: 2023-12-04T15:22:17Z

[Term]
id: XCO:0001152
name: diltiazem
def: "This is any condition whose main influencing factor is diltiazem, a benzothiazepine derivative that is a calcium-channel blocker and vasodilator. Diltiazem is used in the hydrochloride form in the management of angina pectoris and hypertension." [CHEBI:101278]
synonym: "(2S,3S)-5-[2-(dimethylamino)ethyl]-2-(4-methoxyphenyl)-4-oxo-2,3,4,5-tetrahydro-1,5-benzothiazepin-3-yl acetate" EXACT []
xref: CID:39186
xref: MESH:D004110
xref: PMID:32119089
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000269 ! calcium channel inhibitor
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulederkind
creation_date: 2023-12-04T15:40:48Z

[Term]
id: XCO:0001153
name: diphenhydramine
def: "This is any condition whose main influencing factor is diphenhydramine, an histamine H1 antagonist used for for hypersensitivity reactions, for pruritus, as a hypnotic, and as an ingredient in common cold preparations." [MESH:D004155]
synonym: "2-(diphenylmethoxy)-N,N-dimethylethanamine" EXACT []
synonym: "Benedryl" EXACT []
xref: CHEBI:4636
xref: CID:3100
xref: PMID:32119089
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulederkind
creation_date: 2023-12-04T15:53:25Z

[Term]
id: XCO:0001154
name: dipyridamole
def: "This is any condition whose main influencing factor is dipyridamole, a phosphodiesterase inhibitor that blocks uptake and metabolism of adenosine by erythrocytes and vascular endothelial cells. Dipyridamole is an inhibitor of platelet aggregation and a vasodilator agent." [CHEBI:4653, MESH:D004176]
synonym: "2,2',2'',2'''-[(4,8-dipiperidin-1-ylpyrimido[5,4-d]pyrimidine-2,6-diyl)dinitrilo]tetraethanol" EXACT []
synonym: "2,6-Bis(diethanolamino)-4,8-dipiperidinopyrimido(5,4-d)pyrimidine" EXACT []
xref: CID:3108
xref: PMID:32119089
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-12-05T12:10:08Z

[Term]
id: XCO:0001155
name: disopyramide
def: "This is any condition whose main influencing factor is disopyramide, a sodium channel blocker and class I anti-arrhythmic agent with a depressant action on the heart similar to that of guanidine. Disopyramide also possesses some anticholinergic and local anesthetic properties." [https://en.wikipedia.org/wiki/Disopyramide, MESH:D004206]
synonym: "4-(diisopropylamino)-2-phenyl-2-pyridin-2-ylbutanamide" EXACT []
xref: CHEBI:4657
xref: CID:3114
is_a: XCO:0000618 ! sodium channel inhibitor
created_by: slaulederkind
creation_date: 2023-12-05T13:44:50Z

[Term]
id: XCO:0001156
name: erythromycin
def: "This is any condition whose main influencing factor is erythromycin, any of several wide-spectrum macrolide antibiotics obtained from actinomycete Saccharopolyspora erythraea (Streptomyces erythraeus). Erythromycin inhibits protein synthesis by binding to 50S ribosomal subunits, thus interfering with translocation of amino acids during translation and assembly of proteins" [CHEBI:48923, MESH:D004917]
xref: CID:12560
xref: PMID:32119089
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000532 ! protein synthesis inhibitor
created_by: slaulederkind
creation_date: 2023-12-05T13:56:45Z

[Term]
id: XCO:0001157
name: esomeprazole
def: "This is any condition in which the main influencing factor is esomeprazole, an inhibitor of gastric acid secretion used for the treatment of gastro-oesophageal reflux disease, dyspepsia, peptic ulcer disease, and Zollinger-Ellison syndrome." [CHEBI:50275]
xref: CID:9568614
xref: MESH:D064098
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-12-05T14:18:05Z

[Term]
id: XCO:0001158
name: ethambutol
def: "This is any condition whose main influencing factor is ethambutol, an ethylenediamine derivative that is an antimycobacterial drug, effective against Mycobacterium tuberculosis and some other mycobacteria." [CHEBI:4877]
synonym: "(2S,2'S)-2,2'-(ethane-1,2-diyldiimino)dibutan-1-ol" EXACT []
xref: CID:14052
xref: MESH:D004977
xref: PMID:32119089
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2023-12-05T14:29:06Z

[Term]
id: XCO:0001159
name: felbamate
def: "This is any condition whose main influencing factor is felbamate, a PEGylated phenylcarbamate derivative that acts as an antagonist of NMDA receptors. Felbamate is used as an anticonvulsant, primarily for the treatment of seizures in severe refractory epilepsy." [MESH:D000078328]
synonym: "2-phenylpropane-1,3-diyl dicarbamate" EXACT []
xref: CHEBI:4995
xref: PMID:32119089
is_a: XCO:0000950 ! anticonvulsant
created_by: slaulederkind
creation_date: 2023-12-07T11:57:35Z

[Term]
id: XCO:0001160
name: flucloxacillin
def: "This is any condition in which the main influencing factor is flucloxacillin, a penicillin anti-bacterial drug used to treat skin infections, external ear infections, infections of leg ulcers, diabetic foot infections, and infection of bone" [https://en.wikipedia.org/wiki/Flucloxacillin, MESH:D005436]
synonym: "6beta-[3-(2-chloro-6-fluorophenyl)-5-methyl-1,2-oxazole-4-carboxamido]-2,2-dimethylpenam-3alpha-carboxylic acid" EXACT []
synonym: "Floxacillin" EXACT []
xref: CHEBI:5098
xref: CID:21319
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2023-12-07T13:24:24Z

[Term]
id: XCO:0001161
name: fluoxetine
def: "This is any condition whose main influencing factor is fluoxetine, the first highly specific serotonin reuptake inhibitor (SSRI). It is used as an antidepressant and often has a more acceptable side-effects profile than traditional antidepressants." [MESH:D005473]
synonym: "Methyl({3-phenyl-3-[4-(trifluoromethyl)phenoxy]propyl})amine" EXACT []
synonym: "N-Methyl-3-(p-trifluoromethylphenoxy)-3-phenylpropylamine" EXACT []
synonym: "rac-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine" EXACT []
xref: CID:3386
is_a: XCO:0000561 ! antidepressant
created_by: slaulederkind
creation_date: 2023-12-07T13:36:29Z

[Term]
id: XCO:0001162
name: flutamide
def: "This is any condition in which the main influencing factor is flutamide ,a monocarboxylic acid amide which has a role as an androgen receptor antagonist and an antineoplastic agent." [CID:3397]
synonym: "2-methyl-N-[4-nitro-3-(trifluoromethyl)phenyl]propanamide" EXACT []
synonym: "4'-Nitro-3'-trifluoromethylisobutyranilide" EXACT []
synonym: "NFBA" EXACT []
synonym: "niftolid" EXACT []
xref: CHEBI:5132
xref: MESH:D005485
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0000435 ! antineoplastic agent
created_by: slaulederkind
creation_date: 2023-12-07T13:51:59Z

[Term]
id: XCO:0001163
name: hydroxyzine
def: "This is any condition whose main influencing factor is hydroxyzine, a histamine H1 receptor antagonist that is an anxiolytic drug, a dermatologic drug, an antipruritic drug and an anticoronaviral agent." [CID:3658, MESH:D006919]
synonym: "2-(2-{4-[(4-chlorophenyl)(phenyl)methyl]piperazin-1-yl}ethoxy)ethanol" EXACT []
xref: CHEBI:5818
xref: PMID:32119089
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0001122 ! antianxiety agent
created_by: slaulederkind
creation_date: 2023-12-07T14:15:00Z

[Term]
id: XCO:0001164
name: labetalol
def: "This is any condition whose main influencing factor is labetalol, a salicylamide derivative that is a non-cardioselective blocker of beta-adrenergic receptors and alpha-1 adrenergic receptors used to treat high blood pressure." [CHEBI:6343, MESH:D007741]
synonym: "2-hydroxy-5-{1-hydroxy-2-[(1-methyl-3-phenylpropyl)amino]ethyl}benzamide" EXACT []
synonym: "3-Carboxamido-4-hydroxy-alpha-((1-methyl-3-phenylpropylamino)methyl)benzyl alcohol" EXACT []
synonym: "kabetalol" EXACT []
xref: CID:3869
xref: PMID:32119089
is_a: XCO:0000336 ! adrenergic antagonist
created_by: slaulederkind
creation_date: 2023-12-07T15:57:48Z

[Term]
id: XCO:0001165
name: lapatinib
def: "This is any condition whose main influencing factor is lapatinib, a quinazoline derivative that inhibits epidermal growth factor receptor (Egfr) and erb-b2 receptor tyrosine kinase 2 (Erbb2/Her2) tyrosine kinases. It is used for the treatment of advanced or metastatic breast cancer, where tumors overexpress Erbb2/Her2." [MESH:D000077341]
synonym: "lapatinib ditosylate" EXACT []
synonym: "N-[3-chloro-4-(3-fluorobenzyloxy)phenyl]-6-[5-({[2-(methanesulfonyl)ethyl]amino}methyl)furan-2-yl]quinazolin-4-amine" EXACT []
xref: CHEBI:49603
xref: CID:208908
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulederkind
creation_date: 2023-12-07T19:22:36Z

[Term]
id: XCO:0001166
name: hydroxypropyl methylcellulose
def: "This is any condition in which the main influencing factor is hydroxypropyl methylcellulose, a semisynthetic, inert, viscoelastic polymer used in eye drops, as well as an excipient and controlled-delivery component in oral medicaments, found in a variety of commercial products." [https://en.wikipedia.org/wiki/Hypromellose]
synonym: "(hydroxypropyl)methyl cellulose" EXACT []
synonym: "HPMC" EXACT []
synonym: "hydroxypropyl methyl cellulose" EXACT []
synonym: "hypromellose" EXACT []
xref: CHEBI:30618
is_a: XCO:0000789 ! methylcellulose
created_by: slaulederkind
creation_date: 2023-12-07T19:37:18Z

[Term]
id: XCO:0001167
name: polysorbate
def: "This is any condition in which the main influencing factor is any poly(ethylene glycol) derivative composed of PEG-ylated sorbitan [2-(1,2-dihydroxyethyl)tetrahydrofuran-3,4-diol] normally containing a total of 20 oxyethylene groups, with one or more of the terminal hydroxy groups esterified with a fatty acyl group. They are used as emulsifiers and dispersing agents in some pharmaceuticals products and as defoamers and emulsifiers in some foods." [CHEBI:53422]
synonym: "polysorbates" EXACT []
synonym: "tweens" EXACT []
is_a: XCO:0001232 ! emulsifier
relationship: has_component XCO:0000926 ! polyethylene glycol
created_by: slaulederkind
creation_date: 2023-12-07T19:52:38Z

[Term]
id: XCO:0001168
name: polysorbate 80
def: "This is any condition in which the main influencing factor is polysorbate 80, a polymer composed of PEG-ylated sorbitan and oleic acid. Polysorbate 80 is a nonionic surfactant and emulsifier often used in pharmaceuticals, foods, and cosmetics." [CHEBI:53426, https://en.wikipedia.org/wiki/Polysorbate_80]
synonym: "(x)-sorbitan mono-9-octadecenoate poly(oxy-1,2-ethanediyl)" EXACT []
synonym: "Kolliphor PS 80" EXACT []
synonym: "polyoxyethylene (80) sorbitan monooleate" EXACT []
synonym: "PS 80" EXACT []
synonym: "Tween 80" EXACT []
is_a: XCO:0001167 ! polysorbate
created_by: slaulederkind
creation_date: 2023-12-07T20:01:09Z

[Term]
id: XCO:0001169
name: controlled ethanol content deionized water used as vehicle
def: "This is any condition in which the vehicle is made up of deionized water and a specified amount of ethanol, serving as a solvent for some specified chemical." [https://www.merriam-webster.com/]
synonym: "ethanol in deionized water used as vehicle" EXACT []
is_a: XCO:0001119 ! deionized water
relationship: has_component XCO:0000325 ! ethanol
created_by: slaulederkind
creation_date: 2023-12-07T22:13:55Z

[Term]
id: XCO:0001170
name: levofloxacin
def: "This is any condition whose main influencing factor is levofloxacin, a fluoroquinolone antibiotic with activity against both gram-negative and gram-positive bacteria compared to R-(+)-ofloxacin and remains stereochemically stable following administration (i.e. it does not invert to the inactive isomer). Levofloxacin is an inhibitor of bacterial topoisomerase IV and DNA gyrase." [CID:149096]
synonym: "(3S)-9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid" EXACT []
xref: CHEBI:63598
xref: MESH:D064704
is_obsolete: true
created_by: slaulederkind
creation_date: 2023-12-08T14:26:27Z

[Term]
id: XCO:0001171
name: levofloxacin
alt_id: XCO:0001170
def: "This is any condition whose main influencing factor is levofloxacin, a fluoroquinolone antibiotic that is active against both gram-negative and gram-positive bacteria. Levofloxacin is an inhibitor of both bacterial topoisomerase IV and DNA gyrase." [CHEBI:63598, CID:149096]
synonym: "(3S)-9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid" EXACT []
xref: CHEBI:63598
xref: MESH:D064704
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-12-08T15:45:16Z

[Term]
id: XCO:0001172
name: lopinavir
def: "This is any condition in which the main influencing factor is lopinavir, an HIV protease inhibitor used in a fixed-dose combination with ritonavir. Lopinavir is also a cytochrome P-450 inhibitor." [MESH:D061466]
synonym: "(2S)-N-[(2S,4S,5S)-5-{[(2,6-dimethylphenoxy)acetyl]amino}-4-hydroxy-1,6-diphenylhexan-2-yl]-3-methyl-2-(2-oxotetrahydropyrimidin-1(2H)-yl)butanamide" EXACT []
synonym: "LPV" EXACT []
xref: CHEBI:31781
xref: CID:92727
is_a: XCO:0000657 ! antiviral agent
is_a: XCO:0000748 ! protease inhibitor
created_by: slaulederkind
creation_date: 2023-12-08T16:01:36Z

[Term]
id: XCO:0001173
name: loracarbef
def: "This is any condition in which the main influencing factor is loracarbef, a carbacephem antibiotic used to treat a wide range of infections caused by both gram-positive and gram-negative bacteria." [CID:5284585]
synonym: "7beta-[(2R)-2-amino-2-phenylacetyl]nitrilo-3-chloro-3,4-didehydrocepham-4-carboxylic acid" EXACT []
synonym: "loracarbef anhydrous" EXACT []
xref: CHEBI:47544
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2023-12-08T16:13:54Z

[Term]
id: XCO:0001174
name: lumiracoxib
def: "This is any condition whose main influencing factor is lumiracoxib, a highly selective cyclooxygenase 2 inhibitor used for the treatment of osteoarthritis until it was withdrawn from use due to concerns of hepatotoxicity." [CHEBI:73044]
synonym: "lumiracoxibum" EXACT []
synonym: "LUR" EXACT []
synonym: "{2-[(2-chloro-6-fluorophenyl)amino]-5-methylphenyl}acetic acid" EXACT []
xref: CID:151166
xref: MESH:C473384
xref: PMID:32119089
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000506 ! non-steroidal anti-inflammatory drug
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-12-08T16:29:47Z

[Term]
id: XCO:0001175
name: acetone
def: "This is any condition in which the main influencing factor is acetone, a methyl ketone that consists of propane bearing an oxo group at C2. Acetone is used as a solvent and an antiseptic. It is one of the ketone bodies produced during ketoacidosis. Acetone is used to make drugs and other chemicals." [CHEBI:15347, CID:180]
synonym: "2-propanal" EXACT []
synonym: "2-propanone" EXACT []
synonym: "beta-ketopropane" EXACT []
synonym: "dimethyl ketone" EXACT []
synonym: "propan-2-one" EXACT []
xref: MESH:D000096
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2023-12-08T19:35:08Z

[Term]
id: XCO:0001176
name: LY2886721
def: "This is any condition whose main influencing factor is LY2886721, an inhibitor of protease beta-secretase 1 (BACE1), which is a key protease controlling the formation of amyloid &#946; (a peptide hypothesized to play a significant role in the pathogenesis of Alzheimer's disease)." [PMID:25609634]
synonym: "LY-2886721" EXACT []
synonym: "N-(3-((4aS,7aS)-2-amino-4a,5,7,7a-tetrahydro-4H-furo[3,4-d][1,3]thiazin-7a-yl)-4-fluorophenyl)-5-fluoropicolinamide" EXACT []
xref: CID:49837968
xref: PMID:32119089
is_a: XCO:0000748 ! protease inhibitor
created_by: slaulederkind
creation_date: 2023-12-09T10:23:21Z

[Term]
id: XCO:0001177
name: megestrol
def: "This is any condition in which the main influencing factor is megestrol, a 3-oxo Delta(4)-steroid that is a progestational hormone used most commonly as the acetate ester. As the acetate, it is more potent than progesterone both as a progestagen and as an ovulation inhibitor. Megestrol has also been used in the palliative treatment of breast cancer and as an appetite enhancer in cachectic subjects." [CHEBI:6722, MESH:D008535]
synonym: "17-Hydroxy-6-methylpregna-4,6-diene-3,20-dione" EXACT []
synonym: "6-Methyl-17-hydroxypregna-4,6-diene-3,20-dione" EXACT []
synonym: "Pregna-4,6-diene-3,20-dione, 17-hydroxy-6-methyl-" EXACT []
xref: CID:19090
xref: PMID:32119089
is_a: XCO:0000435 ! antineoplastic agent
created_by: slaulederkind
creation_date: 2023-12-09T10:34:00Z

[Term]
id: XCO:0001178
name: methimazole
def: "This is any condition in which the main influencing factor is methimazole, a thioureylene antithyroid agent that inhibits the formation of thyroid hormones by interfering with the incorporation of iodine into tyrosyl residues of thyroglobulin through inhibition of the peroxidase enzyme." [MESH:D008713]
synonym: "1-Methyl-2-mercaptoimidazole" EXACT []
synonym: "1-Methylimidazole-2-thiol" EXACT []
synonym: "2-Mercapto-1-methylimidazole" EXACT []
xref: CHEBI:50673
xref: CID:1349907
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-12-09T11:24:32Z

[Term]
id: XCO:0001179
name: iopromide
def: "This is any condition in which the main influencing factor is iopromide, an organoiodine compound and a dicarboxylic acid diamide used as an x-ray contrast agent for angiography. Iopromide is also a nephrotoxic agent." [CID:3736]
synonym: "iopromid" EXACT []
synonym: "N,N'-bis(2,3-dihydroxypropyl)-2,4,6-triiodo-5-[(methoxyacetyl)amino]-N-methylisophthalamide" EXACT []
xref: CHEBI:63578
xref: MESH:C038192
is_a: XCO:0001112 ! nephrotoxic chemical
created_by: slaulederkind
creation_date: 2023-12-11T15:49:02Z

[Term]
id: XCO:0001180
name: OC43p
def: "This is any condition in which the major influencing factor is OC43p, a synthetic peptide whose sequence (VSKIVHFFKTFTTSTALAFA) is derived from the Human coronavirus OC43 gene ORF1ab/ORF1ab polyprotein. This sequence is homologous to the myelin basic protein pronociceptive peptide MBP84-104 from human/rat." [PMID:35466531]
synonym: "human coronavirus OC43&#8208;encoded polypeptide" EXACT []
synonym: "MHV p65-like protein" RELATED []
synonym: "OC43:653-673" EXACT []
synonym: "ORF1ab polyprotein" RELATED []
synonym: "ORF1a polyprotein" RELATED []
synonym: "polyprotein pp1a" RELATED []
synonym: "polyprotein pp1ab" RELATED []
synonym: "VSKIVHFFKTFTTSTALAFA" EXACT []
is_a: XCO:0000260 ! peptide/protein antigen
created_by: slaulederkind
creation_date: 2023-12-11T16:45:35Z

[Term]
id: XCO:0001181
name: OC43p&#8208;SCR
def: "This is any condition in which the major influencing factor is OC43p-SCR, a synthetic peptide whose sequence (VFIAHSVKFTKSFTLATTFA) is a scrambled version of OC43p, a peptide derived from the Human coronavirus OC43 gene ORF1ab/ORF1ab polyprotein. This OC43p&#8208;SCR sequence is used as an experimental control for OC43p." [PMID:35466531]
synonym: "OC43p&#8208;SCR1" EXACT []
synonym: "VFIAHSVKFTKSFTLATTFA" EXACT []
is_a: XCO:0000260 ! peptide/protein antigen
created_by: slaulederkind
creation_date: 2023-12-11T17:22:19Z

[Term]
id: XCO:0001182
name: methyldopa
def: "This is any condition in which the main influencing factor is methyldopa, a centrally acting sympatholytic agent and an antihypertensive agent. It is an analog of DOPA (3,4&#8208;hydroxyphenylanine), and it is a prodrug, meaning that the drug requires biotransformation to an active metabolite for therapeutic effects. Methyldopa is in the alpha-2 adrenergic receptor agonist family of medications. It works by stimulating the brain to decrease the activity of the sympathetic nervous system." [CID:38853, https://en.wikipedia.org/wiki/Methyldopa]
synonym: "&#945;-methyldopa" EXACT []
synonym: "alpha medopa" EXACT []
synonym: "alphamethyldopa" EXACT []
synonym: "alpha-methyl-L-dopa" EXACT []
xref: MESH:D008750
is_a: XCO:0000673 ! alpha-adrenergic agonist
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulederkind
creation_date: 2023-12-12T13:26:35Z

[Term]
id: XCO:0001183
name: metiamide
def: "This is any condition in which the main influencing factor is metiamide, a histamine H2 receptor antagonist developed from another H2 antagonist, burimamide. It was an intermediate compound in the development of the successful anti-ulcer drug cimetidine." [https://en.wikipedia.org/wiki/Metiamide]
synonym: "1-Methyl-3-(2-{[(5-methyl-1H-imidazol-4-yl)methyl]thio}ethyl)thiourea" EXACT []
synonym: "methiamide" EXACT []
synonym: "N-Methyl-N'-(2-{[(5-methyl-1H-imidazol-4-yl)methyl]sulfanyl}ethyl)thiourea" EXACT []
xref: CHEBI:6896
xref: CID:1548992
xref: PMID:32119089
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulederkind
creation_date: 2023-12-12T13:48:07Z

[Term]
id: XCO:0001184
name: mibefradil
def: "This is any condition in which the main influencing factor is mibefradil, a benzimidazoyl-substituted tetralin that selectively binds and inhibits T-type calcium channels. Mibefradil is a vasodilator and antihypertensive agent." [MESH:D020748]
synonym: "[(1S,2S)-2-[2-[3-(1H-benzimidazol-2-yl)propyl-methylamino]ethyl]-6-fluoro-1-propan-2-yl-3,4-dihydro-1H-naphthalen-2-yl] 2-methoxyacetate" EXACT []
synonym: "Acetic acid, methoxy-, 2-(2-((3-(1H-benzimidazol-2-yl)propyl)methylamino)ethyl)-6-fluoro-1,2,3,4-tetrahydro-1-(1-methylethyl)-2-naphthalenyl ester, (1S-cis)-" EXACT []
xref: CHEBI:6920
xref: CID:60663
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000269 ! calcium channel inhibitor
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulederkind
creation_date: 2023-12-12T14:02:56Z

[Term]
id: XCO:0001185
name: MK-0773
def: "This is any condition in which the main influencing factor is MK-0773, an experimental drug that was under development for the treatment of sarcopenia. MK-0773 is a 4-azasteroid and agonist of the androgen receptor (SARM, selective androgen receptor modulator)." [https://en.wikipedia.org/wiki/MK-0773]
synonym: "(1S,3aS,3bS,5aR,9aS,9bS,11aS)-8-fluoro-N-(1H-imidazo[4,5-b]pyridin-2-ylmethyl)-6,9a,11a-trimethyl-7-oxo-2,3,3a,3b,4,5,5a,9b,10,11-decahydro-1H-indeno[5,4-f]quinoline-1-carboxamide" EXACT []
synonym: "PF-05314882" EXACT []
xref: CID:11950726
xref: PMID:32119089
is_a: XCO:0000091 ! steroid
is_a: XCO:0000135 ! receptor agonist
created_by: slaulederkind
creation_date: 2023-12-12T14:42:14Z

[Term]
id: XCO:0001186
name: MK-3207
def: "This is any condition in which the main influencing factor is MK-03207, a highly potent calcitonin gene-related peptide (CGRP) receptor antagonist designed to be an antimigraine therapeutic." [PMID:24900170]
synonym: "2-((8R)-8-(3,5-Difluorophenyl)-10-oxo-6,9-diazaspiro(4.5)dec-9-yl)-N-((2R)-2'-oxo-1,1',2',3-tetrahydrospiro(indene-2,3'-pyrrolo(2,3-b)pyridin)-5-yl)acetamide" EXACT []
synonym: "MK3207" EXACT []
xref: CID:25019940
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulederkind
creation_date: 2023-12-12T14:57:03Z

[Term]
id: XCO:0001187
name: ampicillin
def: "This is any condition in which the main influencing factor is ampicillin, a semi-synthetic derivative of penicillin that functions as an orally active broad-spectrum antibiotic. Ampicillin is a penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-phenylacetamido group." [CID:6249]
synonym: "6beta-[(2R)-2-amino-2-phenylacetamido]-2,2-dimethylpenam-3alpha-carboxylic acid" EXACT []
synonym: "aminobenzylpenicillin" EXACT []
xref: CHEBI:28971
xref: MESH:D000667
is_a: XCO:0001202 ! penicillin
created_by: slaulederkind
creation_date: 2023-12-14T12:00:21Z

[Term]
id: XCO:0001188
name: neomycin sulfate
def: "This is any condition in which the main influencing factor is neomycin sulfate, the sulfate salt form of neomycin, a broad spectrum aminoglycoside antibiotic derived from Streptomyces fradiae with antibacterial activity. Neomycin is an antibiotic complex consisting of 3 components: the two isomeric components B and C are the active components, and neomycin A is the minor component. Neomycin is a protein synthesis inhibitor and bacteriacidal agent." [CID:62403]
xref: CHEBI:31635
xref: PMID:32119089
xref: SID:483925982
relationship: has_component XCO:0001210 ! neomycin
created_by: slaulederkind
creation_date: 2023-12-14T13:05:10Z

[Term]
id: XCO:0001189
name: metronidazole
def: "This is any condition in which the main influencing factor is metronidazole, a commonly used antibiotic, belonging to the nitroimidazole class of antibiotics. Metronidazole is frequently used to treat gastrointestinal infections and parasitic infections such as trichomoniasis, giardiasis, and amebiasis. The antiparasitic of properties of metronidazole set it apart from many other antibacterial drugs, allowing it to treat a wider variety of infections." [CID:4173]
synonym: "2-(2-methyl-5-nitro-1H-imidazol-1-yl)ethanol" EXACT []
xref: CHEBI:6909
xref: MESH:D008795
is_a: XCO:0000482 ! antimicrobial agent
created_by: slaulederkind
creation_date: 2023-12-14T13:22:30Z

[Term]
id: XCO:0001190
name: amphotericin B
def: "This is any condition in which the main influencing factor is amphotericin B, macrolide antifungal and antiprotozoal antibiotic produced by Streptomyces nodosus." [CID:5280965, MESH:D000666]
synonym: "(1R,3S,5R,6R,9R,11R,15S,16R,17R,18S,19E,21E,23E,25E,27E,29E,31E,33R,35S,36R,37S)-33-[(3-amino-3,6-dideoxy-beta-D-mannopyranosyl)oxy]-1,3,5,6,9,11,17,37-octahydroxy-15,16,18-trimethyl-13-oxo-14,39-dioxabicyclo[33.3.1]nonatriaconta-19,21,23,25,27,29,31-heptaene-36-carboxylic acid" EXACT []
synonym: "amphotericin" EXACT []
xref: CHEBI:2682
is_a: XCO:0001489 ! antifungal agent
created_by: slaulederkind
creation_date: 2023-12-14T13:36:38Z

[Term]
id: XCO:0001191
name: nabumetone
def: "This is any condition in which the main influencing factor is nabumetone, a prodrug that is converted to the active metabolite, 6-methoxy-2-naphthylacetic acid. Nabumetone is a methyl ketone non-steroidal anti-inflammatory drug and cyclooxygenase-2 (COX2) inhibitor that is used in the management of pain associated with osteoarthritis and rheumatoid arthritis." [CHEBI:7443, MESH:D000077430]
synonym: "4-(6-Methoxy-2-naphthyl)-2-butanone" EXACT []
synonym: "4-(6-methoxynaphthalen-2-yl)butan-2-one" EXACT []
synonym: "Relafen" EXACT []
xref: CID:4409
xref: PMID:32119089
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000506 ! non-steroidal anti-inflammatory drug
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-12-15T11:08:39Z

[Term]
id: XCO:0001192
name: nadolol
def: "This is any condition in which the main influencing factor is nadolol, a non-selective beta-adrenergic antagonist with a long half-life, used in cardiovascular disease to treat arrhythmias, angina pectoris, and hypertension. Nadolol is also used to treat vascular headaches." [CID:39147, MESH:D009248]
synonym: "rac-(2R,3S)-5-[3-(tert-butylamino)-2-hydroxypropoxy]-1,2,3,4-tetrahydronaphthalene-2,3-diol" EXACT []
xref: CHEBI:7444
is_a: XCO:0000336 ! adrenergic antagonist
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulederkind
creation_date: 2023-12-15T11:34:46Z

[Term]
id: XCO:0001193
name: naproxen
def: "This is any condition in which the main influencing factor is naproxen, a methoxynaphthalene that is 2-methoxynaphthalene substituted by a carboxy ethyl group at position 6. Naproxen is a non-steroidal anti-inflammatory drug commonly used for the reduction of pain, fever, inflammation and stiffness. Naproxen inhibits both the COX-1 and COX-2 enzymes." [CHEBI:7476]
synonym: "(2S)-2-(6-methoxynaphthalen-2-yl)propanoic acid" EXACT []
synonym: "(S)-(+)-2-(6-Methoxy-2-naphthyl)propionic acid" EXACT []
xref: CID:156391
xref: MESH:D009288
is_a: XCO:0000506 ! non-steroidal anti-inflammatory drug
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-12-15T11:49:04Z

[Term]
id: XCO:0001194
name: NB-360
def: "This is any condition in which the main influencing factor is NB-360, a dual BACE1/BACE2 (beta-secretase 1/beta-secretase 2) inhibitor that stops the progression of amyloid-&#946; (A&#946;) deposition and reduces neuroinflammation." [https://www.medchemexpress.com/nb-360.html]
synonym: "NB-360 HCl" RELATED []
xref: CAS:1262857-73-7
xref: CID:66665322
xref: PMID:32119089
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2023-12-15T15:38:28Z

[Term]
id: XCO:0001195
name: nefazodone
def: "This is any condition in which the main influencing factor is nefazodone, an aromatic ether with multiple roles, including that of an antidepressant, a serotonergic antagonist, a serotonin uptake inhibitor, an alpha-adrenergic antagonist and an analgesic." [CID:4449]
synonym: "2-{3-[4-(3-chlorophenyl)piperazin-1-yl]propyl}-5-ethyl-4-(2-phenoxyethyl)-2,4-dihydro-3H-1,2,4-triazol-3-one" EXACT []
xref: CHEBI:7494
xref: MESH:C051752
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0000336 ! adrenergic antagonist
is_a: XCO:0000561 ! antidepressant
created_by: slaulederkind
creation_date: 2023-12-28T13:14:53Z

[Term]
id: XCO:0001196
name: ethers
def: "This is any condition in which the main influencing factor is an ether, any of a class of compounds that contain an ether group, an oxygen atom connected to two alkyl or aryl groups. They have the general formula R&#8722;O&#8722;R&#8242;, where R and R&#8242; represent the alkyl or aryl groups." [https://en.wikipedia.org/wiki/Ether]
xref: CHEBI:25698
xref: MESH:D004987
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2023-12-28T13:36:58Z

[Term]
id: XCO:0001197
name: nevirapine
def: "This is any condition in which the main influencing factor is nevirapine, a non-nucleoside reverse transcriptase inhibitor (NNRTI) used in combination with nucleoside analogues for treatment of Human Immunodeficiency Virus Type 1 (HIV-1) infections and acquired immunodeficiency syndrome (AIDS)." [CID:4463, MESH:D019829]
synonym: "11-Cyclopropyl-4-methyl-5,11-dihydro-6H-dipyrido[3,2-b:2',3'-e][1,4]diazepin-6-one" EXACT []
synonym: "2-cyclopropyl-7-methyl-2,4,9,15-tetraazatricyclo[9.4.0.0^{3,8}]pentadeca-1(11),3,5,7,12,14-hexaen-10-one" EXACT []
xref: CHEBI:63613
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000657 ! antiviral agent
created_by: slaulederkind
creation_date: 2023-12-28T13:52:45Z

[Term]
id: XCO:0001198
name: nitrofurantoin
def: "This is any condition in which the main influencing factor is nitrofurantoin, a urinary anti-bacterial agent effective against most gram-positive and gram-negative organisms. Nitrofurantoin is converted by bacterial nitroreductases to electrophilic intermediates which inhibit the citric acid cycle as well as synthesis of DNA, RNA, and protein." [CID:6604200, MESH:D009582]
synonym: "1-{[(5-nitro-2-furyl)methylene]amino}imidazolidine-2,4-dione" EXACT []
xref: CHEBI:71415
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2023-12-28T14:15:53Z

[Term]
id: XCO:0001199
name: oxandrolone
def: "This is any condition in which the main influencing factor is oxandrolone, a synthetic, anabolic steroid hormone analog of testosterone." [CID:5878]
synonym: "17beta-hydroxy-17alpha-methyl-2-oxa-5alpha-androstan-3-one" EXACT []
synonym: "DODECAHYDRO-3-HYDROXY-6-(HYDROXY-METHYL)-3,3A,6-TRIMETH YL-1H-BENZ" EXACT []
xref: CHEBI:7820
xref: MESH:D010074
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0000229 ! steroid hormone
created_by: slaulederkind
creation_date: 2023-12-29T11:30:06Z

[Term]
id: XCO:0001200
name: panadiplon
def: "This is any condition in which the main influencing factor is panadiplon (U-78875), an anxiolytic drug with a novel chemical structure. Panadiplon has a similar pharmacological profile to the benzodiazepine family of drugs, but with mainly anxiolytic properties and relatively little sedative or amnestic effect, and so is classified as a nonbenzodiazepine anxiolytic." [https://en.wikipedia.org/wiki/Panadiplon]
synonym: "U-78875" EXACT []
xref: CAS:124423-84-3
xref: CID:3033821
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0001122 ! antianxiety agent
created_by: slaulederkind
creation_date: 2023-12-29T12:44:41Z

[Term]
id: XCO:0001201
name: paroxetine
def: "This is any condition in which the main influencing factor is paroxetine, a serotonin uptake inhibitor that is effective in the treatment of depression and anxiety." [CHEBI:7936]
synonym: "(3S,4R)-3-[(1,3-benzodioxol-5-yloxy)methyl]-4-(4-fluorophenyl)piperidine" EXACT []
synonym: "Piperidine, 3-((1,3-benzodioxol-5-yloxy)methyl)-4-(4-fluorophenyl)-, (3S,4R)-" EXACT []
xref: CID:43815
xref: MESH:D017374
is_a: XCO:0000561 ! antidepressant
is_a: XCO:0001122 ! antianxiety agent
created_by: slaulederkind
creation_date: 2023-12-29T13:24:50Z

[Term]
id: XCO:0001202
name: penicillin
def: "This is any condition in which the main influencing factor is a penicillin, one of a group of β-lactam antibiotics originally obtained from Penicillium molds. Penicillins are widely used for different bacterial infections, though many types of bacteria have developed resistance following extensive use." [https://en.wikipedia.org/wiki/Penicillin]
synonym: "P" EXACT []
synonym: "PCN" EXACT []
synonym: "PEN" EXACT []
synonym: "penicillin G" NARROW []
synonym: "penicillins" EXACT []
synonym: "penicillin V" NARROW []
xref: CHEBI:17334
xref: MESH:D010406
xref: PMID:32119089
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2023-12-29T13:38:29Z

[Term]
id: XCO:0001203
name: phenobarbital
def: "This is any condition in which the main influencing factor is phenobarbital, a barbiturate that acts as a nonselective central nervous system depressant. Phenobarbital potentiates GABA action on GABA-A receptors, modulates chloride currents through receptor channels, and inhibits glutamate induced depolarizations." [MESH:D010634]
synonym: "Luminal" EXACT []
synonym: "phenobarb" EXACT []
synonym: "phenobarbitone" EXACT []
xref: CID:4763
xref: MESH:D010634
is_a: XCO:0000950 ! anticonvulsant
is_a: XCO:0001122 ! antianxiety agent
created_by: slaulederkind
creation_date: 2023-12-29T17:24:51Z

[Term]
id: XCO:0001204
name: pentoxifylline
def: "This is any condition in which the main influencing factor is pentoxifylline, a synthetic dimethylxanthine derivative that inhibits phosphodiesterase and affects blood rheology. It improves blood flow by increasing erythrocyte and leukocyte flexibility. Pentoxifylline has both anti-oxidant and anti-inflammatory properties." [CID:4740, MESH:D010431]
synonym: "3,7-Dihydro-3,7-dimethyl-1-(5-oxohexyl)-1H-purine-2,6-dione" EXACT []
synonym: "3,7-dimethyl-1-(5-oxohexyl)purine-2,6-dione" EXACT []
synonym: "PTX" EXACT []
xref: CHEBI:7986
xref: PMID:32119089
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2024-01-02T14:30:47Z

[Term]
id: XCO:0001205
name: perhexiline maleate
def: "This is any condition in which the main influencing factor is perhexiline maleate, a coronary vasodilator used as a prophylactic antianginal agent. Perhexiline inhibits mitochondrial carnitine palmitoyltransferase-1 and -2." [MESH:D010480, PMID:37110858]
synonym: "2-(2,2-dicyclohexylethyl)piperidine" EXACT []
synonym: "perhexiline" EXACT []
synonym: "Piperidine, 2-(2,2-dicyclohexylethyl)-" EXACT []
xref: CID:5284439
xref: PMID:32119089
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2024-01-02T14:59:49Z

[Term]
id: XCO:0001206
name: probenecid
def: "This is any condition in which the main influencing factor is probenecid, the prototypical uricosuric agent, a drug that promotes the excretion of uric acid. Probenecid inhibits the renal excretion of organic anions and reduces tubular reabsorption of urate. Because probenecid reduces the renal tubular excretion of other drugs, it has been used as an adjunct to antibacterial therapy." [https://www.sciencedirect.com/topics/neuroscience/uricosuric, MESH:D011339]
synonym: "4-(Dipropylsulfamoyl)benzoic acid" EXACT []
synonym: "p-(Dipropylsulfamoyl)benzoic acid" EXACT []
synonym: "probenecid acid" EXACT []
xref: CHEBI:8426
xref: CID:4911
is_a: XCO:0000120 ! inhibitor
created_by: slaulederkind
creation_date: 2024-01-02T15:14:50Z

[Term]
id: XCO:0001207
name: propranolol
def: "This is any condition in which the main influencing factor is propranolol, a widely used non-cardioselective beta-adrenergic antagonist. Propranolol functions as an anxiolytic drug, an anti-arrhythmia drug, a vasodilator agent, and an antihypertensive agent." [CID:4946, MESH:D011433]
synonym: "1-(isopropylamino)-3-(1-naphthyloxy)propan-2-ol" EXACT []
synonym: "2-Propanol, 1-((1-methylethyl)amino)-3-(1-naphthalenyloxy)-" EXACT []
synonym: "3-(naphthalen-1-yloxy)-1-(propan-2-ylamino)propan-2-ol" EXACT []
synonym: "beta-Propranolol" EXACT []
xref: CHEBI:8499
xref: PMID:32119089
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000336 ! adrenergic antagonist
is_a: XCO:0000863 ! antihypertensive agent
is_a: XCO:0001122 ! antianxiety agent
created_by: slaulederkind
creation_date: 2024-01-02T16:01:49Z

[Term]
id: XCO:0001208
name: MWNT-7
def: "This is any condition in which the main influencing factor is MWNT-7, a multi&#8208;walled carbon nanotube, which is a molecule consisting of three or more concentric graphene cylinders. Fibers of MWNT-7 range in size from 5.11 &#956;m to 84.7 nm." [CHEBI:50596, PMID:37513116]
synonym: "Mitsui-7" EXACT []
synonym: "MWCNT-7" EXACT []
synonym: "NT50a" EXACT []
synonym: "XNRI-7" EXACT []
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2024-01-04T12:18:08Z

[Term]
id: XCO:0001209
name: lixisenatide
def: "This is any condition in which the main influencing factor is lixisenatide, a 44 amino acid polypeptide and glucagon-like peptide 1 receptor agonist used as an adjunct to diet and exercise for the treatment of adults with type II diabetes." [CHEBI:85662, https://en.wikipedia.org/wiki/Lixisenatide]
synonym: "H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2" EXACT []
xref: CID:90472060
xref: PMID:37423944
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0000193 ! peptide/protein
is_a: XCO:0000407 ! hypoglycemic agent
created_by: slaulederkind
creation_date: 2024-01-04T13:20:30Z

[Term]
id: XCO:0001210
name: neomycin
def: "This is any condition in which the main influencing factor is neomycin, a broad spectrum aminoglycoside antibiotic derived from Streptomyces fradiae with antibacterial activity. Neomycin is an antibiotic complex consisting of 3 components: the two isomeric components B and C are the active components, and neomycin A is a minor component and a degradation product of B and C. Neomycin is a protein synthesis inhibitor and bacteriacidal agent, primarily effective against gram-negative bacteria." [https://pubchem.ncbi.nlm.nih.gov/#query=neomycin, https://www.ncbi.nlm.nih.gov/books/NBK560603]
xref: CHEBI:7507
xref: MESH:D009355
xref: PMID:33790226
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2024-01-05T11:08:45Z

[Term]
id: XCO:0001211
name: Parabacteroides distasonis
def: "This is any condition in which the main influencing factor is Parabacteroides distasonis, an anaerobic, gram-negative bacillus of the CFB group of bacteria. P. distasonis is an aerotolerant anaerobe found in the gastrointestinal tract of numerous species." [NCBI:txid823, PMID:33790226]
synonym: "Bacteroides distasonis" EXACT []
xref: MESH:C000641579
is_a: XCO:0001212 ! bacteria
created_by: slaulederkind
creation_date: 2024-01-05T12:24:25Z

[Term]
id: XCO:0001212
name: bacteria
def: "This is any condition in which the main influencing factor is bacteria, any of a domain of chiefly round, spiral, or rod-shaped single-celled prokaryotic microorganisms that are represented in most ecological niches on earth." [https://www.merriam-webster.com/]
xref: NCBI:txid2
is_a: XCO:0000761 ! biologics and probiotics
created_by: slaulederkind
creation_date: 2024-01-05T13:06:43Z

[Term]
id: XCO:0001213
name: Parabacteroides johnsonii
def: "This is any condition in which the main influencing factor is Parabacteroides johnsonii, an anaerobic, gram-negative bacillus of the CFB group of bacteria. P. johnsonii is an anaerobe isolated from human fecal matter." [https://en.wikipedia.org/wiki/Parabacteroides_johnsonii, PMID:17267966]
synonym: "M-165T" EXACT []
synonym: "Parabacteroides johnsonii M-165" EXACT []
xref: NCBI:txid387661
xref: PMID:33790226
is_a: XCO:0001212 ! bacteria
created_by: slaulederkind
creation_date: 2024-01-05T14:08:16Z

[Term]
id: XCO:0001214
name: reverse osmosis-filtered water
def: "This is any condition in which the main influencing factor is reverse osmosis-filtered water, purified water that has sediment and chlorine removed from it with a prefilter before solutes are removed by a semipermeable membrane. Reverse osmosis-filtered water also passes through a postfilter after the semi-permeable membrane." [https://www.freshwatersystems.com/blogs/blog/what-is-reverse-osmosis#1]
synonym: "RO-filtered H2O" EXACT []
synonym: "RO-filtered water" EXACT []
xref: PMID:33790226
is_a: XCO:0000021 ! water
created_by: slaulederkind
creation_date: 2024-01-05T14:27:10Z

[Term]
id: XCO:0001215
name: controlled fructose content reverse osmosis-filtered drinking water
def: "This is any condition in which the main influencing factor is a drink made up of reverse osmosis-filtered water and a specified amount of fructose consumed by an organism as part of an experiment. Fructose is one of three dietary monosaccharides, along with glucose and galactose, that are absorbed directly into the bloodstream during digestion." [https://www.freshwatersystems.com/blogs/blog/what-is-reverse-osmosis#1, https://www.merriam-webster.com/]
synonym: "controlled fructose content RO-filtered drinking water" EXACT []
xref: PMID:33790226
is_a: XCO:0000429 ! controlled fructose content drinking water
created_by: slaulederkind
creation_date: 2024-01-05T16:06:22Z

[Term]
id: XCO:0001216
name: controlled glucose content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of glucose consumed by a subject. Glucose is a monosaccharide sugar, C6H12O6, occurring widely in plant and animal tissues. Glucose is one of the three dietary monosaccharides, along with fructose and galactose, that are absorbed directly into the bloodstream during digestion" [https://www.merriam-webster.com/]
synonym: "controlled dextrose content drinking water" EXACT []
xref: PMID:33790226
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0000275 ! glucose
created_by: slaulederkind
creation_date: 2024-01-05T16:23:57Z

[Term]
id: XCO:0001217
name: controlled glucose content reverse osmosis-filtered drinking water
def: "This is any condition in which the main influencing factor is a drink made up of reverse osmosis-filtered water and a specified amount of glucose consumed by an organism as part of an experiment. Glucose is one of three dietary monosaccharides, along with fructose and galactose, that are absorbed directly into the bloodstream during digestion." [https://www.merriam-webster.com/]
synonym: "controlled dextrose content reverse osmosis-filtered drinking water" EXACT []
synonym: "controlled glucose content RO-filtered drinking water" EXACT []
xref: PMID:33790226
is_a: XCO:0001216 ! controlled glucose content drinking water
created_by: slaulederkind
creation_date: 2024-01-05T16:40:50Z

[Term]
id: XCO:0001218
name: controlled ampicillin content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of ampicillin, a semi-synthetic derivative of penicillin that functions as an orally active broad-spectrum antibiotic. Ampicillin is a penicillin in which the substituent at position 6 of the penam ring is a 2-amino-2-phenylacetamido group." [CID:6249, https://www.merriam-webster.com/]
synonym: "controlled aminobenzylpenicillin content drinking water" EXACT []
xref: CHEBI:28971
xref: MESH:D000667
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001187 ! ampicillin
created_by: slaulederkind
creation_date: 2024-01-05T16:56:23Z

[Term]
id: XCO:0001219
name: medium-chain triglyceride-containing ketogenic diet
def: "This is any condition in which the main influencing factor is a medium-chain triglyceride-containing ketogenic diet (MCTKD), a solid diet with a specific ratio of fat weight to carbohydrate plus protein weight. MCTKDs with different ketogenic ratios are designated by KR values. Medium chain triglycerides are absorbed and transported more efficiently than other types of fat in the diet and yield more ketones produced in the liver per unit of dietary energy." [PMID:36386439]
synonym: "KD" BROAD []
synonym: "ketogenic diet" BROAD []
synonym: "MCT-KD" EXACT []
synonym: "MCTKD" EXACT []
is_a: XCO:0000014 ! controlled content diet
created_by: slaulederkind
creation_date: 2024-01-08T14:26:56Z

[Term]
id: XCO:0001220
name: medium-chain triglyceride-containing ketogenic diet, KR 2.0
def: "This is any condition in which the main influencing factor is a medium-chain triglyceride-containing ketogenic diet (MCTKD), KR 2.0, a solid diet with a specific ratio of fat weight to carbohydrate plus protein weight of approximately 2.0. A diet with a higher KR ratio delivers more fat than a diet with a lower KR." [PMID:36386439]
synonym: "MCT-KD, KR 2.0" EXACT []
synonym: "MCTKD, KR 2.0" EXACT []
synonym: "medium-chain triglyceride-containing ketogenic diet, ketogenic ratio 2.0" EXACT []
is_a: XCO:0001219 ! medium-chain triglyceride-containing ketogenic diet
created_by: slaulederkind
creation_date: 2024-01-08T14:47:02Z

[Term]
id: XCO:0001221
name: medium-chain triglyceride-containing ketogenic diet, KR 1.4
def: "This is any condition in which the main influencing factor is a medium-chain triglyceride-containing ketogenic diet (MCTKD), KR 1.4, a solid diet with a specific ratio of fat weight to carbohydrate plus protein weight of approximately 1.4. A diet with a higher KR ratio delivers more fat than a diet with a lower KR." [PMID:36386439]
synonym: "MCT-KD, KR 1.4" EXACT []
synonym: "MCTKD, KR 1.4" EXACT []
synonym: "medium-chain triglyceride-containing ketogenic diet, ketogenic ratio 1.4" EXACT []
is_a: XCO:0001219 ! medium-chain triglyceride-containing ketogenic diet
created_by: slaulederkind
creation_date: 2024-01-08T14:54:32Z

[Term]
id: XCO:0001222
name: ritonavir
def: "This is any condition in which the main influencing factor is ritonavir, a CYP3A inhibitor and antiretroviral drug from the protease inhibitor class used to treat HIV infection and AIDS. Ritonavir is often used as a fixed-dose combination with another protease inhibitor, lopinavir. Ritonavir is also used in combination with dasabuvir sodium hydrate, ombitasvir and paritaprevir for treatment of chronic hepatitis C virus genotype 1 infection and cirrhosis of the liver." [CHEBI:45409]
synonym: "N-[(2S,4S,5S)-4-hydroxy-1,6-diphenyl-5-{[(1,3-thiazol-5-ylmethoxy)carbonyl]amino}hexan-2-yl]-N(2)-(methyl{[2-(propan-2-yl)-1,3-thiazol-4-yl]methyl}carbamoyl)-L-valinamide" EXACT []
xref: CID:392622
xref: MESH:D019438
is_a: XCO:0000657 ! antiviral agent
is_a: XCO:0000748 ! protease inhibitor
created_by: slaulederkind
creation_date: 2024-01-08T15:19:08Z

[Term]
id: XCO:0001223
name: sitaxentan
def: "This is any condition in which the main influencing factor is sitaxentan, a drug designed for the treatment of pulmonary arterial hypertension (PAH). The use of sitaxentan was discontinued because of the side effect of hepatotoxicity." [CID:216235]
xref: CHEBI:135736
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2024-01-08T15:28:14Z

[Term]
id: XCO:0001224
name: sudoxicam
def: "This is any condition in which the main influencing factor is sudoxicam, a benzothiazine derivative and non-steroidal anti-inflammatory drug. Sudoxicam also has anti-edema and antipyretic activity." [https://www.medchemexpress.com/sudoxicam.html, https://www.scbt.com/p/sudoxicam-34042-85-8]
xref: CID:54682951
xref: MESH:C100301
is_a: XCO:0000506 ! non-steroidal anti-inflammatory drug
created_by: slaulederkind
creation_date: 2024-01-09T14:26:00Z

[Term]
id: XCO:0001225
name: sumatriptan
def: "This is any condition in which the main influencing factor is sumatriptan, a serotonin agonist that acts selectively at 5HT1 receptors. It i s used for the acute treatment of migraine with or without aura in adults." [CHEBI:10650, CID:5358]
synonym: "1-{3-[2-(dimethylamino)ethyl]-1H-indol-5-yl}-N-methylmethanesulfonamide" EXACT []
synonym: "Imitrex" EXACT []
xref: MESH:D018170
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0000141 ! vasoconstrictor
created_by: slaulederkind
creation_date: 2024-01-09T14:36:52Z

[Term]
id: XCO:0001226
name: tacrine
def: "This is any condition in which the main influencing factor is tacrine, a centerally active cholinesterase inhibitor that crosses the blood-brain barrier. Tacrine has been used to counter the effects of muscle relaxants, as a respiratory stimulant, and in the treatment of Alzheimer's disease and other central nervous system disorders. Tacrine is also a histamine N-methyltransferase inhibitor." [MESH:D013619]
xref: CHEBI:45980
xref: CID:1935
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2024-01-09T14:46:59Z

[Term]
id: XCO:0001227
name: teriparatide
def: "This is any condition in which the main influencing factor is teriparatide, a recombinant human parathyroid hormone analogue that is used to treat osteoporosis in women or men with a high risk for bone fracture. Teriparatide is made up of the first amino(N)-terminal 34 amino acids of human PTH (parathyroid hormone) and is an osteoanabolic agent." [SID:483927060]
synonym: "human PTH (1-34)" EXACT []
synonym: "PTH (1-34)" EXACT []
synonym: "TPTD" EXACT []
xref: CHEBI:135983
xref: GEO:GSE121109
is_a: XCO:0000228 ! peptide hormone
created_by: slaulederkind
creation_date: 2024-01-09T15:24:19Z

[Term]
id: XCO:0001228
name: electrical muscle stimulation
def: "This is any condition in which the main influencing factor is electrical muscle stimulation (EMS), a transcutaneous method of stimulating skeletal muscle. EMS is designed to facilitate passive activation of a large number of motor units and induce synchronous recruitment of muscle fibers, with the aim of strengthening or maintaining muscle mass." [PMID:36705372]
synonym: "EMS" EXACT []
xref: PMID:30933441
is_a: XCO:0000000 ! experimental condition
created_by: slaulederkind
creation_date: 2024-01-11T14:53:45Z

[Term]
id: XCO:0001229
name: Baihu-Guizhi decoction
def: "This is any condition in which the main influencing factor is Baihu-Guizhi decoction, an anti-arthritic drug of traditional Chinese medicine (TCM). Baihu-Guizhi decoction (BHGZD) is extensively used for the treatment of rheumatoid arthritis (RA)." [PMID:34675809]
synonym: "BHGZD" EXACT []
xref: PMID:35799788
xref: PMID:36195951
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2024-01-11T15:21:04Z

[Term]
id: XCO:0001230
name: Imwitor 742
def: "This is any condition in which the main influencing factor is Imwitor 742, a blend of mono-, di- and triglycerides, mainly of caprylic and capric acid. Imwitor 742 acts as a solubilizer for poorly soluble drugs in oral administration forms (i.e. capsules), as a penetration enhancer in topical drug forms, and as a co-emulsifier in emulsions." [https://marcordev.com/wp-content/uploads/2020/07/IMWITOR_742_TDSH-1.pdf]
synonym: "Glycerol Monocaprylocaprate, type I" EXACT []
synonym: "Glyceryl Mono- and Dicaprylocaprate" EXACT []
xref: PMID:32119089
is_a: XCO:0001231 ! solvent
is_a: XCO:0001232 ! emulsifier
created_by: slaulederkind
creation_date: 2024-01-11T16:07:16Z

[Term]
id: XCO:0001231
name: solvent
def: "This is any condition in which the main influencing factor is a solvent, a liquid that can dissolve other substances (solutes) without any change in their chemical composition." [CHEBI:46787, https://www.merriam-webster.com/]
synonym: "solvents" NARROW []
xref: MESH:D012997
is_a: XCO:0000341 ! chemical with specified function
created_by: slaulederkind
creation_date: 2024-01-11T16:13:49Z

[Term]
id: XCO:0001232
name: emulsifier
def: "This is any condition in which the main influencing factor is an emulsifier, a surface-active agent (such as a soap) promoting the formation and stabilization of an emulsion (a fine dispersion of minute droplets of one liquid in another in which it is not soluble)." [https://languages.oup.com/google-dictionary-en/, https://www.merriam-webster.com/]
xref: CHEBI:63046
xref: PMID:32119089
is_a: XCO:0000341 ! chemical with specified function
created_by: slaulederkind
creation_date: 2024-01-11T16:29:53Z

[Term]
id: XCO:0001233
name: telcagepant
def: "This is any condition in which the main influencing factor is telcagepant, a calcitonin gene-related peptide (CGRP) receptor antagonist which was an investigational drug for the acute treatment and prevention of migraine. Development of telcagepant was discontinued due to hepatic side effects." [https://en.wikipedia.org/wiki/Telcagepant]
synonym: "MK-0974" EXACT []
synonym: "MK0974" EXACT []
synonym: "N-[(3R,6S)-6-(2,3-Difluorophenyl)hexahydro-2-oxo-1-(2,2,2-trifluoroethyl)-1H-azepin-3-yl]-4-(2,3-dihydro-2-oxo-1H-imidazo[4,5-b]pyridin-1-yl)-1-piperidinecarboxamide" EXACT []
xref: CID:11319053
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulederkind
creation_date: 2024-01-12T11:09:21Z

[Term]
id: XCO:0001234
name: telithromycin
def: "This is any condition in which the main influencing factor is telithromycin, a semi-synthetic erythromycin derivative which belongs to a new chemical class of antibiotics called ketolides. Similar to the macrolide antibiotics, telithromycin prevents bacterial growth by interfering with bacterial protein synthesis." [CID:3002190]
synonym: "Ketek" EXACT []
xref: CHEBI:29688
xref: MESH:C106791
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000532 ! protein synthesis inhibitor
created_by: slaulederkind
creation_date: 2024-01-12T11:21:08Z

[Term]
id: XCO:0001235
name: tetracycline
def: "This is any condition in which the main influencing factor is tetracycline, a broad-spectrum polyketide antibiotic produced by the Streptomyces genus of actinobacteria. Tetracycline is both an antibacterial and antiprotozoal drug." [CID:54675776]
synonym: "(4S,4aS,5aS,6S,12aS)-4-(dimethylamino)-3,6,10,12,12a-pentahydroxy-6-methyl-1,11-dioxo-1,4,4a,5,5a,6,11,12a-octahydrotetracene-2-carboxamide" EXACT []
xref: CHEBI:27902
xref: MESH:D013752
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000532 ! protein synthesis inhibitor
is_a: XCO:0000672 ! tetracyclines
created_by: slaulederkind
creation_date: 2024-01-12T12:11:59Z

[Term]
id: XCO:0001236
name: Morinda officinalis polysaccharide
def: "This is any condition whose main influencing factor is Morinda officinalis polysaccharide, a crude polysaccharide extract from the root of Morinda officinalis, a plant used in traditional Chinese medicine." [PMID:31465803]
synonym: "M. officinalis polysaccharide" EXACT []
synonym: "MOP" EXACT []
synonym: "MOP-100" NARROW []
synonym: "MOP-60" NARROW []
synonym: "Morinda officinalis polysaccharides" EXACT []
xref: PMID:34466146
is_a: XCO:0000173 ! polysaccharide
created_by: slaulederkind
creation_date: 2024-01-12T13:30:17Z

[Term]
id: XCO:0001237
name: experimental varicocele
def: "This is any condition whose main influencing factor is an experimental varicocele generated by partial ligation of the left renal vein. A varicocele is an abnormal dilation of the pampiniform plexus (veins) of the spermatic cord.." [ISBN-13:978-1455756438, PMID:34466146]
xref: PMID:28138407
is_a: XCO:0000595 ! surgical manipulation of blood vessels
created_by: slaulederkind
creation_date: 2024-01-12T13:50:18Z

[Term]
id: XCO:0001238
name: ticlopidine
def: "This is any condition in which the main influencing factor is ticlopidine, an inhibitor of platelet aggregation. It is a prodrug that is metabolised to an active form, which blocks the ADP receptor that is involved in GPIIb/IIIa receptor activation leading to platelet aggregation." [CID:5472]
synonym: "5-(2-chlorobenzyl)-4,5,6,7-tetrahydrothieno[3,2-c]pyridine" EXACT []
xref: CHEBI:9588
xref: MESH:D013988
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0001090 ! anticoagulant
created_by: slaulederkind
creation_date: 2024-01-12T18:37:58Z

[Term]
id: XCO:0001239
name: gefitinib
def: "This is any condition in which the main influencing factor is gefitinib, an EGFR (epidermal growth factor receptor) tyrosine kinase inhibitor used for the treatment of non-small cell lung cancer." [CHEBI:49668]
synonym: "N-(3-chloro-4-fluorophenyl)-7-methoxy-6-(3-morpholin-4-ylpropoxy)quinazolin-4-amine" EXACT []
synonym: "ZD1839" EXACT []
xref: CID:123631
xref: MESH:D000077156
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulederkind
creation_date: 2024-01-15T13:18:12Z

[Term]
id: XCO:0001240
name: afatinib
def: "This is any condition in which the main influencing factor is afatinib, an inhibitor of epidermal growth factor receptor (EGFR, ERBB2, ERBB3, ERBB4) tyrosine kinases used for the treatment of metastatic non-small cell lung cancer." [MESH:D000077716]
synonym: "(2E)-N-{4-[(3-chloro-4-fluorophenyl)amino]-7-[(3S)-tetrahydrofuran-3-yloxy]quinazolin-6-yl}-4-(dimethylamino)but-2-enamide" EXACT []
xref: CHEBI:61390
xref: CID:10184653
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulederkind
creation_date: 2024-01-15T13:43:35Z

[Term]
id: XCO:0001241
name: tienilic acid
def: "This is any condition in which the main influencing factor is tienilic acid, a loop diuretic with uricosuric action. Tienilic acid was marketed for the treatment of hypertension until being withdrawn in 1982 because of reports of hepatotoxicity." [CID:38409]
synonym: "[2,3-dichloro-4-(2-thienylcarbonyl)phenoxy]acetic acid" EXACT []
synonym: "ticrynafen" EXACT []
xref: CHEBI:9590
xref: MESH:D013989
is_a: XCO:0000122 ! diuretic
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulederkind
creation_date: 2024-01-15T15:48:27Z

[Term]
id: XCO:0001242
name: tolcapone
def: "This is any condition in which the main influencing factor is tolcapone, a catechol O-methyltransferase (COMT) inhibitor used in the treatment of Parkinson disease." [MESH:D000077867]
synonym: "(3,4-dihydroxy-5-nitrophenyl)(4-methylphenyl)methanone" EXACT []
xref: CHEBI:63630
xref: CID:4659569
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2024-01-15T16:12:42Z

[Term]
id: XCO:0001243
name: wind
def: "This is any condition in which the major influencing factor is wind, the movement of air of any velocity, especially an experimentally controlled velocity. The air may be ambient or otherwise controlled." [https://www.merriam-webster.com/]
xref: PMID:35799788
relationship: has_component XCO:0000918 ! ambient air
created_by: slaulederkind
creation_date: 2024-01-16T13:30:43Z

[Term]
id: XCO:0001244
name: ambient environment
def: "This is any condition in which the major influencing factor is the ambient environment, an encompassing atmosphere which includes temperature, light, sound, and air content as parameters." [https://www.merriam-webster.com/]
synonym: "atmosphere" EXACT []
is_a: XCO:0000000 ! experimental condition
created_by: slaulederkind
creation_date: 2024-01-16T13:50:10Z

[Term]
id: XCO:0001245
name: antiemetic
def: "This is any condition in which the main influencing factor is an antiemetic, a drug used to prevent nausea or vomiting. An antiemetic may affect the medullary control centers (the vomiting center and the chemoreceptive trigger zone) or peripheral receptors." [CHEBI:50919]
xref: https://www.merriam-webster.com/dictionary/antiemetic
xref: MESH:D000932
is_a: XCO:0000341 ! chemical with specified function
is_a: XCO:0000850 ! therapeutic agent
created_by: slaulederkind
creation_date: 2024-01-16T14:27:16Z

[Term]
id: XCO:0001246
name: trimethobenzamide
def: "This is any condition in which the main influencing factor is trimethobenzamide, a drug used to prevent nausea and vomiting in humans." [CHEBI:27796]
synonym: "N-{4-[2-(dimethylamino)ethoxy]benzyl}-3,4,5-trimethoxybenzamide" EXACT []
xref: CID:5577
xref: MESH:C100146
is_a: XCO:0001245 ! antiemetic
created_by: slaulederkind
creation_date: 2024-01-16T14:35:01Z

[Term]
id: XCO:0001247
name: sterile water
def: "This is any condition in which the main influencing factor is sterile water, which is high quality water used for medical irrigation, injection, or inhalation and has been prepared to eliminate microbial contamination. Sterile water may be used as a pharmaceutical solvent." [https://www.merriam-webster.com/, https://www.rxlist.com/sterile-water-drug.htm]
synonym: "sterile H2O" EXACT []
is_a: XCO:0000021 ! water
created_by: slaulederkind
creation_date: 2024-01-16T14:59:01Z

[Term]
id: XCO:0001248
name: poloxamers
def: "This is any condition in which the main influencing factor is poloxamers, nonionic triblock copolymers composed of a central hydrophobic chain of polyoxypropylene (poly(propylene oxide)) flanked by two hydrophilic chains of polyoxyethylene (poly(ethylene oxide)). The length of the copolymer chains can be varied to alter the properties of the whole molecule." [https://en.wikipedia.org/wiki/Poloxamer]
synonym: "Kolliphors" EXACT []
synonym: "Pluronics" EXACT []
synonym: "Synperonics" EXACT []
xref: MESH:D020442
xref: PMID:32119089
is_a: XCO:0000757 ! surfactant
is_a: XCO:0001232 ! emulsifier
created_by: slaulederkind
creation_date: 2024-01-16T15:27:53Z

[Term]
id: XCO:0001249
name: Poloxamer 407
def: "This is any condition in which the main influencing factor is Poloxamer 407 (P407), a nonionic triblock copolymer with a polyoxypropylene molecular mass of 4000 g/mol and a 70% polyoxyethylene content. P407 is used as an emulsifying agent and solubilizing agent in cosmetic and personal products." [CID:24751, https://en.wikipedia.org/wiki/Poloxamer]
synonym: "P407" EXACT []
is_a: XCO:0001248 ! poloxamers
created_by: slaulederkind
creation_date: 2024-01-16T16:33:41Z

[Term]
id: XCO:0001250
name: Poria cocos
def: "This is any condition in which the main influencing factor is Poria cocos, a fungus used extensively as a medicinal mushroom in traditional Chinese medicine." [https://en.wikipedia.org/wiki/Wolfiporia_extensa]
synonym: "China root" EXACT []
synonym: "fu ling" EXACT []
synonym: "hoelen" EXACT []
synonym: "Macrohyporia cocos" EXACT []
synonym: "Macrohyporia extensa" EXACT []
synonym: "matsuhodo" EXACT []
synonym: "PC" EXACT []
synonym: "poria" EXACT []
synonym: "tuckahoe" EXACT []
synonym: "Wolfiporia cocos" EXACT []
synonym: "Wolfiporia extensa" EXACT []
is_a: XCO:0001623 ! Traditional Chinese Medicine
relationship: has_component XCO:0000173 ! polysaccharide
created_by: slaulederkind
creation_date: 2024-01-18T13:48:59Z

[Term]
id: XCO:0001251
name: Alismatis rhizoma
def: "This is any condition in which the main influencing factor is Alismatis rhizoma, the rhizomes of A. orientale (Alisma orientale, a flowering plant species found in Asia) which have been used as a traditional Chinese medicine and as a kampo Japanese medicine. Terpenoids have been identified as characteristic constituents of Alisma orientale." [https://en.wikipedia.org/wiki/Alisma_orientale]
synonym: "Alisma orientale (Sam.) Juzep rhizomes" EXACT []
synonym: "AR" EXACT []
synonym: "Asian water plantain" EXACT []
xref: CHEBI:26873
xref: PMID:27080939
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2024-01-18T14:09:22Z

[Term]
id: XCO:0001252
name: PC-AR
def: "This is any condition in which the main influencing factor is PC-AR, an extract derived from a 60%-40% mix (by weight) of Poria cocos and Alismatis rhizoma." [PMID:37840052]
synonym: "aqueous extract of Poria cocos-Alismatis rhizoma" EXACT []
synonym: "Poria cocos-Alismatis rhizoma" EXACT []
relationship: has_component XCO:0001250 ! Poria cocos
relationship: has_component XCO:0001251 ! Alismatis rhizoma
created_by: slaulederkind
creation_date: 2024-01-18T15:11:22Z

[Term]
id: XCO:0001253
name: Huatan Jiangzhuo decoction
def: "This is any condition in which the main influencing factor is Huatan Jiangzhuo decoction, a combination of six traditional Chinese medicines that is used for lipid metabolism-related disorders." [PMID:33641781]
synonym: "HJD" EXACT []
synonym: "HTJZD" EXACT []
xref: PMID:33936248
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2024-01-18T15:29:08Z

[Term]
id: XCO:0001254
name: troglitazone
def: "This is any condition in which the main influencing factor is troglitazone, a hypoglycemic agent that was taken off the market due to hepatotoxicity issues. Troglitazone is also an antioxidant, a vasodilator agent, an anticonvulsant, an anticoagulant, an antineoplastic agent, and a long-chain-fatty-acid--CoA ligase inhibitor." []
synonym: "5-{4-[(6-hydroxy-2,5,7,8-tetramethyl-3,4-dihydro-2H-chromen-2-yl)methoxy]benzyl}-1,3-thiazolidine-2,4-dione" EXACT []
xref: CHEBI:9753
xref: MESH:D000077288
xref: PMID:32119089
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000407 ! hypoglycemic agent
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000950 ! anticonvulsant
is_a: XCO:0001090 ! anticoagulant
created_by: slaulederkind
creation_date: 2024-01-19T10:41:51Z

[Term]
id: XCO:0001255
name: indomethacin
def: "This is any condition in which the main influencing factor is indomethacin, a non-steroidal anti-inflammatory drug (NSAID) used to treat mild to moderate acute pain and relieve symptoms of arthritis (osteoarthritis and rheumatoid arthritis) or gout. Indomethacin also inhibits the motility of polymorphonuclear leukocytes." [https://www.mayoclinic.org/drugs-supplements/indomethacin-oral-route/description/drg-20069700, MESH:D007213]
synonym: "[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]acetic acid" EXACT []
synonym: "indometacin" EXACT []
xref: CHEBI:49662
xref: CID:3715
is_a: XCO:0000506 ! non-steroidal anti-inflammatory drug
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2024-01-19T10:58:34Z

[Term]
id: XCO:0001256
name: total parenteral nutrition
def: "This is any condition in which the main influencing factor is total parenteral nutrition (TPN), a method of feeding that bypasses the gastrointestinal tract by using an intravenous route. Total parenteral nutrition exists when no significant nutrition is obtained by other routes." [https://en.wikipedia.org/wiki/Parenteral_nutrition, https://medlineplus.gov/ency/patientinstructions/000177.htm]
synonym: "central venous nutrition" NARROW []
synonym: "CVN" NARROW []
synonym: "peripheral parenteral nutrition" NARROW []
synonym: "TNA" EXACT []
synonym: "total nutrient admixture" EXACT []
synonym: "TPN" EXACT []
xref: PMID:32644462
is_a: XCO:0000013 ! diet
created_by: slaulederkind
creation_date: 2024-01-19T11:31:20Z

[Term]
id: XCO:0001257
name: trovafloxacin
def: "This is any condition in which the main influencing factor is trovafloxacin, a broad spectrum antibiotic more effective against Gram-positive bacteria than Gram-negative bacteria. Trovafloxacin exerts its antibacterial activity by inhibiting the uncoiling of supercoiled DNA by blocking the activity of DNA gyrase and topoisomerase IV." [CID:62959]
synonym: "7-[(1R,5S,6s)-6-amino-3-azabicyclo[3.1.0]hex-3-yl]-1-(2,4-difluorophenyl)-6-fluoro-4-oxo-1,4-dihydro-1,8-naphthyridine-3-carboxylic acid" EXACT []
synonym: "TVFX" EXACT []
xref: CHEBI:9763
xref: MESH:C080163
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2024-01-19T13:03:35Z

[Term]
id: XCO:0001258
name: valproate
def: "This is any condition in which the main influencing factor is valproate, a branched-chain saturated fatty acid anion that is the conjugate base of valproic acid. Valproic acid is used in the treatment of epilepsy and bipolar disorder." [CID:3549980]
synonym: "2-propylpentanoate" EXACT []
synonym: "VPA" EXACT []
xref: CHEBI:60654
is_a: XCO:0000950 ! anticonvulsant
relationship: part_of XCO:0000776 ! fatty acid
created_by: slaulederkind
creation_date: 2024-01-22T09:34:42Z

[Term]
id: XCO:0001259
name: valsartan
def: "This is any condition in which the main influencing factor is valsartan, a monocarboxylic acid amide and angiotensin II type 1 receptor blocker that is used to treat hypertension. Valsartan is also used in the management of heart failure and type 2 diabetes-associated nephropathy." [CID:60846, MESH:D000068756]
synonym: "N-pentanoyl-N-{[2'-(1H-tetrazol-5-yl)[1,1'-biphenyl]-4-yl]methyl}-L-valine" EXACT []
xref: CHEBI:9927
is_a: XCO:0000536 ! angiotensin II receptor antagonist
created_by: slaulederkind
creation_date: 2024-01-22T09:54:58Z

[Term]
id: XCO:0001260
name: sterile water, pH-adjusted
def: "This is any condition in which the main influencing factor is pH-adjusted sterile water, an acidity- or alkalinity-adjusted sterile water that is equilibrated to a specific pH." [https://www.merriam-webster.com, https://www.rxlist.com/sterile-water-drug.htm]
synonym: "sterile H2O, pH-adjusted" EXACT []
is_a: XCO:0001247 ! sterile water
created_by: slaulederkind
creation_date: 2024-01-22T11:22:07Z

[Term]
id: XCO:0001261
name: Ma Xing Shi Gan decoction
def: "This is any condition in which the main influencing factor is Ma Xing Shi Gan decoction, an anti-inflammatory and antiviral drug of traditional Chinese medicine (TCM). Ma Xing Shi Gan decoction has shown some effectiveness in the treatment of COVID-19 infection." [PMID:33324213]
synonym: "Maxing Shigan Decoction" EXACT []
synonym: "Maxingshigan Decoction" EXACT []
synonym: "MXSG" EXACT []
synonym: "MXSG Decoction" EXACT []
xref: PMID:32360484
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000657 ! antiviral agent
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2024-01-22T13:02:45Z

[Term]
id: XCO:0001262
name: ximelagatran
def: "This is any condition in which the main influencing factor is ximelagatran, which is an anticoagulant, a serine protease inhibitor and a prodrug for melagatran." [CID:9574101]
synonym: "ethyl N-{(1R)-1-cyclohexyl-2-[(2S)-2-{[4-(N'-hydroxycarbamimidoyl)benzyl]carbamoyl}azetidin-1-yl]-2-oxoethyl}glycinate" EXACT []
xref: CHEBI:65172
xref: MESH:C426686
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0001090 ! anticoagulant
created_by: slaulederkind
creation_date: 2024-01-23T11:32:13Z

[Term]
id: XCO:0001263
name: zafirlukast
def: "This is any condition in which the main influencing factor is zafirlukast, a leukotriene receptor antagonist (LTRA) and cytochrome P450 2C9 (CYP2C9) inhibitor." [CID:5717]
synonym: "cyclopentyl 3-[2-methoxy-4-(2-methylphenylsulfonylcarbamoyl)benzyl]-1-methyl-1H-indol-5-ylcarbamate" EXACT []
xref: CHEBI:10100
xref: MESH:C062735
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2024-01-23T13:19:13Z

[Term]
id: XCO:0001264
name: phloretin
def: "This is any condition in which the main influencing factor is phloretin, an antineoplastic agent and natural dihydrochalcone found in many fruits." [CID:4788]
synonym: "3-(4-hydroxyphenyl)-1-(2,4,6-trihydroxyphenyl)propan-1-one" EXACT []
synonym: "PHL" EXACT []
xref: CHEBI:17276
xref: MESH:D010693
xref: PMID:36793870
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000435 ! antineoplastic agent
created_by: slaulederkind
creation_date: 2024-01-23T13:32:00Z

[Term]
id: XCO:0001265
name: stress
def: "This is any condition in which the main influencing factor is stress, which is a physical, chemical, or emotional factor that causes bodily or mental tension and may be a factor in disease causation." [https://www.merriam-webster.com]
synonym: "pressure" EXACT []
synonym: "strain" EXACT []
synonym: "tension" EXACT []
is_a: XCO:0000000 ! experimental condition
created_by: slaulederkind
creation_date: 2024-01-23T14:18:33Z

[Term]
id: XCO:0001266
name: cage tilt
def: "This is any condition in which the main influencing factor is cage tilt, a procedure designed to cause mild stress in laboratory animals. Typically, the cage is tilted at 30 - 45 degrees for a few hours at a time to overnight." [https://www.merriam-webster.com, PMID:26650668]
synonym: "cage tilt stress" EXACT []
xref: PMID:34568850
relationship: part_of XCO:0001275 ! unpredictable chronic mild stress
created_by: slaulederkind
creation_date: 2024-01-23T14:47:18Z

[Term]
id: XCO:0001267
name: reversed light/dark cycle
def: "This is any condition in which the main influencing factor is a reversed light/dark cycle, a light/dark cycle that is opposite of the normal day/night conditions the subject or patient experiences." [https://www.merriam-webster.com]
synonym: "continuous lighting" NARROW []
synonym: "partially reversed day/night lighting" NARROW []
synonym: "reverse day/night lighting" EXACT []
synonym: "reversed day/night lighting" EXACT []
synonym: "reverse light/dark cycle" EXACT []
xref: PMID:36793870
is_a: XCO:0000459 ! controlled light/dark cycle
relationship: part_of XCO:0001275 ! unpredictable chronic mild stress
created_by: slaulederkind
creation_date: 2024-01-23T15:27:16Z

[Term]
id: XCO:0001268
name: tail clip
def: "This is any condition in which the main influencing factor is a tail clip procedure, a procedure done in the process of collecting blood from a laboratory animal. The subject is usually lightly restrained by the handler or by a mechancal device, while a few millimeters is cut off the end of the tail." [PMID:18459706]
synonym: "tail-clip" EXACT []
synonym: "tail snip" EXACT []
xref: PMID:36793870
relationship: part_of XCO:0001275 ! unpredictable chronic mild stress
created_by: slaulederkind
creation_date: 2024-01-23T16:02:29Z

[Term]
id: XCO:0001269
name: forced swimming
def: "This is any condition in which the main influencing factor is forced swimming, a situation in which the subject (typically a laboratory rodent) inside a water-filled chamber must swim to survive." [https://www.merriam-webster.com]
synonym: "behavioural despair test" EXACT []
synonym: "forced swimming test" EXACT []
synonym: "forced swim test" EXACT []
synonym: "FST" EXACT []
synonym: "Porsolt forced swimming test" EXACT []
xref: PMID:26650668
xref: PMID:36793870
is_a: XCO:0000006 ! swimming
relationship: part_of XCO:0001275 ! unpredictable chronic mild stress
created_by: slaulederkind
creation_date: 2024-01-23T16:19:18Z

[Term]
id: XCO:0001270
name: forced cold water swimming
def: "This is any condition in which the main influencing factor is forced swimming in cold water, a situation in which the subject (typically a laboratory rodent), inside a water-filled cylinder, must swim to survive." [https://en.wikipedia.org/wiki/Behavioural_despair_test, PMID:36793870]
synonym: "cold water FST" EXACT []
synonym: "forced cold water swim" EXACT []
synonym: "forced cold water swimming test" EXACT []
synonym: "forced cold water swim test" EXACT []
is_a: XCO:0001269 ! forced swimming
created_by: slaulederkind
creation_date: 2024-01-23T16:31:48Z

[Term]
id: XCO:0001271
name: zimelidine
def: "This is any condition in which the main influencing factor is zimelidine, an SRI (serotonin uptake inhibitor) antidepressant whose use was discontinued because of the risk of Guillain-Barre syndrome as a side effect." [CID:5365247]
synonym: "2-Propen-1-amine, 3-(4-bromophenyl)-N,N-dimethyl-3-(3-pyridinyl)-, (Z)-" EXACT []
xref: CAS:56775-88-3
xref: CHEBI:135357
xref: MESH:D015031
is_a: XCO:0000561 ! antidepressant
created_by: slaulederkind
creation_date: 2024-01-25T09:24:24Z

[Term]
id: XCO:0001272
name: zolpidem
def: "This is any condition in which the main influencing factor is zolpidem, an imidazopyridine derivative and short-acting GABA-A receptor agonist that is used for the treatment of insomnia." [MESH:D000077334]
synonym: "N,N-dimethyl-2-[6-methyl-2-(4-methylphenyl)imidazo[1,2-a]pyridin-3-yl]acetamide" EXACT []
xref: CHEBI:10125
xref: CID:5732
is_a: XCO:0000135 ! receptor agonist
created_by: slaulederkind
creation_date: 2024-01-25T09:47:44Z

[Term]
id: XCO:0001273
name: high-protein/ammoniagenic diet
def: "This is any condition in which the main influencing factor is a high-protein/ammoniagenic diet, which is a standard diet supplemented with additional amino acids including leucine (~13% of amino acids), valine (~11% of amino acids), and the absence of isoleucine." [PMID:10459831, PMID:36539425]
is_a: XCO:0000030 ! controlled protein content diet
created_by: slaulederkind
creation_date: 2024-01-25T12:58:34Z

[Term]
id: XCO:0001274
name: telmisartan
def: "This is any condition in which the main influencing factor is telmisartan, a biphenyl compound and benzimidazole derivative that acts as an angiotensin II type 1 receptor antagonist used in the management of hypertension." [MESH:D000077333]
synonym: "4'-[(1,7'-dimethyl-2'-propyl-1H,3'H-2,5'-bibenzimidazol-3'-yl)methyl][1,1'-biphenyl]-2-carboxylic acid" EXACT []
xref: CHEBI:9434
xref: CID:65999
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000536 ! angiotensin II receptor antagonist
created_by: slaulederkind
creation_date: 2024-01-25T13:22:29Z

[Term]
id: XCO:0001275
name: unpredictable chronic mild stress
def: "This is any condition in which the main influencing factor is unpredictable chronic mild stress, an experimental model of depression that involves exposing laboratory animals (usually mice or rats) at unpredictable times over several weeks to a series of minor-intensity stressors. This process results in the development of a number of behavioral alterations in a large majority of animals, including anhedonia (loss of pleasure) and apathy." [PMID:34406704, PMID:7202217]
synonym: "chronic unpredictable mild stress" EXACT []
synonym: "chronic unpredictable stress" EXACT []
synonym: "CMS" EXACT []
synonym: "CUMS" EXACT []
synonym: "UCMS" EXACT []
is_a: XCO:0001265 ! stress
created_by: slaulederkind
creation_date: 2024-01-29T12:15:10Z

[Term]
id: XCO:0001276
name: bromobenzene
def: "This is any condition in which the main influencing factor is bromobenzene, the simplest member of the class of bromobenzenes, that is benzene in which a single hydrogen has been substituted by a bromine. Bromobenzene is used as a solvent, particularly for large-scale crystallizations, and for the introduction of phenyl groups in organic synthesis." [CHEBI:3179]
synonym: "Benzene, bromo" EXACT []
synonym: "Monobromobenzene" EXACT []
synonym: "PhBr" EXACT []
synonym: "Phenyl bromide" EXACT []
xref: CID:7961
xref: MESH:C032036
is_a: XCO:0001231 ! solvent
created_by: slaulederkind
creation_date: 2024-01-30T12:12:23Z

[Term]
id: XCO:0001277
name: nicotinamide
def: "This is any condition in which the main influencing factor is nicotinamide, a pyridine derivative that is a component of the coenzyme NAD, a form of vitamin B3, an antioxidant, a histone deacetylase inhibitor, and an anti-inflammatory agent." [CID:936]
synonym: "3-pyridinecarboxamide" EXACT []
synonym: "NAM" EXACT []
synonym: "niacinamide" EXACT []
synonym: "vitamin B3" BROAD []
xref: CHEBI:17154
xref: MESH:D009536
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2024-01-30T12:34:51Z

[Term]
id: XCO:0001278
name: controlled nicotinamide content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of nicotinamide, in which the amount of nicotinamide consumed is maintained at a specified level." [https://www.merriam-webster.com/]
synonym: "controlled NAM content drinking water" EXACT []
synonym: "controlled niacinamide content drinking water" EXACT []
xref: CHEBI:17154
xref: CID:936
xref: MESH:D009536
is_a: XCO:0000163 ! controlled content drinking water
is_a: XCO:0001277 ! nicotinamide
created_by: slaulederkind
creation_date: 2024-01-30T12:51:51Z

[Term]
id: XCO:0001279
name: partial bladder outlet obstruction
def: "This is any condition in which the main influencing factor is partial bladder outlet obstruction, an experimental constriction of the neck of the urinary bladder to restrict urine flow and model changes that occur in clinical bladder outlet obstruction (BOO). Partial bladder outlet obstruction may be achieved surgically by passing a catheter through the urethra into the bladder, suturing around the neck of the bladder, and removing the catheter." [PMID:20590549]
synonym: "pBOO" EXACT []
xref: GEO:GSE167430
xref: https://my.clevelandclinic.org/health/diseases/15181-bladder-outlet-obstruction
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2024-02-01T10:29:45Z

[Term]
id: XCO:0001280
name: open field task
def: "This is any condition in which the main influencing factor is the open field task, which is designed to measure the movement and other behavior exhibited by a subject responding to an experimentally defined, open space. The open field test is used to assess activity and behavior in laboratory animals, usually rodents." [https://en.wikipedia.org/wiki/Open_field_(animal_test), https://med.stanford.edu/sbfnl/services/bm/sm/openfield.html]
synonym: "open field maze" EXACT []
synonym: "open field test" EXACT []
xref: PMID:25742564
xref: PMID:36793870
is_a: XCO:0000059 ! physical activity
created_by: slaulederkind
creation_date: 2024-02-05T12:42:37Z

[Term]
id: XCO:0001281
name: sodium octanoate
def: "This is any condition in which the main influencing factor is sodium octanoate, an organic sodium salt comprising equal numbers of sodium and octanoate ions." [CHEBI:132100]
synonym: "octanoic acid, sodium salt" EXACT []
synonym: "sodium caprylate" EXACT []
synonym: "sodium n-octanoate" EXACT []
xref: CID:23664772
xref: PMID:34939931
relationship: has_component XCO:0000253 ! sodium ion
created_by: slaulederkind
creation_date: 2024-02-05T16:24:49Z

[Term]
id: XCO:0001282
name: sodium carboxymethylcellulose
def: "This is any condition in which the main influencing factor is sodium carboxymethylcellulose, a cellulose derivative which is a beta-(1,4)-D-glucopyranose polymer. Sodium carboxymethylcellulose is a commonly used form of carboxymethylcellulose." [https://en.wikipedia.org/wiki/Carboxymethyl_cellulose#References, MESH:D002266]
synonym: "carboxymethylcellulose sodium" EXACT []
synonym: "carboxymethylcellulose sodium salt" EXACT []
synonym: "carmellose sodium" EXACT []
synonym: "CMC-Na" EXACT []
xref: CHEBI:85146
xref: CID:6328154
is_a: XCO:0001129 ! carboxymethylcellulose
created_by: slaulederkind
creation_date: 2024-02-06T11:57:19Z

[Term]
id: XCO:0001283
name: grouped housing
def: "This is any condition in which the main influencing factor is grouped housing, a living situation involving four or more individual subjects housed in the same structure." [PMID:15033287, PMID:37044360]
synonym: "group housing" EXACT []
is_a: XCO:0000033 ! housing condition
relationship: part_of XCO:0001275 ! unpredictable chronic mild stress
created_by: slaulederkind
creation_date: 2024-02-08T16:10:11Z

[Term]
id: XCO:0001284
name: soiled cage
def: "This is any condition in which the main influencing factor is a soiled cage, a housing condition designed to create stress in subjects living in such housing. The soiled cage is typically a cage in which excess water has been introduced to the bedding (for example: 200 ml water in 100 g of sawdust bedding)." [PMID:15033287, PMID:36793870]
synonym: "wet cage" EXACT []
is_a: XCO:0000033 ! housing condition
relationship: part_of XCO:0001275 ! unpredictable chronic mild stress
created_by: slaulederkind
creation_date: 2024-02-08T16:47:00Z

[Term]
id: XCO:0001285
name: oxaliplatin
def: "This is any condition in which the main influencing factor is oxaliplatin, an organoplatinum complex that is a commonly used as a chemothrepeutic drug for treatment of metastatic colorectal cancer." [XCO:0000088]
synonym: "(SP-4-2)[(1R,2R)-cyclohexane-1,2-diamine-kappa(2)N,N'][ethanedioato(2-)-kappa(2)O(1),O(2)]platinum" EXACT []
xref: GEO:GSE160543
is_a: XCO:0000435 ! antineoplastic agent
created_by: slaulederkind
creation_date: 2024-02-16T15:16:38Z

[Term]
id: XCO:0001286
name: von Frey monofilament stimulus
def: "This is any condition in which the main influencing factor is a Von Frey monofilament stimulus, usually encountered in a Von Frey assay, which is used to evaluate mechanical allodynia in laboratory rodents. The von Frey test, which may be manual or electronic, uses von Frey monofilaments (hair or fibers), which are small pieces of nylon rod, approximately 50 mm in length, and of varying diameters, to test a rodent's sensitivity to punctate mechanical pressure on the plantar surface of a rear paw. Von Frey filaments are able to deliver force in the range of 0.08 to 2940 mN." [https://en.wikipedia.org/wiki/Nociception_assay, PMID:28932184]
synonym: "von Frey assay condition" EXACT []
xref: PMID:34808752
is_a: XCO:0000052 ! tactile stimulus
created_by: slaulederkind
creation_date: 2024-02-19T15:10:13Z

[Term]
id: XCO:0001287
name: hot plate stimulus
def: "This is any condition in which the main influencing factor is a hot plate stimulus, usually encountered by laboratory rodents in thermal hyperalgesia testing. The hot plate test is a useful screening tool for interventions of analgesia and involves placing the subject on its feet on a temperature-regulatable hot plate inside a cylindrical chamber." [https://en.wikipedia.org/wiki/Hot_plate_test, https://maze.conductscience.com/portfolio/hot-plate/]
synonym: "PMID:34808752" EXACT []
is_a: XCO:0000052 ! tactile stimulus
created_by: slaulederkind
creation_date: 2024-02-19T15:33:23Z

[Term]
id: XCO:0001288
name: acetone drop stimulus
def: "This is any condition in which the main influencing factor is an acetone drop stimulus, usually encountered in a test used to measure cold allodynia behavior in the experimental subject, typically a rodent. The test involves applying a small drop (50 - 100 ul) of acetone to the mid-plantar area of the hind paw and recording the resulting behavior for one minute. The skin temperature of the subject drops ~3 - 5 degrees during the test." [PMID:30228362]
xref: PMID:34808752
is_a: XCO:0000052 ! tactile stimulus
created_by: slaulederkind
creation_date: 2024-02-22T13:16:18Z

[Term]
id: XCO:0001289
name: tenotomy
def: "This is any condition in which the main influencing factor is tenotomy, any process involving transcutaneous or surgical techniques for incision of a tendon to investigate and/or treat a pathological condition. Tenotomy may involve needle puncture, incision, or complete transection of a tendon." [https://my.clevelandclinic.org/health/treatments/24123-tenotomy]
synonym: "open tenotomy" NARROW []
xref: PMID:35897746
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2024-02-22T14:12:59Z

[Term]
id: XCO:0001290
name: Achilles tendon transection
def: "This is any condition in which the main influencing factor is Achilles tendon transection, a process involving a surgical technique for complete transection of the calcaneal and plantaris tendon to investigate tendon healing in an experimental animal model." [https://en.wikipedia.org/wiki/Achilles_tendon, PMID:35897746]
synonym: "Achille's tenotomy" EXACT []
synonym: "open Achilles tenotomy" EXACT []
is_a: XCO:0001289 ! tenotomy
created_by: slaulederkind
creation_date: 2024-02-22T14:31:22Z

[Term]
id: XCO:0001291
name: particulate matter
def: "This is any condition in which the main influencing factor is particulate matter (particle pollution), a mixture of inhalable, solid particles and liquid droplets found in the air. The size of particulate matter ranges from visible to microscopic." [https://www.epa.gov/pm-pollution/particulate-matter-pm-basics#PM]
synonym: "particle pollution" EXACT []
synonym: "PM" EXACT []
xref: PMID:35897746
is_a: XCO:0000342 ! chemical with specified structure
relationship: part_of XCO:0000918 ! ambient air
created_by: slaulederkind
creation_date: 2024-02-23T11:04:16Z

[Term]
id: XCO:0001293
name: PM2.5
def: "This is any condition in which the main influencing factor is PM2.5, which is particulate matter consisting of fine inhalable particles, with diameters that are generally 2.5 micrometers and smaller." [https://www.epa.gov/pm-pollution/particulate-matter-pm-basics#PM]
synonym: "2.5 um particulate matter" EXACT []
xref: PMID:35897746
is_a: XCO:0001291 ! particulate matter
created_by: slaulederkind
creation_date: 2024-02-23T11:17:32Z

[Term]
id: XCO:0001294
name: PM10
def: "This is any condition in which the main influencing factor is PM10, which is particulate matter consisting of inhalable particles, with diameters that are generally 10 micrometers and smaller." [https://www.epa.gov/pm-pollution/particulate-matter-pm-basics#PM]
synonym: "10 um particulate matter" EXACT []
xref: PMID:35897746
is_a: XCO:0001291 ! particulate matter
created_by: slaulederkind
creation_date: 2024-02-23T11:22:35Z

[Term]
id: XCO:0001295
name: gingerol
def: "This is any condition in which the main influencing factor is gingerol, a beta-hydroxy ketone that is 5-hydroxydecan-3-one substituted by a 4-hydroxy-3-methoxyphenyl moiety at position 1. Gingerol is a constituent of fresh ginger and other plants. Gingerol may have antifungal and antineoplastic properties." [CHEBI:10136, https://en.wikipedia.org/wiki/File\:Gingerol_cytotoxic_activity.jpg]
synonym: "(5S)-5-hydroxy-1-(4-hydroxy-3-methoxyphenyl)decan-3-one" EXACT []
synonym: "(6)-Gingerol" EXACT []
synonym: "6-Gingerol" EXACT []
xref: CID:442793
xref: MESH:C007845
xref: PMID:35897746
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0001489 ! antifungal agent
created_by: slaulederkind
creation_date: 2024-02-23T13:21:55Z

[Term]
id: XCO:0001296
name: blood transfusion
def: "This is any condition in which the main influencing factor is blood transfusion, an intravenous transfer of blood or blood components from one subject to another or from one subject back to the same subject (after treatment or storage of blood/blood product)." [https://en.wikipedia.org/wiki/Blood_transfusion, https://www.merriam-webster.com]
synonym: "autologous blood transfusion" NARROW []
synonym: "homologous blood transfusion" NARROW []
synonym: "transfusion" EXACT []
xref: PMID:35897746
is_a: XCO:0000761 ! biologics and probiotics
created_by: slaulederkind
creation_date: 2024-02-23T13:48:00Z

[Term]
id: XCO:0001297
name: autologous blood transfusion
def: "This is any condition in which the main influencing factor is autologous blood transfusion, the intravenous reinfusion of blood or blood components to the same individual from whom they were taken." [https://www.merriam-webster.com, PMID:8400524]
xref: PMID:35897746
is_a: XCO:0001296 ! blood transfusion
created_by: slaulederkind
creation_date: 2024-02-23T13:55:44Z

[Term]
id: XCO:0001298
name: bleomycin
def: "This is any condition in which the main influencing factor is bleomycin, a complex of related glycopeptide antibiotics from Streptomyces verticillus consisting of bleomycin A2 and B2. Bleomycin inhibits DNA metabolism and is used as an antineoplastic, especially for solid tumors." [CID:5360373]
synonym: "bleomycin a2" EXACT []
xref: PMID:33881353
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000482 ! antimicrobial agent
created_by: slaulederkind
creation_date: 2024-02-23T14:57:46Z

[Term]
id: XCO:0001299
name: middle cerebral artery occlusion sham procedure
def: "This is any condition in which the main influencing factor is a middle cerebral artery (MCA) occlusion sham procedure, which follows the same surgical process as an MCA occlusion without blocking the middle cerebral artery." [https://www.merriam-webster.com/]
synonym: "MCA occlusion sham procedure" EXACT []
synonym: "MCA occlusion sham surgery" EXACT []
synonym: "middle cerebral artery occlusion sham surgery" EXACT []
xref: PMID:2643202
xref: PMID:33935709
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0000348 ! middle cerebral artery occlusion
created_by: slaulederkind
creation_date: 2024-02-26T14:15:53Z

[Term]
id: XCO:0001300
name: cerebral reperfusion
def: "This is any condition in which the main influencing factor is cerebral reperfusion, any situation in which the flow of blood to the cerebral hemispheres is restored after a period of blood vessel occlusion occurring experimentally." [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "cerebral ischemia/reperfusion" EXACT []
synonym: "cerebral ischemia-reperfusion" EXACT []
synonym: "cerebrum ischemia/reperfusion" EXACT []
synonym: "cerebrum ischemia-reperfusion" EXACT []
synonym: "cerebrum reperfusion" EXACT []
xref: PMID:33935709
relationship: has_component XCO:0000348 ! middle cerebral artery occlusion
created_by: slaulederkind
creation_date: 2024-02-27T14:36:39Z

[Term]
id: XCO:0001301
name: AEGE extract
def: "This is any condition in which the main influencing factor is AEGE extract, an herbal mixture extracted from the dried roots and rhizomes or stems of Acanthopanax senticosus Harms (ASH; Eleutherococcus senticosus; Siberian Ginseng) and Gastrodia elata Blume (Tianma; GE)." [PMID:33935709]
synonym: "AEGE" EXACT []
synonym: "ASE and GEB" EXACT []
synonym: "GEB-ASE" EXACT []
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2024-02-27T15:16:18Z

[Term]
id: XCO:0001302
name: dapagliflozin
def: "This is any condition in which the main influencing factor is dapagliflozin, a sodium-glucose cotransporter 2 (SGLT2) inhibitor used for managing diabetes mellitus type 2." [CID:9887712]
synonym: "(1S)-1,5-anhydro-1-[4-chloro-3-(4-ethoxybenzyl)phenyl]-D-glucitol" EXACT []
synonym: "DAPA" EXACT []
xref: CHEBI:85078
xref: MESH:C529054
xref: PMID:37383701
is_a: XCO:0000120 ! inhibitor
is_a: XCO:0000407 ! hypoglycemic agent
created_by: slaulederkind
creation_date: 2024-03-01T10:57:39Z

[Term]
id: XCO:0001303
name: sinomenine
def: "This is any condition in which the main influencing factor is sinomenine, a unique plant alkaloid that releases histamine in association with degranulation of tissue mast cells in mammalian tissues. Sinomenine has been used in herbal medicine for the treatment of rheumatism and arthritis. Sinomenine also has anti-angiogenic, anti-inflammatory, and anti-apoptotic effects." [CID:5459308]
synonym: "cocculine" EXACT []
synonym: "cucoline" EXACT []
synonym: "cuculine" EXACT []
xref: CHEBI:9163
xref: MESH:C009271
xref: PMID:61710
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulederkind
creation_date: 2024-03-01T11:26:11Z

[Term]
id: XCO:0001304
name: Danlu tongdu
def: "This is any condition in which the main influencing factor is Danlu tongdu, a Chinese patent medicine made up of five traditional Chinese drugs, including Salviae miltiorrhizae, Astragali radix, Eucommiae cortex, Corydalis rhizoma and Cervi cornus colla. Danlu tongdu is used in treatment of lumbar spinal stenosis and lumbosacral disc herniations, but has some adverse side-effects on liver." [PMID:36408216]
synonym: "DLTD" EXACT []
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2024-03-04T17:50:54Z

[Term]
id: XCO:0001305
name: pulmonary artery occlusion
def: "This is any condition in which the main influencing factor is pulmonary artery occlusion, a clinical or experimental surgical procedure which restricts the amount of blood flow to the lung via the pulmonary artery." [PMID:32809673]
synonym: "PAB" EXACT []
synonym: "pulmonary artery banding" EXACT []
synonym: "pulmonary artery ligation" EXACT []
xref: PMID:36631871
is_a: XCO:0000347 ! blood vessel occlusion
created_by: slaulederkind
creation_date: 2024-03-05T13:47:25Z

[Term]
id: XCO:0001306
name: experimental traumatic muscle injury
def: "This is a condition induced by an mechanical procedure involving controlled trauma to skeletal muscle. The controlled muscle trauma may be to model contusion, strain, or laceration." [PMID:23328717, PMID:24011855]
synonym: "experimental mechanical muscle injury" EXACT []
synonym: "experimental muscle contusion" NARROW []
synonym: "experimental muscle laceration" NARROW []
synonym: "experimental muscle strain" NARROW []
is_a: XCO:0001100 ! physical manipulation
created_by: slaulederkind
creation_date: 2024-03-08T14:04:49Z

[Term]
id: XCO:0001307
name: experimental muscle contusion
def: "This is a condition induced by an mechanical procedure involving controlled trauma to skeletal muscle, such as the vastus medialis (part of the quadriceps muscle). Controlled muscle contusion has been used to model myofascial pain syndrome and other skeletal muscle injuries." [PMID:23328717, PMID:24011855]
synonym: "experimental muscle bruise" EXACT []
is_a: XCO:0001306 ! experimental traumatic muscle injury
created_by: slaulederkind
creation_date: 2024-03-08T14:37:50Z

[Term]
id: XCO:0001308
name: Erxian decoction
def: "This is any condition in which the main influencing factor is Erxian decoction, a six-herb formulation from traditional Chinese medicine (TCM). Erxian decoction (ERX) has been used for the treatment of menopausal symptoms and also for spinal cord injury." [PMID:30658181, PMID:36387579]
synonym: "Er-Xian Decoction" EXACT []
synonym: "Er xian tang" RELATED []
synonym: "Erxian tang" RELATED []
synonym: "EXD" EXACT []
synonym: "Two Immortals Decoction" RELATED []
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2024-03-18T14:40:55Z

[Term]
id: XCO:0001309
name: methylprednisolone sodium succinate
def: "This is any condition in which the main influencing factor is methylprednisolone sodium succinate, the sodium succinate salt of a synthetic glucocorticoid receptor agonist with immunosuppressive and anti-inflammatory effects. Methylprednisolone sodium succinate is converted into active prednisolone in the body, which activates the glucocorticoid receptor." [CID:23680530]
synonym: "MPL sodium succinate" EXACT []
xref: CHEBI:6890
is_a: XCO:0000229 ! steroid hormone
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulederkind
creation_date: 2024-03-18T15:13:22Z

[Term]
id: XCO:0001310
name: controlled methylprednisolone sodium succinate content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of methylprednisolone sodium succinate, the sodium succinate salt of a synthetic glucocorticoid receptor agonist with immunosuppressive and anti-inflammatory effects." [CID:23680530, https://www.merriam-webster.com/]
synonym: "controlled MPL sodium succinate content drinking water" EXACT []
xref: CHEBI:6890
is_a: XCO:0000163 ! controlled content drinking water
is_a: XCO:0001309 ! methylprednisolone sodium succinate
created_by: slaulederkind
creation_date: 2024-03-18T15:25:49Z

[Term]
id: XCO:0001311
name: Pkc-IN-1
def: "This is any condition in which the main influencing factor is Pkc-IN-1, a potent, ATP-competitive inhibitor of PKC&#945; and PKC&#946;." [PMID:37805649]
synonym: "5-[(2S,5R)-2,5-dimethyl-4-(tetrahydro-2H-pyran-4-ylmethyl)piperazin-l-yl]carbonyl-N-(5-fluoro-2-methylpyrimidin-4-yl)-6, 6-dimethyl-1,4, 5, 6-tetrahydropyrrolo[3,4-c]pyrazol-3-amine" EXACT []
synonym: "Cmpd 1" EXACT []
synonym: "Cmpd A" EXACT []
xref: CAS:1046787-18-1
xref: CID:25155745
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulederkind
creation_date: 2024-03-18T16:52:03Z

[Term]
id: XCO:0001312
name: controlled Pkc-IN-1 content diet
def: "This is any condition in which the main influencing factor is a solid diet in which the amount of Pkc-IN-1 is maintained at a specified level. Pkc-IN-1 is a potent, ATP-competitive inhibitor of PKC&#945; and PKC&#946;." [https://www.merriam-webster.com/, PMID:37805649]
synonym: "controlled Cmpd 1 content diet" EXACT []
synonym: "controlled Cmpd A content diet" EXACT []
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0001311 ! Pkc-IN-1
created_by: slaulederkind
creation_date: 2024-03-19T12:09:44Z

[Term]
id: XCO:0001313
name: inferior alveolar nerve transection
def: "This is any condition in which the main influencing factor is transection of the inferior alveolar nerve, a model of a peripheral nerve injury. The inferior alveolar nerve (IAN) is a branch of the mandibular nerve in the lower jaw. The inferior alveolar nerve branches into the mylohyoid nerve and the mental nerve." [https://www.ncbi.nlm.nih.gov/books/NBK546712/, PMID:37946211]
synonym: "IANX" EXACT []
synonym: "transection of the inferior alveolar nerve" EXACT []
is_a: XCO:0001373 ! surgical nerve transection
created_by: slaulederkind
creation_date: 2024-03-19T12:35:17Z

[Term]
id: XCO:0001314
name: forced activity in rotating cylinder
def: "This is any condition in which the main influencing factor is forced activity in rotating cylinder, which can be used with rodents as a model of human shift work. The rotating cylinder (~1 revolution per 3 minutes) forces the subject to move and reposition repeatedly during a specified period." [https://www.merriam-webster.com/, PMID:35236346]
synonym: "night shift work simulation" NARROW []
synonym: "shift work simulation" EXACT []
is_a: XCO:0000059 ! physical activity
created_by: slaulederkind
creation_date: 2024-03-19T13:33:03Z

[Term]
id: XCO:0001315
name: Tianhe Zhuifeng Gao
def: "This is any condition in which the main influencing factor is Tianhe Zhuifeng Gao, a complex mixture of herbal and other medicinal ingredients. Tianhe Zhuifeng Gao is an external analgesic used as a plaster formulation or a liquid extract." [https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=28457a0b-e7de-4e37-a554-edf4e2000898&audience=consumer, PMID:37860777]
synonym: "TZG" EXACT []
synonym: "Zhui Feng Gao" EXACT []
is_a: XCO:0000106 ! anesthetic/analgesic
created_by: slaulederkind
creation_date: 2024-03-19T17:19:02Z

[Term]
id: XCO:0001316
name: methamphetamine
def: "This is any condition in which the main influencing factor is methamphetamine, a member of the class of amphetamines in which the amino group of (S)-amphetamine carries a methyl substituent." [CHEBI:6809]
synonym: "(2S)-N-methyl-1-phenylpropan-2-amine" EXACT []
xref: CID:10836
xref: MESH:D008694
xref: PMID:33238484
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2024-03-21T15:13:20Z

[Term]
id: XCO:0001317
name: C4 spinal cord hemi-contusion
def: "This is any condition in which the main influencing factor is an experimental surgical procedure involving hemilaminectomy/laminectomy of the fourth cervical vertebra and delivery of a controlled contusion to one side of the spinal cord by a mechanical apparatus." [PMID:25929319, PMID:34267212]
synonym: "spinal cord hemi-contusion at C4" EXACT []
synonym: "spinal cord injury at C4" BROAD []
synonym: "spinal cord injury at the fourth cervical vertebra" BROAD []
is_a: XCO:0001041 ! experimental spinal cord contusion
created_by: slaulederkind
creation_date: 2024-03-21T17:02:00Z

[Term]
id: XCO:0001318
name: motor cortex stimulation via implanted electrode array
def: "This is any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to a specific area of motor cortex. This is done with implanted electrode(s)." [http://braininfo.rprc.washington.edu/Default.aspx, PMID:34267212]
synonym: "brain stimulation via implanted electrode array" BROAD []
is_a: XCO:0000027 ! surgical implantation
is_a: XCO:0000520 ! neuromodulation
created_by: slaulederkind
creation_date: 2024-03-21T17:30:51Z

[Term]
id: XCO:0001319
name: 3D printed scaffold implantation
def: "This is any condition in which the main influencing factor is implantation of a 3D printed scaffold, an artificial construct which mimics the extracellular matrix of the host tissue. The scaffold may be made of natural or synthetic polymers, metal, or ceramic." [https://www.sciencedirect.com/science/article/pii/S2590238522002983, https://www.sciencedirect.com/topics/materials-science/scaffold-for-tissue-engineering]
xref: PMID:35040587
is_a: XCO:0001409 ! tissue engineering scaffold implantation
created_by: slaulederkind
creation_date: 2024-03-25T14:44:30Z

[Term]
id: XCO:0001320
name: 3D printed GelMA scaffold implantation
def: "This is any condition in which the main influencing factor is implantation of a 3D printed gelatin-methacryloyl (GelMA) scaffold, a tissue scaffold made of the bioprintable, natural polymer hydrogel gelatin methacryloyl. GelMA has been widely utilized for diverse tissue engineering applications." [PMID:38507816]
synonym: "3D printed gelatin methacryloyl scaffold implant" EXACT []
synonym: "3D printed gelatin methacryloyl scaffold implantation" EXACT []
xref: PMID:35040587
xref: PMID:38507816
is_a: XCO:0001319 ! 3D printed scaffold implantation
created_by: slaulederkind
creation_date: 2024-03-25T15:16:51Z

[Term]
id: XCO:0001321
name: 3D printed PCL scaffold implantation
def: "This is any condition in which the main influencing factor is implantation of a 3D printed polycaprolactone (PCL) scaffold, a tissue scaffold made of the printable, synthetic polymer material polycaprolactone. PCL has been used in bone tissue engineering due to its advantages such as good biocompatibility, slow degradation rate, and the potential for loadbearing applications. PCL has also been tested for tendon repair." [PMID:35040587]
synonym: "3D printed polycaprolactone scaffold implantation" EXACT []
is_a: XCO:0001319 ! 3D printed scaffold implantation
created_by: slaulederkind
creation_date: 2024-03-25T15:49:18Z

[Term]
id: XCO:0001322
name: 3D printed β‐TCP scaffold implantation
def: "This is any condition in which the main influencing factor is implantation of a 3D printed β‐TCP scaffold, a tissue scaffold made of a printable, bioceramic material (mainly β‐tricalcium phosphate/β‐TCP). β-tricalcium phosphate (β-TCP) is one the most used and potent synthetic bone graft substitutes. β-TCP has the beneficial properties of biocompatibility, osteoconductivity, osteoinductivity, and biodegradability." [PMID:35669331]
synonym: "3D printed β-tricalcium phosphate scaffold implant" EXACT []
synonym: "3D printed β-tricalcium phosphate scaffold implantation" EXACT []
xref: PMID:35040587
is_a: XCO:0001319 ! 3D printed scaffold implantation
created_by: slaulederkind
creation_date: 2024-03-26T13:38:24Z

[Term]
id: XCO:0001323
name: experimental drill-hole bone defect
def: "This is any condition in which the main influencing factor is an experimental drill-hole bone defect, a controlled, precisely defined defect created with a surgical bone drill. This type of bone defect is made in laboratory animals to study the healing of bone fractures and sometimes for delivery of therapeutic substances." [PMID:35849443]
synonym: "burr holing" RELATED []
synonym: "trepanation" RELATED []
synonym: "trepanning" RELATED []
synonym: "trephination" RELATED []
xref: https://www.osmosis.org/answers/trephination
xref: PMID:35040587
is_a: XCO:0001394 ! osteotomy
created_by: slaulederkind
creation_date: 2024-03-26T14:13:37Z

[Term]
id: XCO:0001324
name: H1-hESC-derived hNPCs
def: "This is any condition in which the main influencing factor is an injection or infusion of human neural progenitor cells derived from the H1 human embryonic stem cell line (H1-hESC)." [PMID:35030322]
synonym: "H1-derived hNPCs" EXACT []
xref: https://www.wicell.org/home/stem-cells/catalog-of-stem-cell-lines/wa01.cmsx
xref: PMID:18564034
is_a: XCO:0001032 ! human neural progenitor cells
created_by: slaulederkind
creation_date: 2024-03-26T14:55:28Z

[Term]
id: XCO:0001325
name: 3-aminoisobutyric acid
def: "This is any condition in which the main influencing factor is 3-aminoisobutyric acid, which is isobutyric acid in which one of the methyl hydrogens is substituted by an amino group. During exercise, 3-aminoisobutyric acid is secreted by muscle cells into the blood, and when this molecule interacts with adipocytes, it may induce signaling pathways that regulate the metabolism of fats, insulin, and cholesterol." [CID:64956]
synonym: "3-amino-2-methylpropanoic acid" EXACT []
synonym: "BAIBA" EXACT []
synonym: "beta-aminoisobutyric acid" EXACT []
xref: CAS:144-90-1
xref: CHEBI:27389
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2024-03-28T13:08:38Z

[Term]
id: XCO:0001326
name: left anterior descending coronary artery occlusion sham procedure
def: "This is any condition in which the main influencing factor is a left anterior descending coronary artery occlusion sham procedure, which follows the same surgical process as an left anterior descending coronary artery occlusion without blocking the left anterior descending coronary artery." [PMID:35282369]
synonym: "interventricular artery occlusion sham procedure" EXACT []
synonym: "LAD occlusion sham procedure" EXACT []
synonym: "left anterior descending artery occlusion sham procedure" EXACT []
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0000549 ! left anterior descending coronary artery occlusion
created_by: slaulederkind
creation_date: 2024-03-28T13:27:56Z

[Term]
id: XCO:0001327
name: letrozole
def: "This is any condition in which the main influencing factor is letrozole, a triazole and benzonitrile derivative that is a selective non-steroidal aromatase inhibitor, similar to anastrozole. Letrozole is used in the treatment of metastatic or locally advanced breast cancer in postmenopausal women." [MESH:D000077289]
synonym: "4,4'-(1H-1,2,4-triazol-1-ylmethanediyl)dibenzonitrile" EXACT []
xref: CHEBI:6413
xref: CID:3902
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2024-03-28T14:12:18Z

[Term]
id: XCO:0001328
name: mogroside
def: "This is any condition in which the main influencing factor is a mogroside, a glycoside of cucurbitane derivatives found in certain plants, such as monkfruit (S. grosvenorii). Mogrosides are extracted from monkfruit and used in the manufacture of sugar substitutes. Mogrosides have shown some efficacy as anticarcinogens, anti-inflammatory agents, sugar- and lipid-lowering agents." [https://en.wikipedia.org/wiki/Mogroside, https://www.future-science.com/doi/10.4155/fmc-2017-0255]
synonym: "mogrosides" EXACT []
xref: CHEBI:139477
xref: PMID:35418943
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000407 ! hypoglycemic agent
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000850 ! therapeutic agent
created_by: slaulederkind
creation_date: 2024-03-28T14:43:56Z

[Term]
id: XCO:0001329
name: opioid analgesic
def: "This is any condition in which the main influencing factor is an opioid analgesic. Opioids (synthetic or semisynthetic) and opiates (related natural alkaloids) make up this class of medication used in the management and treatment of pain." [CHEBI:35482, https://www.ncbi.nlm.nih.gov/books/NBK459161/, PMID:31643200]
synonym: "narcotic analgesic" EXACT []
is_a: XCO:0000106 ! anesthetic/analgesic
created_by: slaulederkind
creation_date: 2024-04-01T13:31:08Z

[Term]
id: XCO:0001330
name: oxycodone
def: "This is any condition in which the main influencing factor is oxycodone, a semisynthetic opioid analgesic derived from thebaine." [CHEBI:7852]
synonym: "14-hydroxy-3-methoxy-17-methyl-4,5alpha-epoxymorphinan-6-one" EXACT []
xref: CID:5284603
xref: MESH:D010098
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0001329 ! opioid analgesic
created_by: slaulederkind
creation_date: 2024-04-01T14:11:43Z

[Term]
id: XCO:0001331
name: pregestational maternal exposure to oxycodone
def: "This is any condition in which the main influencing factor is any pregestational maternal exposure to oxycodone. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F1 offspring." [https://www.merriam-webster.com/]
synonym: "maternal exposure to oxycodone prior to a pregnancy" EXACT []
synonym: "pregestational maternal exposure to 14-hydroxy-3-methoxy-17-methyl-4,5alpha-epoxymorphinan-6-one" EXACT []
xref: CHEBI:7852
xref: CID:5284603
xref: PMID:25839742
xref: PMID:33490084
relationship: part_of XCO:0001334 ! multigenerational maternal exposure to oxycodone
relationship: part_of XCO:0001335 ! transgenerational maternal exposure to oxycodone
created_by: slaulederkind
creation_date: 2024-04-01T15:32:46Z

[Term]
id: XCO:0001332
name: gestational maternal exposure to oxycodone
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to oxycodone. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "maternal exposure to oxycodone during pregnancy" EXACT []
xref: CHEBI:7852
xref: PMID:25839742
xref: PMID:33490084
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001334 ! multigenerational maternal exposure to oxycodone
relationship: part_of XCO:0001335 ! transgenerational maternal exposure to oxycodone
created_by: slaulederkind
creation_date: 2024-04-01T16:10:18Z

[Term]
id: XCO:0001333
name: maternal exposure to oxycodone during nursing
def: "This is any condition in which the main influencing factor is any maternal exposure to oxycodone during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure during the postnatal, preweaning period on the F1 offspring." [https://www.merriam-webster.com/]
synonym: "maternal exposure to oxycodone during nursing of offspring" EXACT []
xref: CHEBI:7852
xref: PMID:33490084
relationship: part_of XCO:0001334 ! multigenerational maternal exposure to oxycodone
relationship: part_of XCO:0001335 ! transgenerational maternal exposure to oxycodone
created_by: slaulederkind
creation_date: 2024-04-02T11:12:02Z

[Term]
id: XCO:0001334
name: multigenerational maternal exposure to oxycodone
def: "This is any condition in which the main influencing factor is any maternal exposure to oxycodone that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
xref: CHEBI:7852
xref: PMID:33490084
is_a: XCO:0001330 ! oxycodone
created_by: slaulederkind
creation_date: 2024-04-04T10:34:20Z

[Term]
id: XCO:0001335
name: transgenerational maternal exposure to oxycodone
def: "This is any condition in which the main influencing factor is any maternal exposure to oxycodone that has transgenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxycodone use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation." [https://www.merriam-webster.com, PMID:25839742]
xref: CHEBI:7852
xref: PMID:33490084
is_a: XCO:0001330 ! oxycodone
created_by: slaulederkind
creation_date: 2024-04-04T11:04:06Z

[Term]
id: XCO:0001336
name: enrofloxacin
def: "This is any condition in which the main influencing factor is enrofloxacin, an antibiotic and antineoplastic agent from the fluoroquinolone family used in veterinary medicine." [CID:71188]
synonym: "1-cyclopropyl-7-(4-ethylpiperazin-1-yl)-6-fluoro-4-oxo-1,4-dihydroquinoline-3-carboxylic acid" EXACT []
synonym: "Baytril" EXACT []
xref: CHEBI:35720
xref: MESH:D000077422
xref: PMID:34267212
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000483 ! antibacterial agent
created_by: slaulederkind
creation_date: 2024-04-05T10:35:00Z

[Term]
id: XCO:0001337
name: controlled enrofloxacin content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of enrofloxacin, in which the amount of enrofloxacin consumed is maintained at a specified level. Enrofloxacin is an antibiotic and antineoplastic agent from the fluoroquinolone family used in veterinary medicine." [CID:71188, https://www.merriam-webster.com]
synonym: "controlled Baytril content drinking water" EXACT []
xref: CHEBI:35720
xref: MESH:D000077422
xref: PMID:34267212
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001336 ! enrofloxacin
created_by: slaulederkind
creation_date: 2024-04-05T10:52:59Z

[Term]
id: XCO:0001338
name: human adipose-derived stromal cells
def: "This is any condition in which the main influencing factor is human, adipose-derived stromal cells, which are isolated from lipoaspirates from healthy adult donors. They are mesenchymal stem cells that can be expanded in culture" [PMID:35566725]
synonym: "adipose-derived mesenchymal stem cells" EXACT []
synonym: "adipose tissue mesenchymal stem cells" EXACT []
synonym: "ASC" EXACT []
synonym: "AT?MSCs" EXACT []
synonym: "human, adipose-derived stromal cells" EXACT []
synonym: "human ASC" EXACT []
synonym: "human PLA cells" EXACT []
synonym: "PLA cells" EXACT []
synonym: "processed lipoaspirate cells" EXACT []
is_a: XCO:0001393 ! human stem cells
created_by: slaulederkind
creation_date: 2024-04-08T13:22:27Z

[Term]
id: XCO:0001339
name: human serum
def: "This is any experimental condition in which the main influencing factor is human serum. Human serum is used in tissue engineering, transplantation and cell therapy applications, for the expansion of mesenchymal stem cells (MSC) from adipose tissue or bone marrow, ex vivo expansion of peripheral blood cells, etc." [https://en.wikipedia.org/wiki/Serum_(blood), https://www.sigmaaldrich.com/US/en/product/sigma/h4522]
synonym: "human blood plasma without the clotting factors" EXACT []
xref: MESH:D044967
xref: PMID:35566725
is_a: XCO:0000965 ! controlled in vitro cell condition
created_by: slaulederkind
creation_date: 2024-04-08T14:04:38Z

[Term]
id: XCO:0001340
name: human skin-derived ABCB5+ stromal cells
def: "This is any condition in which the main influencing factor is human, skin-derived ABCB5+ stromal cells, which are ABCB5-positive mesenchymal stem cells (MSCs) isolated from skin of healthy adult donors and can be expanded in culture. ABCB5+ MSCs are used in therapy for chronic wounds and other skin diseases." [https://www.gesundheitsindustrie-bw.de/en/article/news/innovative-stem-cell-therapy-chronic-wounds]
synonym: "ABCB5+ MSCs" EXACT []
synonym: "ABCB5-positive mesenchymal stem cells" EXACT []
synonym: "human, skin-derived ABCB5+ stromal cells" EXACT []
xref: PMID:35566725
is_a: XCO:0001393 ! human stem cells
created_by: slaulederkind
creation_date: 2024-04-08T14:45:47Z

[Term]
id: XCO:0001341
name: conditioned medium
def: "This is any condition in which the main influencing factor is cultured cell-conditioned medium, which consists of the liquid nutrient medium the cells are grown in plus soluble factors secreted by the cells." [PMID:30595826]
synonym: "conditioned culture medium" EXACT []
synonym: "cultured cell-conditioned medium" EXACT []
xref: PMID:35566725
is_a: XCO:0000965 ! controlled in vitro cell condition
created_by: slaulederkind
creation_date: 2024-04-08T16:41:42Z

[Term]
id: XCO:0001342
name: human, adipose-derived stromal cell-conditioned medium
def: "This is any condition in which the main influencing factor is human, adipose-derived stromal cell-conditioned medium, which consists of the liquid nutrient medium the cells are grown in plus soluble factors secreted by the cells." [PMID:30595826]
synonym: "human ASC-conditioned medium" EXACT []
synonym: "human PLA-conditioned medium" EXACT []
xref: PMID:35566725
is_a: XCO:0001341 ! conditioned medium
created_by: slaulederkind
creation_date: 2024-04-08T20:18:39Z

[Term]
id: XCO:0001343
name: human, skin-derived ABCB5+ MSC/THP-1-conditioned medium
def: "This is any condition in which the main influencing factor is a co-culture of human, skin-derived ABCB5+ stromal cells and THP-1-derived macrophage-conditioned medium, which consists of the liquid nutrient medium the cells are grown in plus soluble factors secreted by the cells." [PMID:30595826]
synonym: "ABCB5+-derived CoCM+" EXACT []
synonym: "ABCB5+ MSC/THP-1 conditioned medium" EXACT []
xref: PMID:35566725
is_a: XCO:0001341 ! conditioned medium
created_by: slaulederkind
creation_date: 2024-04-08T20:36:46Z

[Term]
id: XCO:0001344
name: Streptococcus pneumoniae 262
def: "This is any condition in which the main influencing factor is Streptococcus pneumoniae strain 262, a bacterium isolated from the sputum of a human male. This bacterial culture has applications in respiratory disease research. This strain is serotype 19 (Danish designation 19F)." [ATCC:49619]
synonym: "Streptococcus pneumoniae strain 262" EXACT []
synonym: "Streptococcus pneumoniae strain 262, serotype 19" EXACT []
synonym: "Streptococcus Pneumonia Serotype 19F" EXACT []
xref: PMID:35784337
is_a: XCO:0000476 ! Streptococcus pneumoniae
created_by: slaulederkind
creation_date: 2024-04-09T14:42:02Z

[Term]
id: XCO:0001345
name: splenic ultrasound neuromodulation
def: "This is any condition in which the main influencing factor is splenic stimulation via ultrasound, a method to noninvasively modulate neural signaling in the spleen." [PMID:35784337]
synonym: "splenic U/S neuromodulation" EXACT []
synonym: "splenic U/S stimulation" EXACT []
synonym: "splenic ultrasound stimulation" EXACT []
synonym: "ultrasound-induced neuromodulation of spleen" EXACT []
xref: PMID:30862827
is_a: XCO:0000520 ! neuromodulation
created_by: slaulederkind
creation_date: 2024-04-09T15:10:22Z

[Term]
id: XCO:0001346
name: enalaprilat
def: "This is any condition in which the main influencing factor is enalaprilat, the active metabolite of the orally available pro-drug enalapril. Used in the treatment of hypertension, heart failure, and nephropathies, enalapril is an ACE inhibitor that prevents Angiotensin Converting Enzyme (ACE) from transforming angiotensin I into angiotensin II. Enalaprilat is enalapril in which the ethyl ester group has been hydrolysed to the corresponding carboxylic acid." [CID:5462501]
synonym: "enalaprilat (anhydrous)" RELATED []
synonym: "enalaprilat dihydrate" RELATED []
synonym: "N-[(1S)-1-carboxy-3-phenylpropyl]-L-alanyl-L-proline" EXACT []
xref: CHEBI:4786
xref: CHEBI:59877
is_a: XCO:0000542 ! enalapril
created_by: slaulederkind
creation_date: 2024-04-12T12:43:11Z

[Term]
id: XCO:0001347
name: Compound 1
def: "This is any condition in which the main influencing factor is Compound 1, a bicyclic molecule (patented by Merck & Co., Inc.) that can have various substituents and is a soluble guanylate cyclase activator." [PatentNo:_US_9\,365\,574_B2]
xref: PMID:35085251
is_a: XCO:0000695 ! soluble guanylate cyclase activator
created_by: slaulederkind
creation_date: 2024-04-12T13:02:34Z

[Term]
id: XCO:0001348
name: controlled Compound 1 content diet
def: "This is any condition in which the main influencing factor is a controlled Compound 1 content diet, a regimen of solid food in which the amount of Compound 1 consumed is controlled. Coumpound 1 is a soluble guanylate cyclase activator." [https://www.merriam-webster.com, PatentNo:_US_9\,365\,574_B2]
xref: PMID:35085251
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0001347 ! Compound 1
created_by: slaulederkind
creation_date: 2024-04-12T13:13:10Z

[Term]
id: XCO:0001349
name: controlled enalapril content diet
def: "This is any condition in which the main influencing factor is a controlled enalapril content diet, a regimen of solid food in which the amount of enalapril consumed is controlled. Enalapril is a prodrug that is rapidly metabolized in the liver to enalaprilat, a potent, competitive inhibitor of angiotensin-converting enzyme (ACE)." [https://en.wikipedia.org/wiki/Enalapril, https://www.merriam-webster.com]
xref: CHEBI:4784
xref: PMID:35085251
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0000542 ! enalapril
created_by: slaulederkind
creation_date: 2024-04-12T13:28:02Z

[Term]
id: XCO:0001350
name: diallyl trisulfide
def: "This is any condition in which the main influencing factor is diallyl trisulfide, an organic trisulfide that is trisulfane in which both of the hydrogens are replaced by allyl groups. Diallyl trisulfide is a component of the essential oil of garlic and a major component of the traditional Chinese medicine allitridium. Diallyl trisulfide has multiple medicinal effects." [CHEBI:78492]
synonym: "DATS" EXACT []
synonym: "diallyltrisulfane" EXACT []
xref: CID:16315
xref: MESH:C042577
xref: PMID:35419300
is_a: XCO:0000140 ! vasodilator
is_a: XCO:0000160 ! receptor antagonist
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000482 ! antimicrobial agent
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000680 ! antilipemic agent
created_by: slaulederkind
creation_date: 2024-04-12T13:54:25Z

[Term]
id: XCO:0001352
name: controlled neomycin sulfate content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of neomycin sulfate, the sulfate salt form of neomycin, a broad spectrum aminoglycoside antibiotic derived from Streptomyces fradiae with antibacterial activity. Neomycin is an antibiotic complex consisting of 3 components: the two isomeric components B and C are the active components, and neomycin A is the minor component. Neomycin is a protein synthesis inhibitor and bacteriacidal agent." [CID:62403]
synonym: "CHEBI:31635" EXACT []
synonym: "PMID:32119089" EXACT []
synonym: "SID:483925982" EXACT []
is_a: XCO:0000163 ! controlled content drinking water
is_a: XCO:0001188 ! neomycin sulfate
created_by: slaulederkind
creation_date: 2024-04-15T11:11:20Z

[Term]
id: XCO:0001353
name: controlled metronidazole content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of metronidazole, a commonly used antibiotic, belonging to the nitroimidazole class of antibiotics. Metronidazole is frequently used to treat gastrointestinal infections and parasitic infections such as trichomoniasis, giardiasis, and amebiasis. The antiparasitic of properties of metronidazole set it apart from many other antibacterial drugs, allowing it to treat a wider variety of infections." [CID:4173]
synonym: "controlled 2-(2-methyl-5-nitro-1H-imidazol-1-yl)ethanol content drinking water" EXACT []
xref: CHEBI:6909
xref: MESH:D008795
is_a: XCO:0000163 ! controlled content drinking water
is_a: XCO:0001189 ! metronidazole
created_by: slaulederkind
creation_date: 2024-04-15T11:23:39Z

[Term]
id: XCO:0001354
name: vancomycin hydrochloride
def: "This is any condition in which the main influencing factor is vancomycin hydrochloride, the hydrochloride salt of vancomycin, a branched tricyclic glycosylated peptide used for the treatment of certain bacterial infections, such as infections caused by Clostridium difficile and Staphylococcus aureus." [CID:6420023]
xref: CHEBI:28001
xref: MESH:D014640
is_a: XCO:0000572 ! vancomycin
created_by: slaulederkind
creation_date: 2024-04-15T12:34:59Z

[Term]
id: XCO:0001355
name: controlled vancomycin hydrochloride content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of vancomycin hydrochloride, the hydrochloride salt of vancomycin, a branched tricyclic glycosylated peptide used for the treatment of certain bacterial infections, such as infections caused by Clostridium difficile and Staphylococcus aureus." [CID:6420023]
synonym: "CHEBI:28001" EXACT []
synonym: "MESH:D014640" EXACT []
is_a: XCO:0000163 ! controlled content drinking water
is_a: XCO:0001354 ! vancomycin hydrochloride
created_by: slaulederkind
creation_date: 2024-04-15T12:41:18Z

[Term]
id: XCO:0001356
name: ampicillin sodium
def: "This is any condition in which the main influencing factor is ampicillin sodium, the sodium salt form of ampicillin, a broad-spectrum semisynthetic derivative of aminopenicillin. Ampicillin sodium inhibits bacterial cell wall synthesis by binding to penicillin binding proteins, thereby inhibiting peptidoglycan synthesis, a critical component of the bacterial cell wall." [CID:23663979]
synonym: "PMID:33957990" EXACT []
synonym: "sodium 6beta-[(2R)-2-amino-2-phenylacetamido]-2,2-dimethylpenam-3alpha-carboxylate" EXACT []
xref: CHEBI:34535
is_a: XCO:0001187 ! ampicillin
created_by: slaulederkind
creation_date: 2024-04-15T12:48:57Z

[Term]
id: XCO:0001357
name: controlled ampicillin sodium content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of ampicillin sodium, the sodium salt form of ampicillin, a broad-spectrum semisynthetic derivative of aminopenicillin. Ampicillin sodium inhibits bacterial cell wall synthesis by binding to penicillin binding proteins, thereby inhibiting peptidoglycan synthesis, a critical component of the bacterial cell wall." [CID:23663979, https://www.merriam-webster.com/]
synonym: "controlled sodium 6beta-[(2R)-2-amino-2-phenylacetamido]-2,2-dimethylpenam-3alpha-carboxylate content drinking water" EXACT []
xref: CHEBI:34535
xref: PMID:33957990
is_a: XCO:0000163 ! controlled content drinking water
is_a: XCO:0001356 ! ampicillin sodium
created_by: slaulederkind
creation_date: 2024-04-15T12:52:59Z

[Term]
id: XCO:0001358
name: fecal transplantation
def: "This is any condition in which the main influencing factor is fecal transplantation, a clinical or experimental procedure to collect feces from a donor and introduce them into a recipient's gastrointestinal tract. In patients the procedure can be used to control an infection of Clostridium difficile (C. diff)." [https://en.wikipedia.org/wiki/Fecal_microbiota_transplant, https://www.hopkinsmedicine.org/health/treatment-tests-and-therapies/fecal-transplant]
synonym: "fecal microbial transplantation" EXACT []
synonym: "fecal microbiota transplantation" EXACT []
synonym: "fecal transplant" EXACT []
synonym: "FMT" EXACT []
synonym: "stool transplantation" EXACT []
is_a: XCO:0000761 ! biologics and probiotics
created_by: slaulederkind
creation_date: 2024-04-15T13:42:58Z

[Term]
id: XCO:0001359
name: fecal transplantation from DHEA-treated donor
def: "This is any condition in which the main influencing factor is fecal transplantation from a DHEA (dehydroepiandrosterone)-treated donor, an experimental procedure to collect feces from a DHEA-treated donor and introduce them into a recipient's gastrointestinal tract. This procedure is used to investigate gut dysbiosis in various conditions, including cancer and polycystic ovary syndrome." [https://www.hopkinsmedicine.org/health/treatment-tests-and-therapies/fecal-transplant, PMID:33957990]
synonym: "fecal microbial transplantation from DHEA-treated donor" EXACT []
synonym: "fecal microbiota transplantation from DHEA-treated donor" EXACT []
synonym: "fecal transplant from DHEA-treated donor" EXACT []
synonym: "FMT from DHEA-treated donor" EXACT []
is_a: XCO:0001358 ! fecal transplantation
created_by: slaulederkind
creation_date: 2024-04-15T14:04:09Z

[Term]
id: XCO:0001360
name: fecal transplantation from control donor
def: "This is any condition in which the main influencing factor is fecal transplantation from a control donor, an experimental procedure to collect feces from a control donor and introduce them into a recipient's gastrointestinal tract. This procedure is used to investigate gut dysbiosis in various conditions, including cancer and polycystic ovary syndrome." [https://www.hopkinsmedicine.org/health/treatment-tests-and-therapies/fecal-transplant, PMID:33957990]
synonym: "fecal microbial transplantation from control donor" EXACT []
synonym: "fecal microbiota transplantation from control donor" EXACT []
synonym: "fecal transplant from control donor" EXACT []
synonym: "FMT from DHEA-treated donor" EXACT []
is_a: XCO:0001358 ! fecal transplantation
created_by: slaulederkind
creation_date: 2024-04-15T14:16:05Z

[Term]
id: XCO:0001361
name: pulmonary artery occlusion sham procedure
def: "This is any condition in which the main influencing factor is a pulmonary artery occlusion sham procedure, which follows the same surgical process as a pulmonary artery occlusion without blocking the pulmonary artery." [PMID:33064565]
synonym: "(Sham) PAB" EXACT []
synonym: "pulmonary artery sham banding" EXACT []
synonym: "pulmonary artery sham ligation" EXACT []
synonym: "sham PAB" EXACT []
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001305 ! pulmonary artery occlusion
created_by: slaulederkind
creation_date: 2024-04-16T14:35:03Z

[Term]
id: XCO:0001362
name: experimental post-traumatic osteoarthritis of the knee joint
def: "This is any condition in which the main influencing factor is experimental post-traumatic osteoarthritis (PTOA) of the knee joint. This model of PTOA is initiated in rodents by axial compression overload of the joint to the point of ACL (anterior cruciate ligament) rupture." [ISBN-13:9780781733908, PMID:27235904]
synonym: "experimental PTOA of knee" EXACT []
xref: PMID:32778777
xref: PMID:37425196
is_a: XCO:0001100 ! physical manipulation
created_by: slaulederkind
creation_date: 2024-04-19T13:27:38Z

[Term]
id: XCO:0001363
name: CGS 21680-filled liposomes
def: "This is any condition in which the main influencing factor is CGS 21680-filled liposomes, artificial vesicles composed of one or more concentric phospholipid bilayers and containing CGS 21680 hydrochloride. CGS 21680 is an adenosine A2a receptor (Adora2a) agonist." [PMID:32778777]
synonym: "CGS 21680-containing liposomes" EXACT []
synonym: "CGS21680-filled liposomes" EXACT []
synonym: "CGS 21680 liposomes" EXACT []
synonym: "Lipo-CGS" EXACT []
xref: https://www.tocris.com/products/cgs-21680-hydrochloride_1063
is_a: XCO:0000780 ! liposomes
created_by: slaulederkind
creation_date: 2024-04-19T16:21:25Z

[Term]
id: XCO:0001364
name: isoliensinine
def: "This is any condition in which the main influencing factor is isoliensinine, a bisbenzylisoquinoline alkaloid isolated from the lotus plant (Nelumbo nucifera Gaertn). Isoliensinine is claimed to have antitumor, cardioprotective, antioxidant, antidepressant, and anti-HIV properties." [https://en.wikipedia.org/wiki/Nelumbo_nucifera, PMID:33967765]
synonym: "(1R)-1-[[4-hydroxy-3-[[(1R)-6-methoxy-1-[(4-methoxyphenyl)methyl]-2-methyl-3,4-dihydro-1H-isoquinolin-7-yl]oxy]phenyl]methyl]-6-methoxy-2-methyl-3,4-dihydro-1H-isoquinolin-7-ol" EXACT []
xref: CHEBI:185701
xref: MESH:C499779
xref: PMID:37701045
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000561 ! antidepressant
created_by: slaulederkind
creation_date: 2024-04-19T16:58:30Z

[Term]
id: XCO:0001365
name: consumption
def: "This is any condition in which the main influencing factor is diet-like consumption, the act or process of consuming food, drink, or other substance by way of an oral route into the body." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
xref: NCIT:C19706
xref: NCIT:C20134
is_a: XCO:0000000 ! experimental condition
created_by: slaulederkind
creation_date: 2024-04-19T18:10:27Z

[Term]
id: XCO:0001366
name: DMEM/F-12
def: "This is any condition in which the main influencing factor is DMEM/F-12, a widely used basal medium for supporting the growth of many different mammalian cells. DMEM/F-12 is a 1:1 mixture of DMEM and Ham's F-12. This formulation combines DMEM's high concentrations of glucose, amino acids, and vitamins with F-12's wide variety of components. DMEM/F-12 uses a sodium bicarbonate buffer system and therefore requires a 5?10% CO2 environment to maintain physiological pH." [https://www.merriam-webster.com/, https://www.thermofisher.com/order/catalog/product/11320033?SID=srch-srp-11320033]
synonym: "DMEM/F12" EXACT []
synonym: "DMEM/Ham's F-12" EXACT []
synonym: "Dulbecco's Modified Eagle Medium/Nutrient Mixture F-12" EXACT []
xref: PMID:35030322
relationship: has_component XCO:0000988 ! Dulbecco's Modified Eagle's Medium
created_by: slaulederkind
creation_date: 2024-04-22T16:52:52Z

[Term]
id: XCO:0001367
name: medial meniscus transection
def: "This is any condition in which the main influencing factor is medial meniscus transection, a model of osteoarthritis (OA) in the laboratory rat. The procedure involves transection of the medial collateral ligament, incision of the synovial membrane, and full transsection of the medial meniscus so as to form anterior and posterior halves of the meniscus." [https://www.merriam-webster.com/, PMID:36354073]
synonym: "medial meniscal transection" EXACT []
synonym: "MMT" EXACT []
xref: PMID:32963278
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2024-04-22T18:11:16Z

[Term]
id: XCO:0001368
name: medial meniscus transection sham procedure
def: "This is any condition in which the main influencing factor is a medial meniscus transection sham procedure, which follows the same surgical process as a medial meniscus transection without cutting the medial meniscus." [https://www.merriam-webster.com/, PMID:36354073]
synonym: "medial meniscal transection sham procedure" EXACT []
synonym: "MMT sham procedure" EXACT []
xref: PMID:32963278
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001367 ! medial meniscus transection
created_by: slaulederkind
creation_date: 2024-04-22T18:33:41Z

[Term]
id: XCO:0001369
name: exosomes
def: "This is any condition in which the main influencing factor is exosomes, a subset (~30–150 nm diameter) of extracellular vesicles (EVs) generated by all cells from the endosomal compartment. Exosomes may carry nucleic acids, proteins, lipids, and metabolites." [PMID:32029601, PMID:40214483]
synonym: "EVs of endosomal origin" EXACT []
synonym: "extracellular vesicles of endosomal origin" EXACT []
xref: PMID:37478186
is_a: XCO:0000761 ! biologics and probiotics
created_by: slaulederkind
creation_date: 2024-04-25T13:56:16Z

[Term]
id: XCO:0001370
name: Ancr/E7-exosomes
def: "This is any condition in which the main influencing factor is Ancr/E7-modified exosomes, which are exosomes generated from Lamp2b-E7 transfected host cells, collected, and electroporated with lncRNA-ANCR. The experimental purpose of delivery of Ancr/E7-exosomes is blood vessel anticalcification." [PMID:37478186]
synonym: "Ancr/E7-EXO" EXACT []
synonym: "Ancr/E7-modified exosomes" EXACT []
xref: PMID:32029601
is_a: XCO:0001369 ! exosomes
created_by: slaulederkind
creation_date: 2024-04-25T14:35:39Z

[Term]
id: XCO:0001371
name: Ancr/E7 exosome-modified TEBV implantation
def: "This is any condition in which the main influencing factor is Ancr/E7 exosome-modified TEBV implantation, which is the replacement of a blood vessel with a tissue-engineered blood vessel incorporating Ancr/E7 exosomes." [PMID:37478186]
synonym: "Ancr/E7 exosome-modified tissue-engineered blood vessel implantation" EXACT []
synonym: "PMID:32029601" EXACT []
xref: PMID:23181145
is_a: XCO:0000027 ! surgical implantation
created_by: slaulederkind
creation_date: 2024-04-25T15:01:50Z

[Term]
id: XCO:0001372
name: TEBV implantation sham procedure
def: "This is any condition in which the main influencing factor is TEBV implantation sham surgery, which follows the same surgical process as a TEBV implantation without the replacement of a blood vessel with a tissue-engineered blood vessel." [https://www.merriam-webster.com/, PMID:37478186]
synonym: "TEBV implantation sham surgery" EXACT []
synonym: "tissue-engineered blood vessel implantation sham surgery" EXACT []
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001371 ! Ancr/E7 exosome-modified TEBV implantation
created_by: slaulederkind
creation_date: 2024-04-25T15:15:43Z

[Term]
id: XCO:0001373
name: surgical nerve transection
def: "This is any condition in which the main influencing factor is transection of some specific nerve, usually performed on a laboratory animal to study peripheral nerve injury." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "surgical transection of nerve" EXACT []
xref: PMID:37660072
xref: PMID:37946211
is_a: XCO:0000373 ! surgical denervation
created_by: slaulederkind
creation_date: 2024-04-26T13:43:46Z

[Term]
id: XCO:0001374
name: spared nerve injury
def: "This is any condition in which the main influencing factor is spared nerve injury, a model of neuropathic pain in rodents. The model consists of ligation/transection of the common peroneal and tibial nerves (two of the three branches of the sciatic nerve), while the sural nerve (third branch of the sciatic nerve) is left intact. This allows mechanical allodynia to be measured on the surface of the ipsilateral paw." [PMID:21876524]
synonym: "SNI" EXACT []
synonym: "SNI model" EXACT []
synonym: "spared nerve injury model" EXACT []
xref: PMID:37660072
is_a: XCO:0001373 ! surgical nerve transection
created_by: slaulederkind
creation_date: 2024-04-26T14:06:48Z

[Term]
id: XCO:0001375
name: spared nerve injury sham procedure
def: "This is any condition in which the main influencing factor is spared nerve injury sham surgery, which follows the same surgical process as a spared nerve injury without the ligation/transection of the common peroneal and tibial nerves." [PMID:21876524]
synonym: "SNI sham surgery" EXACT []
synonym: "spared nerve injury sham surgery" EXACT []
xref: PMID:37660072
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001374 ! spared nerve injury
created_by: slaulederkind
creation_date: 2024-04-26T14:23:02Z

[Term]
id: XCO:0001376
name: experimental spinal cord transection at T10/T11
def: "This is any condition in which the main influencing factor is an experimental transection of the rat spinal cord at the vertebral level of thoracic 10/11 (T10/11). This procedure involves laminectomy of the tenth vertebra and complete transection of the isolated section of spinal cord." [ISBN-13:9780781733908, PMID:37744239]
synonym: "experimental SSCI" EXACT []
synonym: "experimental suprasacral spinal cord injury" EXACT []
is_a: XCO:0001091 ! experimental spinal cord injury
created_by: slaulederkind
creation_date: 2024-04-29T15:57:35Z

[Term]
id: XCO:0001377
name: experimental spinal cord transection at T10/T11 sham procedure
def: "This is any condition in which the main influencing factor is an experimental spinal cord transection sham procedure at T10/T11, which follows the same surgical process through laminectomy, but no spinal cord transection occurs." [ISBN-13:9780781733908, PMID:37744239]
synonym: "experimental spinal cord transection at T10/T11 sham surgery" EXACT []
synonym: "sham SSCI" EXACT []
synonym: "sham suprasacral spinal cord injury" EXACT []
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001376 ! experimental spinal cord transection at T10/T11
created_by: slaulederkind
creation_date: 2024-04-29T16:09:31Z

[Term]
id: XCO:0001378
name: silicon dioxide nanoparticle
def: "This is any condition in which the main influencing factor is a silicon dioxide nanoparticle with a size between 1 and 100 nanometers composed of silicon dioxide. Silicon dioxide is a silicon oxide made up of linear triatomic molecules in which a silicon atom is covalently bonded to two oxygens." [CHEBI:30563, CHEBI:50828]
synonym: "silica nanoparticle" EXACT []
synonym: "SiNP" EXACT []
xref: CID:24261
xref: MESH:D012822
is_a: XCO:0000338 ! chemical nanoparticle
is_a: XCO:0001098 ! crystalline silica
created_by: slaulederkind
creation_date: 2024-05-23T17:06:47Z

[Term]
id: XCO:0001379
name: 4,4'-diaminodiphenylmethane
def: "This is any condition in which the main influencing factor is 4,4'-diaminodiphenylmethane, an aromatic amine that is diphenylmethane substituted at the 4-position of each benzene ring by an amino group." []
synonym: "4,4'-methylenebisbenzenamine" EXACT []
synonym: "4,4'-methylene dianiline" EXACT []
synonym: "4,4'-methylenedianiline" EXACT []
xref: CAS:101-77-9
xref: MESH:C009505
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2024-05-24T13:40:14Z

[Term]
id: XCO:0001380
name: metyrapone
def: "This is any condition in which the main influencing factor is metyrapone, an aromatic ketone that is 3,3-dimethylbutan-2-one in which the methyl groups at positions 1 and 4 are replaced by pyridin-3-yl groups. It is a steroid 11beta-monooxygenase (Cyp11b1) inhibitor used in a test of the feedback hypothalamic-pituitary mechanism for the diagnosis of adrenal insufficiency." [CHEBI:44241, MESH:D008797]
synonym: "1-Propanone, 2-methyl-1,2-di-3-pyridinyl-" EXACT []
synonym: "MET" EXACT []
synonym: "methbipyranone" EXACT []
synonym: "methopyrapone" EXACT []
synonym: "metopirone" EXACT []
xref: CAS:54-36-4
xref: CID:4174
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2024-05-24T14:12:37Z

[Term]
id: XCO:0001381
name: multigenerational maternal exposure to metyrapone
def: "This is any condition in which the main influencing factor is any maternal exposure to metyrapone that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) metyrapone use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to MET" EXACT []
synonym: "multigenerational maternal exposure to methbipyranone" EXACT []
synonym: "multigenerational maternal exposure to methopyrapone" EXACT []
synonym: "multigenerational maternal exposure to metopirone" EXACT []
xref: CHEBI:44241
xref: PMID:38007547
is_a: XCO:0001380 ! metyrapone
created_by: slaulederkind
creation_date: 2024-05-24T14:25:03Z

[Term]
id: XCO:0001382
name: gestational maternal exposure to metyrapone
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to metyrapone. This is a condition typically studied to determine the effect of maternal (F0) metyrapone use/exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "gestational maternal exposure to MET" EXACT []
synonym: "maternal exposure to MET during pregnancy" EXACT []
synonym: "maternal exposure to metyrapone during pregnancy" EXACT []
xref: CHEBI:44241
xref: PMID:25839742
xref: PMID:38007547
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001381 ! multigenerational maternal exposure to metyrapone
created_by: slaulederkind
creation_date: 2024-05-24T14:40:41Z

[Term]
id: XCO:0001383
name: multigenerational maternal exposure to lipopolysaccharide
def: "This is any condition in which the main influencing factor is any maternal exposure to lipopolysaccharide that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) lipopolysaccharide use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "multigenerational maternal exposure to LPS" EXACT []
xref: CHEBI:16412
xref: PMID:38007547
is_a: XCO:0000738 ! lipopolysaccharide
created_by: slaulederkind
creation_date: 2024-05-24T14:51:07Z

[Term]
id: XCO:0001384
name: gestational maternal exposure to lipopolysaccharide
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to lipopolysaccharide. This is a condition typically studied to determine the effect of maternal (F0) lipopolysaccharide use/exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "gestational maternal exposure to LPS" EXACT []
synonym: "maternal exposure to lipopolysaccharide during pregnancy" EXACT []
synonym: "maternal exposure to LPS during pregnancy" EXACT []
xref: CHEBI:16412
xref: PMID:38007547
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001383 ! multigenerational maternal exposure to lipopolysaccharide
created_by: slaulederkind
creation_date: 2024-05-24T15:10:20Z

[Term]
id: XCO:0001385
name: multigenerational maternal exposure to saline
def: "This is any condition in which the main influencing factor is any maternal exposure to saline that has multigenerational effects. This is a vehicle control condition typically studied to control for any effect of maternal (F0) saline (vehicle) use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "multigenerational maternal exposure to 0.9% sodium chloride solution" EXACT []
synonym: "multigenerational maternal exposure to normal saline" EXACT []
xref: PMID:38007547
is_a: XCO:0000156 ! 0.9% sodium chloride solution
created_by: slaulederkind
creation_date: 2024-05-28T15:18:30Z

[Term]
id: XCO:0001386
name: gestational maternal exposure to saline
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to saline. This is a vehicle control condition typically studied to determine any effect of maternal (F0) saline (vehicle) use/exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "gestational maternal exposure to 0.9% sodium chloride solution" EXACT []
synonym: "gestational maternal exposure to normal saline" EXACT []
xref: PMID:38007547
is_a: XCO:0000101 ! vehicle control condition
is_a: XCO:0000420 ! controlled in utero environment
is_a: XCO:0001385 ! multigenerational maternal exposure to saline
created_by: slaulederkind
creation_date: 2024-05-28T15:26:32Z

[Term]
id: XCO:0001387
name: testosterone propionate
def: "This is any condition in which the main influencing factor is testosterone propionate, a testosterone ester and a relatively short-acting prodrug of testosterone in the human body. Testosterone propionate is a synthetic androstane steroid derivative of testosterone in the form of 17beta propionate ester of testosterone." [CID:5995, https://en.wikipedia.org/wiki/Testosterone_propionate]
synonym: "propionyltestosterone" EXACT []
synonym: "testosterone 17beta-propanoate" EXACT []
synonym: "testosterone propanoate" EXACT []
synonym: "TP" EXACT []
xref: PMID:38273331
relationship: has_component XCO:0000204 ! testosterone
created_by: slaulederkind
creation_date: 2024-05-28T16:28:21Z

[Term]
id: XCO:0001388
name: IFA-CII emulsion
def: "This is any condition in which the major influencing factor is an IFA-CII emulsion, a combination of the oil-based incomplete Freud's adjuvant and acetic acid-soluble type II collagen (usually bovine). IFA induces a predominantly Th2-biased inflammatory response through the formation of a depot at the injection site and the stimulation of antibody producing plasma cells." [https://www.invivogen.com/ifa, https://www.merriam-webster.com/]
synonym: "incomplete Freud's adjuvant -type II collagen emulsion" EXACT []
is_a: XCO:0000281 ! type II collagen
relationship: has_component XCO:0000265 ! Freund's incomplete adjuvant
created_by: slaulederkind
creation_date: 2024-05-28T17:12:55Z

[Term]
id: XCO:0001389
name: methylcellulose 400
def: "This is any condition in which the main influencing factor is methylcellulose 400, an aqueous solution of methylcellulose with a dynamic viscosity of 400 centipoise (cP). Methylcellulose is a methylester of cellulose used as an emulsifying and suspending agent in cosmetics, pharmaceuticals and the chemical industry. It is used therapeutically as a bulk laxative." [https://en.wikipedia.org/wiki/Poise_(unit), https://www.rheosense.com/basics/viscosity-units]
synonym: "methyl cellulose 400" EXACT []
synonym: "methylcellulose 400 solution" EXACT []
is_a: XCO:0000789 ! methylcellulose
created_by: slaulederkind
creation_date: 2024-05-31T18:55:30Z

[Term]
id: XCO:0001390
name: CGG hydrogel implantation
def: "This is any condition in which the main influencing factor is implantation of a CGG hydrogel, a biomimetic hydrogel composed of gelatin and chitosan networks covalently cross-linked by genipin. Additional components added to these gel scaffolds are intended to increase mechanical performance and the migration, proliferation, and osteodifferentiation of endogenous mesenchymal stem cells (MSCs). Hydrogel implants are one of many methods used in bone tissue engineering." [PMID:38284176]
synonym: "CGG hydrogel scaffold implantation" EXACT []
synonym: "genipin cross-linked biomimetic hydrogel implantation" EXACT []
xref: PMID:32752105
is_a: XCO:0001439 ! bone tissue engineering scaffold implantation
created_by: slaulederkind
creation_date: 2024-06-03T13:49:46Z

[Term]
id: XCO:0001391
name: CGG-Cit hydrogel implantation
def: "This is any condition in which the main influencing factor is implantation of a CGG-Cit hydrogel, a citrate (Cit)-coordinated CGG hydrogel composed of gelatin and chitosan networks covalently cross-linked by genipin and coordinated with sodium citrate (Na3Cit). Sodium citrate used in the formation of these gel scaffolds increase mechanical performance and the migration, proliferation, and osteodifferentiation of endogenous mesenchymal stem cells (MSCs)." [PMID:38284176]
synonym: "CGG-Cit hydrogel scaffold implantation" EXACT []
synonym: "CGG-citrate hydrogel implantation" EXACT []
synonym: "citrate-based hydrogel implantation" EXACT []
synonym: "Na3Cit-coordinated CGG hydrogel implantation" EXACT []
xref: PMID:32752105
is_a: XCO:0001390 ! CGG hydrogel implantation
created_by: slaulederkind
creation_date: 2024-06-03T14:14:56Z

[Term]
id: XCO:0001392
name: human placenta-derived mesenchymal stem cells
def: "This is any condition in which the main influencing factor is human, placenta-derived mesenchymal stem cells, which are isolated from various parts of the placenta from healthy maternal donors. They are mesenchymal stem cells that can be expanded in culture and are intermediate in characteristics between bone marrow-derived mesenchymal stem cells (BM-MSCs) and embryonic stem cells (ESCs)." [DOI:10.1002/adtp.202200054]
synonym: "human placentalmesenchymal stem/stromal cells" EXACT []
synonym: "human PMSCs" EXACT []
synonym: "PMSCs" EXACT []
xref: PMID:35566725
is_a: XCO:0001393 ! human stem cells
created_by: slaulederkind
creation_date: 2024-06-06T12:41:23Z

[Term]
id: XCO:0001393
name: human stem cells
def: "This is a condition in which the main influencing factor is a human stem cell, an unspecialized cell capable of perpetuating itself through cell division and having the potential to give rise to a variety of differentiated cells with specialized functions." [CL:0000034, https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "Not4Curation" RELATED []
synonym: "PMID:37722965" EXACT []
is_a: XCO:0000851 ! stem cells
created_by: slaulederkind
creation_date: 2024-06-06T12:54:44Z

[Term]
id: XCO:0001394
name: osteotomy
def: "This is any condition in which the main influencing factor is osteotomy, a surgical cutting of bone. Osteotomy may be used clinically to correct an orthopedic defect or experimentally to study fracture healing." [https://my.clevelandclinic.org/health/articles/22688-osteotomy, PMID:35882120]
synonym: "surgical bone-cutting" EXACT []
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2024-06-07T15:15:46Z

[Term]
id: XCO:0001395
name: diaphyseal resection
def: "This is any condition in which the main influencing factor is a diaphyseal resection, which is the surgical removal of a length of bone from the diaphysis, the section of a long bone between the two epiphyses." [https://www.merriam-webster.com/, PMID:35882120]
synonym: "diaphysis resection" EXACT []
synonym: "resection of diaphysis" EXACT []
is_a: XCO:0000026 ! surgical removal
is_a: XCO:0001394 ! osteotomy
created_by: slaulederkind
creation_date: 2024-06-07T15:36:01Z

[Term]
id: XCO:0001396
name: transfer of circNrxn3 siRNA using jetPEI transfection reagent
def: "This is any condition in which the main influencing factor is circNrxn3 (a circular RNA originating from the neurexin 3 gene) siRNA transfected by jetPEI transfection reagent. JetPEI transfection reagent is a linear polyethylenimine derivative, designed for high throughput screening (HTS) in adherent and suspension cell cultures." [https://www.polyplus-sartorius.com/products/jetpei, PMID:38036039]
synonym: "transfection of circNrxn3 short interfering RNA using jetPEI transfection reagent" EXACT []
synonym: "transfection of circNrxn3 silencing RNA using jetPEI transfection reagent" EXACT []
synonym: "transfection of circNrxn3 siRNA using jetPEI transfection reagent" EXACT []
synonym: "transfection of circNrxn3 small interfering RNA using jetPEI transfection reagent" EXACT []
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulederkind
creation_date: 2024-06-10T15:20:19Z

[Term]
id: XCO:0001397
name: transfer of negative control siRNA using jetPEI transfection reagent
def: "This is any condition in which the main influencing factor is negative control siRNA delivered with jetPEI transfection reagent. Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences. JetPEI transfection reagent is a linear polyethylenimine derivative, designed for high throughput screening (HTS) in adherent and suspension cell cultures." [https://www.polyplus-sartorius.com/products/jetpei, PMID:38036039]
synonym: "transfection of negative control short interfering RNA using jetPEI transfection reagent" EXACT []
synonym: "transfection of negative control silencing RNA using jetPEI transfection reagent" EXACT []
synonym: "transfection of negative control siRNA using jetPEI transfection reagent" EXACT []
synonym: "transfection of negative control small interfering RNA using jetPEI transfection reagent" EXACT []
is_a: XCO:0001510 ! transfer of negative control siRNA
created_by: slaulederkind
creation_date: 2024-06-10T15:30:39Z

[Term]
id: XCO:0001398
name: phenylethanoid glycosides
def: "This is any condition in which the main influencing factor is phenylethanoid glycosides (PhGs), a class of natural glycosides containing hydroxy-methoxy-substituted phenylethyl and hydroxy-methoxy-substituted cinnamoyl groups, usually with central glucose as the parent core, and also an ester bond and oxygen glycoside bond. PhGs are obtained from a wide range of sources and show strong biological and pharmacological activities, such as antioxidant, antibacterial and neuroprotective effects." [PMID:35267401]
synonym: "PGC" NARROW []
synonym: "phenylethanoid glycosides of desert-living Cistanche" NARROW []
synonym: "PhGs" EXACT []
xref: PMID:37439895
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000850 ! therapeutic agent
created_by: slaulederkind
creation_date: 2024-06-10T16:07:10Z

[Term]
id: XCO:0001399
name: sevoflurane
def: "This is any condition in which the main influencing factor is sevoflurane, an ether compound having fluoromethyl and 1,1,1,3,3,3-hexafluoroisopropyl as the two alkyl groups. Sevoflurane is a non-explosive inhalation anesthetic used in the induction and maintenance of general anesthesia. It does not cause respiratory irritation and may also prevent platelet aggregation." [MESH:D000077149, XCO:0000088]
synonym: "1,1,1,3,3,3-Hexafluoro-2-(fluoromethoxy)propane" EXACT []
synonym: "fluoromethyl hexafluoroisopropyl ether" EXACT []
xref: CID:5206
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0001196 ! ethers
created_by: slaulederkind
creation_date: 2024-06-10T17:18:06Z

[Term]
id: XCO:0001400
name: desflurane
def: "This is any condition in which the main influencing factor is desflurane, an organofluorine compound that is an inhalation anaesthetic functionally related to methoxyethane." [CID:42113]
synonym: "2-(difluoromethoxy)-1,1,1,2-tetrafluoroethane" EXACT []
synonym: "difluoromethyl 1,2,2,2-tetrafluoroethyl ether" EXACT []
xref: CHEBI:4445
is_a: XCO:0000106 ! anesthetic/analgesic
created_by: slaulederkind
creation_date: 2024-06-10T17:37:14Z

[Term]
id: XCO:0001401
name: Xiaogu San
def: "This is any condition in which the main influencing factor is Xiaogu San, a multi-herbal composition (traditional chinese medicine formula) which contains components commonly prescribed in the treatment of pain and inflammation.." [PMID:34629040]
synonym: "XGS" EXACT []
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2024-06-11T15:21:30Z

[Term]
id: XCO:0001402
name: 21% O2, 79% N2
def: "This is a condition in which the level of oxygen (21%) and nitrogen (79%) in the air surrounding the organism or breathed by the organism is controlled as part of the experiment." [https://www.merriam-webster.com/, PMID:33230951]
synonym: "normoxia" EXACT []
xref: PMID:33230951
is_a: XCO:0000010 ! controlled air oxygen content
is_a: XCO:0001403 ! controlled air nitrogen content
created_by: slaulederkind
creation_date: 2024-06-11T16:27:54Z

[Term]
id: XCO:0001403
name: controlled air nitrogen content
def: "This is any condition in which the main influencing factor is controlled air nitrogen content surrounding an organism or breathed by the organism as part of the experiment." [https://www.merriam-webster.com/, PMID:33230951]
xref: PMID:33230951
is_a: XCO:0000009 ! controlled air content
created_by: slaulederkind
creation_date: 2024-06-11T16:33:00Z

[Term]
id: XCO:0001404
name: 42% O2, 58% N2
def: "This is a condition in which the level of oxygen (42%) and nitrogen (58%) in the air surrounding the organism or breathed by the organism is controlled as part of the experiment." [https://www.merriam-webster.com/, PMID:33230951]
xref: PMID:33230951
is_a: XCO:0000010 ! controlled air oxygen content
is_a: XCO:0001403 ! controlled air nitrogen content
created_by: slaulederkind
creation_date: 2024-06-11T16:39:06Z

[Term]
id: XCO:0001405
name: controlled atmospheric pressure
def: "This is any condition in which the main influencing factor is controlled atmospheric pressure, which involves controlling volume of the air, temperature of the air, and humidity of the air breathed. Controlled atmospheric pressure may be achieved by the use of a hypobaric or hyperbaric chamber." [https://www.dellamarca.it/en/what-and-how-the-pressure-chamber-works/#, https://www.merriam-webster.com/]
xref: PMID:33230951
is_a: XCO:0000998 ! controlled breathing condition
created_by: slaulederkind
creation_date: 2024-06-11T17:07:49Z

[Term]
id: XCO:0001406
name: hypobaric chamber
def: "This is any condition in which the main influencing factor is a hypobaric chamber, which lowers atmospheric pressure to simulate high altitude." [https://www.dellamarca.it/en/what-and-how-the-pressure-chamber-works/#, https://www.merriam-webster.com/]
synonym: "altitude chamber" EXACT []
synonym: "pressure chamber" EXACT []
is_a: XCO:0001405 ! controlled atmospheric pressure
created_by: slaulederkind
creation_date: 2024-06-11T17:23:50Z

[Term]
id: XCO:0001407
name: dextran sulfate sodium
def: "This is any condition in which the main influencing factor is dextran sulfate sodium, a synthetic sulfated polysaccharide with anticoagulant activity used in immunological research to induce colitis. Dextran polymer molecules with a molecular weight of 36-50 kDa are frequently used to produce colitis in rodents." [https://en.wikipedia.org/wiki/Dextran_sulphate_sodium]
synonym: "dextran sodium sulfate" EXACT []
synonym: "DSS" EXACT []
xref: CHEBI:191875
is_a: XCO:0001090 ! anticoagulant
relationship: has_component XCO:0000253 ! sodium ion
created_by: slaulederkind
creation_date: 2024-06-13T17:25:50Z

[Term]
id: XCO:0001408
name: controlled dextran sulfate sodium content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of dextran sulfate sodium, a synthetic, sulfated polysaccharide with anticoagulant activity used in immunological research to induce colitis." [https://en.wikipedia.org/wiki/Dextran_sulphate_sodium, https://www.merriam-webster.com/]
synonym: "controlled dextran sodium sulfate content drinking water" EXACT []
synonym: "controlled DSS content drinking water" EXACT []
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001407 ! dextran sulfate sodium
created_by: slaulederkind
creation_date: 2024-06-13T17:33:05Z

[Term]
id: XCO:0001409
name: tissue engineering scaffold implantation
def: "This is any condition in which the main influencing factor is implantation of an engineered tissue scaffold, an artificial construct which mimics the extracellular matrix of the host tissue. The scaffold may be made of natural or synthetic polymers, metal, or ceramic." [https://www.sciencedirect.com/science/article/pii/S2590238522002983, https://www.sciencedirect.com/topics/materials-science/scaffold-for-tissue-engineering]
synonym: "Not4Curation" RELATED []
xref: PMID:38654018
is_a: XCO:0000027 ! surgical implantation
created_by: slaulederkind
creation_date: 2024-06-14T15:41:14Z

[Term]
id: XCO:0001410
name: GelMA scaffold implantation
def: "This is any condition in which the main influencing factor is implantation of a gelatin-methacryloyl (GelMA) scaffold, a tissue scaffold made of methacrylated gelatin (collagen). GelMA has been widely utilized for diverse tissue engineering applications." [https://www.sciencedirect.com/science/article/pii/S2590238522002983, PMID:38654018]
synonym: "gelatin-methacryloyl scaffold implant" EXACT []
synonym: "GelMA scaffold implant" EXACT []
is_a: XCO:0001409 ! tissue engineering scaffold implantation
created_by: slaulederkind
creation_date: 2024-06-14T16:08:19Z

[Term]
id: XCO:0001411
name: CTS scaffold implantation
def: "This is any condition in which the main influencing factor is implantation of a porous chitosan (CTS) scaffold, a tissue scaffold made of macroporous chitosan hydrogel. Chitosan is a linear polysaccharide composed of randomly distributed β-(1→4)-linked D-glucosamine (deacetylated unit) and N-acetyl-D-glucosamine. Chitosan is attractive as a bone scaffold material because it supports the attachment and proliferation of osteoblasts as well as formation of mineralized bone matrix." [https://en.wikipedia.org/wiki/Chitosan, PMID:24999429]
synonym: "chitosan scaffold implant" EXACT []
synonym: "CTS scaffold implant" EXACT []
xref: PMID:38654018
is_a: XCO:0001439 ! bone tissue engineering scaffold implantation
created_by: slaulederkind
creation_date: 2024-06-14T16:51:04Z

[Term]
id: XCO:0001412
name: PLA scaffold implantation
def: "This is any condition in which the main influencing factor is implantation of a polylactic acid (PLA) scaffold, a tissue scaffold made of Poly(L-Lactic acid) in the form of a nanofiber membrane made by electrospinning. Electrospinning leads to membranes with relatively uniform pore size distribution with high interconnectivity of pores and significantly higher porosity, typically around 80%." [https://www.sciencedirect.com/science/article/pii/S0011916414005190, PMID:35582285]
synonym: "L-Lactide polymer scaffold implant" EXACT []
synonym: "PLA scaffold implant" EXACT []
synonym: "poly(L-Lactic acid) scaffold implant" EXACT []
synonym: "polylactic acid scaffold implant" EXACT []
is_a: XCO:0001409 ! tissue engineering scaffold implantation
created_by: slaulederkind
creation_date: 2024-06-14T17:25:28Z

[Term]
id: XCO:0001413
name: allisartan
def: "This is any condition in which the main influencing factor is allisartan, an orally potent, selective, non-peptide inhibitor of Angiotensin II Type 1 receptors. Allisartan is an antihypertensive agent that protects various organs from damage of high blood pressure." [https://www.medchemexpress.com/allisartan-isoproxil.html]
synonym: "allisartan isoproxil" EXACT []
xref: CAS:947331-05-7
xref: PMID:38590561
is_a: XCO:0000536 ! angiotensin II receptor antagonist
created_by: slaulederkind
creation_date: 2024-06-17T15:57:36Z

[Term]
id: XCO:0001414
name: Ramulus Mori alkaloids
def: "This is a condition in which the main influencing factor is Ramulus Mori alkaloids, a group of polyhydroxy alkaloids extracted and isolated from mulberry twig (Morus alba L.). Mulberry twig extract is used in traditional Chinese medicine (TCM) and is used against hyperglycemia and obesity." [PMID:37063280]
synonym: "Sangzhi alkaloids" EXACT []
synonym: "SZ-A" EXACT []
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2024-06-17T16:51:06Z

[Term]
id: XCO:0001415
name: double-distilled water
def: "This is any condition in which the main influencing factor is double distilled water, the secondary distillation of the water vapor of a prior distillation procedure. Double-distilled water (ddH2O) is traditionally considered the ‘most pure’ type of laboratory-grade water." [https://www.aatbio.com/resources/faq-frequently-asked-questions/What-are-the-differences-between-diH2O-dH2O-and-ddH2O]
synonym: "ddH2O" EXACT []
synonym: "doubly distilled water" EXACT []
xref: PMID:30479497
is_a: XCO:0000917 ! distilled water
created_by: slaulederkind
creation_date: 2024-06-18T16:39:23Z

[Term]
id: XCO:0001416
name: distilled deionized water
def: "This is any condition in which the main influencing factor is distilled, deionized water, a type of purified water that is sequentially distilled and deionized." [https://www.merriam-webster.com/, PMID:20549630]
synonym: "DDI H2O" EXACT []
synonym: "distilled deionized H2O" EXACT []
synonym: "Milli-Q system water" EXACT []
xref: PMID:31919777
is_a: XCO:0000917 ! distilled water
is_a: XCO:0001119 ! deionized water
created_by: slaulederkind
creation_date: 2024-06-18T17:07:08Z

[Term]
id: XCO:0001417
name: transgenerational maternal exposure to folic acid
def: "This is any condition in which the main influencing factor is any maternal exposure to folic acid that has transgenerational effects. This is a condition typically studied to determine the effect of maternal (F0) folic acid use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation." [https://www.merriam-webster.com/, PMID:25839742]
xref: CHEBI:7852
xref: PMID:31919777
is_a: XCO:0001113 ! folic acid
created_by: slaulederkind
creation_date: 2024-06-21T16:15:05Z

[Term]
id: XCO:0001418
name: transgenerational paternal exposure to folic acid
def: "This is any condition in which the main influencing factor is any paternal exposure to folic acid that has transgenerational effects. This is a condition typically studied to determine the effect of paternal (F0) folic acid use/exposure on the F2/F3 offspring by direct effects on the F1 generation via germ cell exposure. The paternal exposure may be any time after sexual maturity up to the time of copulation." [https://www.merriam-webster.com/, PMID:25839742]
xref: CHEBI:7852
xref: PMID:31919777
is_a: XCO:0001113 ! folic acid
created_by: slaulederkind
creation_date: 2024-06-21T16:54:45Z

[Term]
id: XCO:0001419
name: transgenerational maternal exposure to distilled deionized water
def: "This is any condition in which the main influencing factor is any maternal exposure to distilled, deionized water used as a vehicle control for transgenerational effects of some chemical. This is a condition typically studied to control for the effect of maternal (F0) chemical use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "transgenerational maternal exposure to distilled, deionized water" EXACT []
xref: CHEBI:7852
xref: PMID:31919777
is_a: XCO:0000101 ! vehicle control condition
is_a: XCO:0000420 ! controlled in utero environment
is_a: XCO:0001416 ! distilled deionized water
created_by: slaulederkind
creation_date: 2024-06-21T17:15:02Z

[Term]
id: XCO:0001420
name: transgenerational paternal exposure to distilled deionized water
def: "This is any condition in which the main influencing factor is any paternal exposure to distilled, deionized water used as a vehicle control for transgenerational effects of some chemical. This is a condition typically studied to determine the effect of paternal (F0) distilled, deionized water use/exposure on the F2/F3 offspring by direct effects on the F1 generation via germ cell exposure. The paternal exposure may be any time after sexual maturity up to the time of copulation." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "transgenerational paternal exposure to distilled, deionized water" EXACT []
xref: CHEBI:7852
xref: PMID:31919777
is_a: XCO:0000101 ! vehicle control condition
is_a: XCO:0001416 ! distilled deionized water
created_by: slaulederkind
creation_date: 2024-06-21T17:21:50Z

[Term]
id: XCO:0001421
name: liver transplant
def: "This is any condition in which the main influencing factor is a liver transplant, a surgical procedure in which a whole or partial liver from a donor organism is implanted into a recipient organism for the clinical purpose of replacing a diseased liver or for the experimental purpose of studying organ transplantation." [https://www.mayoclinic.org/tests-procedures/liver-transplant/about/pac-20384842, PMID:36426354]
synonym: "liver graft" NARROW []
synonym: "liver transplantion" EXACT []
is_a: XCO:0000248 ! kidney transplant
created_by: slaulederkind
creation_date: 2024-06-24T16:12:38Z

[Term]
id: XCO:0001422
name: allogeneic liver transplant
def: "This is any condition in which the main influencing factor is an allogeneic liver transplant, a surgical procedure in which a whole or partial liver from a donor organism is implanted into a genetically non-identical recipient organism of the same species for the clinical purpose of replacing a diseased liver or for the experimental purpose of studying organ transplantation." [https://en.wikipedia.org/wiki/Allotransplantation, PMID:36426354]
synonym: "allogeneic liver graft" NARROW []
synonym: "allogeneic liver transplantion" EXACT []
synonym: "liver allograft" EXACT []
synonym: "liver homograft" EXACT []
is_a: XCO:0001421 ! liver transplant
created_by: slaulederkind
creation_date: 2024-06-24T16:35:16Z

[Term]
id: XCO:0001423
name: syngeneic liver transplant
def: "This is any condition in which the main influencing factor is a syngeneic liver transplant, a surgical procedure in which a whole or partial liver from a donor organism is implanted into a genetically identical/nearly identical recipient organism of the same species for the clinical purpose of replacing a diseased liver or for the experimental purpose of studying organ transplantation." [https://www.merriam-webster.com, PMID:36426354]
synonym: "homogeneic liver transplant" EXACT []
synonym: "syngeneic liver graft" EXACT []
synonym: "syngeneic liver transplantion" EXACT []
is_a: XCO:0001421 ! liver transplant
created_by: slaulederkind
creation_date: 2024-06-24T16:43:24Z

[Term]
id: XCO:0001424
name: corneal de-epithelialization
def: "This is any condition in which the main influencing factor is corneal de-epithelialization, an experimental removal of the corneal epithelium of the eye for the purpose of studying the healing process related to clinical procedures like photorefractive keratectomy (PRK) and laser in situ keratomileusis (LASIK). The experimental corneal de-epithelialization may be achieved by mechanical means, or a combination of chemical and mechanical means." [https://corzaeye.com/catalogsearch/result/?q=+Sclerotome+Knife, PMID:26086898]
synonym: "cornea de-epithelialization" EXACT []
xref: PMID:23595375
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2024-06-27T14:03:53Z

[Term]
id: XCO:0001425
name: limbal resection
def: "This is any condition in which the main influencing factor is limbal resection, an experimental procedure which surgically removes the border between cornea and sclera of the eye. Limbal resection causes limbal stem cell deficiency (LSCD), which leads to failure of corneal repair, followed by neovascularization, and other pathologic sequelae." [https://en.wikipedia.org/wiki/Limbal_stem_cell, https://eyewiki.aao.org/Limbal_Stem_Cell_Deficiency]
synonym: "limbus resection" EXACT []
xref: GEO:GSE245468
xref: PMID:11900318
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2024-06-27T14:45:22Z

[Term]
id: XCO:0001426
name: albiflorin
def: "This is any condition in which the main influencing factor is albiflorin, a monoterpene glycoside with formula C23H28O11. Albiflorin is a plant metabolite found in various types of Peonies." [CHEBI:132793, CID:24868421]
synonym: "[(1R,3R,4R,6S,9S)-1-(beta-D-glucopyranosyloxy)-4-hydroxy-6-methyl-8-oxo-7-oxatricyclo[4.3.0.0(3,9)]nonan-9-yl]methyl benzoate" EXACT []
xref: PMID:34601221
is_a: XCO:0000511 ! ester
is_a: XCO:0000561 ! antidepressant
created_by: slaulederkind
creation_date: 2024-06-27T15:17:12Z

[Term]
id: XCO:0001427
name: Schwann cells
def: "This is a condition in which the main influencing factor is Schwann cells, glial cells that myelinate or ensheath axons in the peripheral nervous system. Some Schwann cells, repair (Bungner) Schwann cells, are only activated upon nerve injury." [CL:0002573, PMID:25957303]
xref: PMID:35091563
is_a: XCO:0000761 ! biologics and probiotics
created_by: slaulederkind
creation_date: 2024-06-28T16:23:06Z

[Term]
id: XCO:0001428
name: rat Schwann cell precursors
def: "This is a condition in which the main influencing factor is rat Schwann cell precursors, glioblasts that develop from migratory neural crest cells about embryonic day 12-14 (E12-E14) in the rat. The Schwann cell precursors are embedded among neurons (axons) with minimal extracellular space separating them from nerve cell membranes and have no basal lamina." [CL:0002375, PMID:25957303]
synonym: "rat SCPs" EXACT []
xref: PMID:35091563
relationship: part_of XCO:0001427 ! Schwann cells
created_by: slaulederkind
creation_date: 2024-06-28T17:04:46Z

[Term]
id: XCO:0001429
name: rat repair Schwann cells
def: "This is a condition in which the main influencing factor is rat repair Schwann cells, myelin cells that previously formed flattened sheaths around axons, then adopt an elongated bipolar morphology after nerve injury, allowing them to align to form a Schwann cell column named a Bungner band, which delineates the space in which the nerve regenerates." [PMID:25957303, UBERON:0001031]
synonym: "rat Bungner band cells" EXACT []
synonym: "rat RSCs" EXACT []
xref: PMID:35091563
is_a: XCO:0001427 ! Schwann cells
created_by: slaulederkind
creation_date: 2024-06-28T17:32:28Z

[Term]
id: XCO:0001430
name: sciatic nerve crush with decellularization
def: "This is any condition in which the main influencing factor is an experimentally controlled sciatic nerve crush and decellularization, which can be achieved by mechanical nerve crush followed by multiple freeze/thaw cycles using controlled application of liquid nitrogen and ambient thawing. This system is used as a model of sciatic neuropathy, Wallerian degeneration, and axonal regeneration." [https://en.wikipedia.org/wiki/Decellularization, PMID:35091563]
synonym: "ischiadic nerve crush with decellularization" EXACT []
xref: PMID:35768768
is_a: XCO:0001092 ! sciatic nerve crush
created_by: slaulederkind
creation_date: 2024-06-28T17:52:14Z

[Term]
id: XCO:0001431
name: CN-Patch implantation
def: "This is any condition in which the main influencing factor is implantation of a CN-Patch hydrogel, an injectable hydrogel designed for controlled release of CO (carbon monoxide) and NO (nitric oxide) into host soft tissue. Catechol-modified chitosan (Chi-C) and aldehyde dextran (Odex) are used as the basis of the hydrogel for viscosity and hemostatic effects. Gelatin nanoparticles, GSNO (S-Nitrosoglutathione), and CORM-3 (Ru(CO)3Cl(glycinate) ) are suspended/dissolved in the hydrogel to accomplish the release of CO and NO." [https://www.merriam-webster.com/, PMID:37105981]
synonym: "CN-Patch" EXACT []
synonym: "CN-Patch implant" EXACT []
xref: PMID:32118241
is_a: XCO:0001409 ! tissue engineering scaffold implantation
relationship: has_component XCO:0001411 ! CTS scaffold implantation
created_by: slaulederkind
creation_date: 2024-07-01T15:26:53Z

[Term]
id: XCO:0001432
name: single-pedicled skin flap
def: "This is any condition in which the main influencing factor is an autologous, single pedicled skin flap, skin flap in which the flap is still attached to the original blood supply by a single blood vessel. This type of skin flap is relevant in specific clinical situations and in experimental situations for the purpose of studying various factors affecting the success of skin grafts." [https://www.merriam-webster.com/, https://www.sciencedirect.com/topics/medicine-and-dentistry/pedicled-skin-flap]
synonym: "autologous pedicle flap" EXACT []
synonym: "autologous, single pedicled skin flap" EXACT []
xref: https://www.ncbi.nlm.nih.gov/books/NBK532874/
xref: PMID:37105981
is_a: XCO:0001053 ! surgical closure
created_by: slaulederkind
creation_date: 2024-07-01T16:51:16Z

[Term]
id: XCO:0001433
name: canagliflozin
def: "This is any condition in which the main influencing factor is canagliflozin, a glucoside-derived sodium/glucose cotransporter (Slc5a2) inhibitor used clinically to treat type 2 diabetes mellitus." [MESH:D000068896]
synonym: "(1S)-1,5-anhydro-1-(3-{[5-(4-fluorophenyl)-2-thienyl]methyl}-4-methylphenyl)-D-glucitol" EXACT []
synonym: "canagliflozin anhydrous" EXACT []
xref: CHEBI:73274
xref: CID:24812758
is_a: XCO:0000120 ! inhibitor
is_a: XCO:0000407 ! hypoglycemic agent
created_by: slaulederkind
creation_date: 2024-07-08T16:47:06Z

[Term]
id: XCO:0001434
name: parasite behavior in a Skinner box within a worker/parasite group feeding/reward paradigm
def: "This is any condition in which the main influencing factor is acting as a parasite in a group feeding/reward paradigm in a customized Skinner box, an experimental setup to designed to create parasite-worker social relationships between subjects. The parasite subjects eat most of the rewarded food, while the worker subject performs most of the required lever presses to earn the reward." [https://www.merriam-webster.com, PMID:34815341]
synonym: "parasite behavior in an operant conditioning chamber within a worker/parasite group feeding/reward paradigm" EXACT []
synonym: "parasitic behavior in an operant conditioning chamber within a worker/parasite group feeding/reward paradigm" EXACT []
synonym: "parasitic behavior in a Skinner box within a worker/parasite group feeding/reward paradigm" EXACT []
is_a: XCO:0000491 ! controlled exposure to an organism of the same species
created_by: slaulederkind
creation_date: 2024-07-18T16:15:18Z

[Term]
id: XCO:0001435
name: worker behavior in a Skinner box within a worker/parasite group feeding/reward paradigm
def: "This is any condition in which the main influencing factor is acting as a servant (worker) in a group feeding/reward paradigm in a customized Skinner box, an experimental setup to designed to create parasite-worker social relationships between subjects. The worker subject performs most of the required lever presses to earn a reward (food), while the parasite subjects eat most of the rewarded food." [https://www.merriam-webster.com, PMID:34815341]
synonym: "servant behavior in an operant conditioning chamber within a worker/parasite group feeding/reward paradigm" EXACT []
synonym: "servant behavior in a Skinner box within a worker/parasite group feeding/reward paradigm" EXACT []
synonym: "worker behavior in an operant conditioning chamber within a worker/parasite group feeding/reward paradigm" EXACT []
is_a: XCO:0000491 ! controlled exposure to an organism of the same species
created_by: slaulederkind
creation_date: 2024-07-18T16:35:53Z

[Term]
id: XCO:0001436
name: gastrointestinal bypass
def: "This is any condition in which the main influencing factor is gastrointestinal bypass, a type of surgery that either bypasses the stomach or part of the small intestine as a weight loss strategy. Gastrointestinal bypass is also an experimental procedure to study the surgery in model organisms like rats." [https://www.mayoclinic.org/tests-procedures/bariatric-surgery/about/pac-20394258]
synonym: "bariatric surgery" EXACT []
synonym: "metabolic surgery" EXACT []
synonym: "Not4Curation" RELATED []
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2024-07-23T16:41:03Z

[Term]
id: XCO:0001437
name: duodenal-jejunal bypass
def: "This is any condition in which the main influencing factor is a duodenal-jejunal bypass, a surgical procedure which involves transection of the duodenum proximally and transection of the jejunum distal to the ligament of Treitz. The distal end of the jejunum is anastomosed to the proximal end of the duodenum (duodenojejunal anastomosis), which creates the bypass of the duodenum and most of the jejunum. The biliopancreatic limb is anastomosed to the alimentary limb distal to the duodenojejunal anastomosis in a Roux-en-Y fashion to divert biliopancreatic juice to the ileum." [PMID:36726038, PMID:38983805]
synonym: "DJB" EXACT []
is_a: XCO:0001436 ! gastrointestinal bypass
created_by: slaulederkind
creation_date: 2024-07-30T17:25:20Z

[Term]
id: XCO:0001438
name: duodenal-jejunal bypass sham surgery
def: "This is any condition in which the main influencing factor is duodenal-jejunal bypass sham surgery, a surgical procedure which follows the same surgical process as duodenal-jejunal bypass surgery, but all intestinal transections are reanastomosed without any tissue repositioning." []
is_a: XCO:0001437 ! duodenal-jejunal bypass
created_by: slaulederkind
creation_date: 2024-08-05T12:42:55Z

[Term]
id: XCO:0001439
name: bone tissue engineering scaffold implantation
def: "This is any condition in which the main influencing factor is implantation of an engineered bone tissue scaffold, an artificial construct which mimics the extracellular matrix of the host tissue. Support of the attachment and proliferation of osteoblasts, formation of mineralized bone matrix, and osteodifferentiation of endogenous mesenchymal stem cells (MSCs) are some desired characteristics of these implants. Both synthetic and natural polymers may be a part of bone scaffolds." [https://www.sciencedirect.com/topics/materials-science/scaffold-for-tissue-engineering, PMID:24999429]
xref: PMID:36526019
is_a: XCO:0001409 ! tissue engineering scaffold implantation
created_by: slaulederkind
creation_date: 2024-08-06T16:37:23Z

[Term]
id: XCO:0001440
name: peptide hydrogel implantation
def: "This is any condition in which the main influencing factor is implantation of a peptide hydrogel, a hydrogel containing a self-assembling metal ion-chelating peptide (HPGIAQFF) . This peptide hydrogel serves as a control for the peptide hydrogel that contains chelated metal ions. Hydrogel implants are one of many methods used in bone tissue engineering." [https://www.sciencedirect.com/topics/materials-science/scaffold-for-tissue-engineering, PMID:36526019]
synonym: "implantation of self-assembling metal ion-chelating peptide hydrogel without metal ions" EXACT []
synonym: "PH implant" EXACT []
is_a: XCO:0001439 ! bone tissue engineering scaffold implantation
created_by: slaulederkind
creation_date: 2024-08-13T14:38:15Z

[Term]
id: XCO:0001441
name: processed pyritum hydrogel implantation
def: "This is any condition in which the main influencing factor is implantation of a metal ion-chelating peptide hydrogel, a hydrogel containing a self-assembling metal ion-chelating peptide (HPGIAQFF) with chelated metal ions (Fe2+, Cu2+, Zn2+, Mn2+, Mg2+, and Ca2) . The metal ions are derived from processed pyritum, a Chinese medicine derived from pyritum disulfide. Hydrogel implants are one of many methods used in bone tissue engineering." [https://www.sciencedirect.com/topics/materials-science/scaffold-for-tissue-engineering, PMID:36526019]
synonym: "implantation of self-assembling metal ion-chelating peptide hydrogel with metal ions" EXACT []
synonym: "PPH implant" EXACT []
relationship: has_component XCO:0001440 ! peptide hydrogel implantation
created_by: slaulederkind
creation_date: 2024-08-13T14:55:37Z

[Term]
id: XCO:0001442
name: experimental drill-hole bone defect sham procedure
def: "This is any condition in which the main influencing factor is an experimental drill-hole bone defect sham procedure, which follows the same surgical process through full tissue thickness incision, but no bone defect is made." [https://www.merriam-webster.com/, PMID:36526019]
synonym: "sham burr holing procedure" EXACT []
synonym: "sham trepanation" EXACT []
synonym: "sham trepanning" EXACT []
synonym: "sham trephination" EXACT []
xref: PMID:35849443
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001323 ! experimental drill-hole bone defect
created_by: slaulederkind
creation_date: 2024-08-13T15:09:14Z

[Term]
id: XCO:0001443
name: medial collateral ligament transection
def: "This is any condition in which the main influencing factor is medial collateral ligament transection, a process involving a surgical technique for complete transection of the medial collateral ligament to investigate ligament healing in an experimental animal model." [PMID:38597671]
synonym: "complete MCL tear" RELATED []
synonym: "MCL transection" EXACT []
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2024-09-05T15:06:23Z

[Term]
id: XCO:0001444
name: muscle layer pouch
def: "This is any condition in which the main influencing factor is an artificial pouch created by a surgical technique to cover a ligament wound with the adjacent muscle layer. The pouch may be used for delivery of drugs or other agents." [PMID:38597671]
synonym: "artificial muscle layer pouch" EXACT []
synonym: "surgical pouch" BROAD []
is_a: XCO:0000318 ! surgical construction
created_by: slaulederkind
creation_date: 2024-09-05T15:54:18Z

[Term]
id: XCO:0001445
name: TNF-primed human BM-MSC exosomes
def: "This is any condition in which the main influencing factor is exosomes from human, bone marrow-derived, mesenchymal stromal cells which have been primed with cytokine TNF-alpha." [PMID:38597671]
synonym: "TNFA-primed human BM-MSC exosomes" EXACT []
synonym: "tumor necrosis factor alpha-primed human BM-MSC exosomes" EXACT []
synonym: "tumor necrosis factor-primed human BM-MSC exosomes" EXACT []
is_a: XCO:0001369 ! exosomes
created_by: slaulederkind
creation_date: 2024-09-06T11:29:42Z

[Term]
id: XCO:0001446
name: CRX527-primed human BM-MSC exosomes
def: "This is any condition in which the main influencing factor is exosomes from human, bone marrow-derived, mesenchymal stromal cells which have been primed with the synthetic lipid A analog CRX-527. CRX-527 is a Toll-like receptor 4 (TLR4) agonist." [https://www.invivogen.com/crx527, PMID:38597671]
synonym: "CRX-527-primed human BM-MSC exosomes" EXACT []
synonym: "CRX527-primed human bone marrow-derived mesenchymal stromal cell exosomes" EXACT []
is_a: XCO:0001369 ! exosomes
created_by: slaulederkind
creation_date: 2024-09-06T11:44:43Z

[Term]
id: XCO:0001447
name: T9 spinal cord contusion sham procedure
def: "This is any condition in which the main influencing factor is a T9 spinal cord contusion sham procedure, which follows the same surgical process as a T9 spinal cord contusion procedure, but no contusion is generated. The sham procedure includes laminectomy of the ninth thoracic vertebra and exposure of the spinal cord." [PMID:38647358]
synonym: "T9 spinal cord contusion sham surgery" EXACT []
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001042 ! T9 spinal cord contusion
created_by: slaulederkind
creation_date: 2024-09-06T13:30:46Z

[Term]
id: XCO:0001448
name: fractional CO2 laser ablation of liver
def: "This is a condition in which the main influencing factor is fractional CO2 laser ablation of liver, an experimental procedure involving the creation of microinjuries in a restricted surface area of liver. This use of fractional ablation is an adaptation of a technique of dermal scar treatment. Access to liver surface requires laparotomy." [https://lumenis.com/aesthetics/products/ultrapulse/, PMID:38661043]
synonym: "fractional ablative CO2 laser treatment of liver" EXACT []
synonym: "fractional CO2 laser ablation of hepatic surface" EXACT []
synonym: "fractional CO2 laser ablative treatment of liver" EXACT []
is_a: XCO:0000165 ! surgical manipulation
created_by: slaulederkind
creation_date: 2024-09-09T17:42:47Z

[Term]
id: XCO:0001449
name: hepatotoxic chemical
def: "This is any condition in which the main influencing factor is a hepatotoxic chemical, a chemical that causes injury to or disease of the liver." [https://www.merriam-webster.com, ISBN-13:9780781733908]
synonym: "hepatotoxic agent" EXACT []
synonym: "hepatotoxicity-inducing chemical" EXACT []
synonym: "liver toxicity-inducing chemical" EXACT []
xref: PMID:38661043
is_a: XCO:0000259 ! disease-inducing chemical
created_by: slaulederkind
creation_date: 2024-09-10T11:20:09Z

[Term]
id: XCO:0001450
name: thioacetamide
def: "This is any condition in which the main influencing factor is thioacetamide, a thiocarboxamide consiting of acetamide having the oxygen replaced by sulfur. Thioacetamide is used to replicate the initiation and progression of human liver disease in laboratory rats." [CHEBI:32497, https://en.wikipedia.org/wiki/Thioacetamide]
synonym: "acetothioamide" EXACT []
synonym: "CID:2723949" EXACT []
synonym: "ethanethioamide" EXACT []
synonym: "thiacetamide" EXACT []
xref: MESH:D013853
is_a: XCO:0001449 ! hepatotoxic chemical
created_by: slaulederkind
creation_date: 2024-09-10T11:26:58Z

[Term]
id: XCO:0001451
name: diagnostic imaging agent
def: "This is any condition in which the main influencing factor is a diagnostic imaging agent, a substance administered to enhance contrast in images of the inside of the body obtained using X-rays, gamma-rays, sound waves, radio waves (MRI), or radioactive particles." [CHEBI:37334]
xref: PMID:38704728
is_a: XCO:0000358 ! diagnostic agent
created_by: slaulederkind
creation_date: 2024-09-10T16:53:48Z

[Term]
id: XCO:0001452
name: gadodiamide
def: "This is any condition in which the main influencing factor is gadodiamide, a gadolinium-based MRI contrast agent (GBCA), used in magnetic resonance imaging (MRI) procedures to assist in the visualization of blood vessels." [https://en.wikipedia.org/wiki/Gadodiamide]
synonym: "Omniscan" EXACT []
xref: CAS:131410-48-5
xref: CID:24847884
is_a: XCO:0000718 ! gadolinium-based contrast agent
created_by: slaulederkind
creation_date: 2024-09-10T17:17:56Z

[Term]
id: XCO:0001453
name: gene transfer of the VEGFC gene using an adenovirus vector
def: "This is any condition in which the main influencing factor is the vascular endothelial growth factor C gene (VEGFC) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [PMID:38704728]
synonym: "gene transfer of AAV2/9‐CMV‐rVEGF‐C" NARROW []
synonym: "gene transfer of the vascular endothelial growth factor C gene using an adenoviral vector" EXACT []
synonym: "gene transfer of the VEGFC gene using an adenoviral vector" EXACT []
synonym: "transduction of VEGFC using an adenoviral vector" EXACT []
synonym: "transduction of VEGFC using an adenovirus vector" EXACT []
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulederkind
creation_date: 2024-09-10T17:34:42Z

[Term]
id: XCO:0001454
name: gene transfer of the mNeonGreen gene using an adenovirus vector
def: "This is any condition in which the main influencing factor is the mNeonGreen gene (mNG) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism. This gene codes for a green/yellow fluorescent protein and is used as a control for studying the effects of some other gene." [https://www.fpbase.org/protein/mneongreen/]
synonym: "gene transfer of AAV2/9‐CMV‐mNeonGreen" NARROW []
synonym: "gene transfer of the mNeonGreen gene using an adenoviral vector" EXACT []
synonym: "gene transfer of the mNG gene using an adenoviral vector" EXACT []
synonym: "transduction of mNG using an adenoviral vector" EXACT []
synonym: "transduction of mNG using an adenovirus vector" EXACT []
xref: PMID:38704728
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulederkind
creation_date: 2024-09-10T17:48:16Z

[Term]
id: XCO:0001455
name: heroin
def: "This is any condition in which the main influencing factor is heroin, a morphinane alkaloid that is morphine bearing two acetyl substituents on the O-3 and O-6 positions. Heroin has a role as an opioid analgesic, a mu-opioid receptor agonist and a prodrug." [CHEBI:27808, CID:5462328]
synonym: "17-methyl-7,8-didehydro-4,5alpha-epoxymorphinan-3,6alpha-diyl diacetate" EXACT []
synonym: "Diacetylmorphine" EXACT []
synonym: "Diamorphine" EXACT []
xref: MESH:D003932
relationship: has_component XCO:0000610 ! morphine
created_by: slaulederkind
creation_date: 2024-09-12T14:02:42Z

[Term]
id: XCO:0001456
name: psilocybin
def: "This is any condition in which the main influencing factor is psilocybin, a naturally occurring psychedelic prodrug compound produced by more than 200 species of fungi. Psilocybin is quickly converted by the body to psilocin, a hallucinogen." [https://en.wikipedia.org/wiki/Psilocybin]
synonym: "3-[2-(dimethylamino)ethyl]-1H-indol-4-yl dihydrogen phosphate" EXACT []
synonym: "4-phosphoryloxy-N,N-dimethyltryptamine" EXACT []
synonym: "4-PO-DMT" EXACT []
synonym: "psilocybine" EXACT []
xref: CHEBI:8614
xref: CID:10624
is_a: XCO:0000135 ! receptor agonist
created_by: slaulederkind
creation_date: 2024-09-12T14:26:48Z

[Term]
id: XCO:0001457
name: ketanserin
def: "This is any condition in which the main influencing factor is ketanserin, a selective serotonin receptor antagonist with weak adrenergic receptor blocking properties. Ketanserin is effective in lowering blood pressure in essential hypertension and it also inhibits platelet aggregation." [MESH:D007650]
synonym: "3-{2-[4-(4-fluorobenzoyl)piperidin-1-yl]ethyl}quinazoline-2,4(1H,3H)-dione" EXACT []
xref: CHEBI:6123
xref: CID:3822
is_a: XCO:0000336 ! adrenergic antagonist
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulederkind
creation_date: 2024-09-12T14:49:25Z

[Term]
id: XCO:0001458
name: intracerebral hemorrhage induced by collagenase injection
def: "This is any condition in which the main influencing factor is experimental intracerebral hemorrhage induced by collagenase injection into the cerebrum, a method used to model intracerebral hemorrhage in laboratory animals. Severity of hemorrhage can be controlled by the amount of collagenase injected. For example 0.23 U of bacterial collagenase VII-S injected into rat striatum causes a moderate intracerebral hemorrhage, and 0.6 U of bacterial collagenase VII-S injected into rat striatum causes severe intracerebral hemorrhage." [https://www.merriam-webster.com, PMID:38927081]
synonym: "experimental ICH induced by collagenase injection" EXACT []
is_a: XCO:0000258 ! disease-inducing agent
created_by: slaulederkind
creation_date: 2024-09-16T14:35:52Z

[Term]
id: XCO:0001459
name: ethoxysanguinarine
def: "This is any condition in which the main influencing factor is ethoxysanguinarine, an activator of AMP-Activated Protein Kinase (AMPK). It possesses antibacterial and antiviral activities and offers therapeutic benefits for the treatment of respiratory syndrome virus-induced cytopathic effects." [PMID:31969821]
synonym: "14-ethoxy-13-methyl-13,14-dihydro-(1,3)dioxolo(4',5':4,5)benzo(1,2-c)(1,3)dioxolo(4,5-i)phenanthridine" EXACT []
synonym: "ETH" EXACT []
xref: CAS:28342-31-6
xref: CID:5317235
xref: MESH:C000729450
relationship: has_component XCO:0000733 ! sanguinarine
created_by: slaulederkind
creation_date: 2024-09-26T16:00:40Z

[Term]
id: XCO:0001460
name: glycerol
def: "This is any condition in which the main influencing factor is glycerol, a trihydroxy sugar alcohol that is an intermediate in carbohydrate and lipid metabolism. Glycerol is used as a solvent, emollient, pharmaceutical agent, and sweetening agent." [MESH:D005990]
synonym: "glycerin" EXACT []
synonym: "glycerine" EXACT []
xref: CHEBI:17754
xref: CID:753
is_a: XCO:0000323 ! alcohol
is_a: XCO:0001231 ! solvent
created_by: slaulederkind
creation_date: 2024-09-30T11:58:19Z

[Term]
id: XCO:0001461
name: controlled glycerol content saline
def: "This is any condition in which the main influencing factor is a specific amount of glycerol dissolved in saline (0.9% sodium chloride solution). Glycerol is a trihydroxy sugar alcohol that is used as a solvent, emollient, pharmaceutical agent, and sweetening agent." [MESH:D005990]
synonym: "controlled glycerin content saline" EXACT []
synonym: "controlled glycerine content saline" EXACT []
xref: CHEBI:17754
xref: CID:753
is_a: XCO:0000156 ! 0.9% sodium chloride solution
relationship: has_component XCO:0001460 ! glycerol
created_by: slaulederkind
creation_date: 2024-09-30T12:20:53Z

[Term]
id: XCO:0001462
name: thoracic aorta constriction sham procedure
def: "This is any condition in which the main influencing factor is a thoracic aortic constriction sham procedure, which follows the same surgical process as a thoracic aortic constriction without blocking the aorta." [PMID:39196177]
synonym: "aorta sham banding" BROAD []
synonym: "sham AOB" BROAD []
synonym: "thoracic aorta sham banding" EXACT []
synonym: "thoracic aorta sham ligation" EXACT []
synonym: "thoracic aortic constriction sham procedure" EXACT []
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0000598 ! thoracic aorta constriction
created_by: slaulederkind
creation_date: 2024-09-30T14:22:47Z

[Term]
id: XCO:0001463
name: hyperbaric chamber
def: "This is any condition in which the main influencing factor is a hyperbaric chamber, which raises atmospheric pressure to simulate atmospheric conditions below sea level or underwater. A hyperbaric chamber may use ambient air at high pressure (hyperbaric air) or air with high oxygen content at high pressure (hyperbaric oxygen therapy)." [https://en.wikipedia.org/wiki/Hyperbaric_medicine, PMID:39156650]
is_a: XCO:0001405 ! controlled atmospheric pressure
created_by: slaulederkind
creation_date: 2024-09-30T15:19:05Z

[Term]
id: XCO:0001464
name: citrate buffer
def: "This is any condition in which the main influencing factor is citrate buffer, a combination of sodium citrate dihydrate and citric acid in water to form a solution with a pH range of 3.0 to 6.2." [https://www.aatbio.com/resources/buffer-preparations-and-recipes/citrate-buffer-ph-3-to-6-2]
synonym: "sodium citrate buffer" EXACT []
xref: CHEBI:53258
xref: CID:6224
xref: https://en.wikipedia.org/wiki/Trisodium_citrate
is_a: XCO:0000315 ! buffer solution
relationship: has_component XCO:0001600 ! citrate salt
created_by: slaulederkind
creation_date: 2024-10-01T15:59:01Z

[Term]
id: XCO:0001465
name: ochratoxin A
def: "This is any condition in which the main influencing factor is ochratoxin A, a phenylalanine derivative that is a nephrotoxic, carcinogenic mycotoxin. Ochratoxin A is among the most widely occurring food-contaminating mycotoxins, produced by Aspergillus ochraceus, Aspergillus carbonarius and Penicillium verrucosum." [CHEBI:7719]
synonym: "N-{[(3R)-5-chloro-8-hydroxy-3-methyl-1-oxo-3,4-dihydro-1H-2-benzopyran-7-yl]carbonyl}-L-phenylalanine" EXACT []
synonym: "OTA" EXACT []
xref: CAS:303-47-9
xref: CID:442530
xref: MESH:C025589
xref: PMID:37162024
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000222 ! cation channel inhibitor
is_a: XCO:0001112 ! nephrotoxic chemical
created_by: slaulederkind
creation_date: 2024-10-11T10:36:42Z

[Term]
id: XCO:0001466
name: 3-chloro-1,2-propanediol
def: "This is any condition in which the main influencing factor is 3-chloro-1,2-propanediol, a chlorinated propanediol with antifertility activity in males used as a chemosterilant in rodents." [MESH:D000517]
synonym: "3-chloropropane-1,2-diol" EXACT []
synonym: "3-Chloropropanediol" EXACT []
synonym: "3-MCPD" EXACT []
synonym: "3-Monochloropropane-1,2-diol" EXACT []
synonym: "alpha-Chlorohydrin" EXACT []
xref: CAS:96-24-2
xref: CHEBI:18721
xref: CID:7290
xref: PMID:37162024
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2024-10-11T11:04:52Z

[Term]
id: XCO:0001467
name: controlled 3-chloro-1,2-propanediol content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of 3-chloro-1,2-propanediol, a chlorinated propanediol with antifertility activity in males used as a chemosterilant in rodents." [https://www.merriam-webster.com, MESH:D000517]
synonym: "controlled 3-chloropropane-1,2-diol content drinking water" EXACT []
synonym: "controlled 3-Chloropropanediol content drinking water" EXACT []
synonym: "controlled 3-MCPD content drinking water" EXACT []
xref: CHEBI:18721
xref: PMID:37162024
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001466 ! 3-chloro-1,2-propanediol
created_by: slaulederkind
creation_date: 2024-10-11T11:13:45Z

[Term]
id: XCO:0001468
name: minocycline
def: "This is any condition in which the main influencing factor is minocycline, a semi-synthetic second-generation tetracycline and a broad-spectrum antibiotic. Minocycline has a dimethylamino group at position 7 and lacks the methyl and hydroxy groups at position 5, which makes it effective against tetracycline-resistant staphylococcus infections." [CID:54675783, NBK:554519]
synonym: "minomycin" EXACT []
xref: CHEBI:50694
xref: GEO:GSE261833
xref: MESH:D008911
is_a: XCO:0000483 ! antibacterial agent
is_a: XCO:0000672 ! tetracyclines
created_by: slaulederkind
creation_date: 2024-10-11T14:41:45Z

[Term]
id: XCO:0001469
name: iron trichloride
def: "This is any condition in which the main influencing factor is iron trichloride, a iron coordination entity that has the formula FeCl3(H2O)x." [CHEBI:30808, https://en.wikipedia.org/wiki/Iron(III)_chloride]
synonym: "ferric chloride" EXACT []
synonym: "iron(3+) chloride" EXACT []
synonym: "iron(III) chloride" EXACT []
synonym: "trichloroiron" EXACT []
xref: CID:24380
xref: MESH:C024555
is_a: XCO:0001549 ! inorganic chloride
created_by: slaulederkind
creation_date: 2024-11-04T14:12:23Z

[Term]
id: XCO:0001470
name: hmSi-CREKA-RB-PFH nanoparticle
def: "This is any condition in which the main influencing factor is hmSi-CREKA-RB-PFH nanoparticles, nanoparticles based on hollow mesoporous silica (hmSi), coated with CREKA (the fibrin-targeting peptide Cys-Arg-Glu-Lys-Ala), and filled with sonosensitizer RB (Rose Bengal) and phase transition molecular PFH (perfluorohexane). These particles are combined with the action of ultrasound in sonodynamic therapy (SDT) of thrombus." [PMID:39098904]
synonym: "hmSi-CREKA-RB-PFH" EXACT []
synonym: "hmSi-CREKA-RB-PFH nanoparticles" EXACT []
xref: GEO:GSE254810
xref: PMID:33987928
is_a: XCO:0000338 ! chemical nanoparticle
created_by: slaulederkind
creation_date: 2024-11-04T15:22:22Z

[Term]
id: XCO:0001471
name: ultrasound
def: "This is any condition in which the main influencing factor is ultrasound, a technique used in both medical diagnostics and therapeutics. As a therapeutic method, it allows non-invasive means to treat tumors, thrombi, various neurodegenerative diseases, and other medical issues." [https://www.merriam-webster.com, ISBN-13:9780781733908]
synonym: "sonography" EXACT []
synonym: "ultrasonography" EXACT []
xref: PMID:39098904
is_a: XCO:0000000 ! experimental condition
created_by: slaulederkind
creation_date: 2024-11-04T17:00:39Z

[Term]
id: XCO:0001472
name: alectinib
def: "This is any condition in which the main influencing factor is alectinib, an organic heterotetracyclic compound, a member of morpholines, a member of piperidines, a nitrile and an aromatic ketone. Alectinib is an antineoplastic inhibitor of the receptor tyrosine kinase ALK (anaplastic lymphoma kinase). It is used to treat ALK-positive NSCLC (non-small cell lung cancer)." []
synonym: "9-ethyl-6,6-dimethyl-8-[4-(morpholin-4-yl)piperidin-1-yl]-11-oxo-6,11-dihydro-5H-benzo[b]carbazole-3-carbonitrile" EXACT []
synonym: "Alecensa" NARROW []
synonym: "alectinib hydrochloride" NARROW []
xref: CHEBI:90936
xref: MESH:C582670
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulederkind
creation_date: 2024-11-07T10:17:30Z

[Term]
id: XCO:0001473
name: cerebral artery perforation
def: "This is any condition in which the main influencing factor is cerebral artery perforation, a controlled surgical procedure which perforates the cerebral artery near the junction of the anterior and middle cerebral arteries with a blunt, nylon monofilament passed through the internal carotid artery. The resultant bleeding is a model of subarachnoid hemorrhage (SAH)." [PMID:39233827]
synonym: "cerebral artery rupture" RELATED []
synonym: "iatrogenic arterial perforation" NARROW []
is_a: XCO:0000812 ! controlled hemorrhage
created_by: slaulederkind
creation_date: 2024-12-02T15:59:50Z

[Term]
id: XCO:0001474
name: cerebral artery perforation sham procedure
def: "This is any condition in which the main influencing factor is a cerebral artery perforation sham procedure, which follows the same surgical process as a cerebral artery perforation procedure, but no perforation is generated. The sham procedure includes surgical exposure of the carotid artery and passage of a blunt, nylon monofilament through the internal carotid artery to the junction of the anterior and middle cerebral arteries." [PMID:39233827]
synonym: "cerebral artery sham perforation" EXACT []
is_a: XCO:0001473 ! cerebral artery perforation
created_by: slaulederkind
creation_date: 2024-12-02T16:13:49Z

[Term]
id: XCO:0001475
name: Banxia Xiexin decoction
def: "This is any condition in which the main influencing factor is Banxia Xiexin decoction, an anti-inflammatory, anticancer, and antioxidative drug of traditional Chinese medicine (TCM). Banxia Xiexin decoction has been used to treat stress-induced gastric ulceration (SIGU) and many other gastrointestinal diseases. Banxia Xiexin decoction is a combination of seven different herbal medicines." [https://www.google.com, PMID:38499261]
synonym: "BXD" EXACT []
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulederkind
creation_date: 2024-12-03T14:37:20Z

[Term]
id: XCO:0001476
name: 8-aminoguanine
def: "This is any condition in which the main influencing factor is 8-aminoguanine, a naturally occurring purine that is produced from precursors containing 8-nitroguanine. 8-aminoguanine has effects on urine volume, sodium excretion, glucose excretion, and the metabolome influencing inflammation in the context of metabolic syndrome." [PMID:39349636]
synonym: "6H-Purin-6-one, 2,8-diamino-1,7-dihydro-" EXACT []
synonym: "8-AG" EXACT []
xref: CAS:28128-41-8
xref: CID:135421887
xref: MESH:C033495
xref: PMID:38765984
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000863 ! antihypertensive agent
created_by: slaulederkind
creation_date: 2024-12-05T16:27:20Z

[Term]
id: XCO:0001477
name: controlled 8-aminoguanine content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of 8-aminoguanine, a naturally occurring purine that is produced from precursors containing 8-nitroguanine, consumed by a subject." [https://www.merriam-webster.com/, PMID:39349636]
synonym: "controlled 6H-Purin-6-one, 2,8-diamino-1,7-dihydro- content drinking water" EXACT []
synonym: "controlled 8-AG content drinking water" EXACT []
xref: CAS:28128-41-8
xref: CID:135421887
xref: MESH:C033495
xref: PMID:38765984
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001476 ! 8-aminoguanine
created_by: slaulederkind
creation_date: 2024-12-05T16:41:34Z

[Term]
id: XCO:0001478
name: controlled ex vivo liver condition
def: "This is an experimental condition in which the internal or external environment of a liver is manipulated or regulated, for example through perfusion, increased or decreased blood flow, temperature, etc. after removal from the body." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "controlled isolated liver condition" EXACT []
xref: PMID:36982476
is_a: XCO:0000464 ! controlled ex vivo organ condition
created_by: slaulederkind
creation_date: 2024-12-05T17:49:12Z

[Term]
id: XCO:0001479
name: controlled ex vivo liver perfusion
def: "This is an experimental condition consisting of perfusion (recirculated or single pass) of the isolated liver with some physiological buffer (consisting of controlled solute composition and specific flow rate) through the liver portal vein and/or hepatic artery.." [ISBN-13:9780781733908, PMID:36982476]
synonym: "controlled isolated liver perfusion" EXACT []
synonym: "HMP of liver" NARROW []
synonym: "hypothermic machine perfusion of ex vivo liver" NARROW []
xref: PMID:36982476
is_a: XCO:0001478 ! controlled ex vivo liver condition
created_by: slaulederkind
creation_date: 2024-12-05T17:59:35Z

[Term]
id: XCO:0001480
name: histidine-tryptophan-ketoglutarate solution
def: "This is any condition in which the main influencing factor is histidine-tryptophan-ketoglutarate (HTK) solution, a cardioplegic solution used in open heart surgery that is increasingly being used as a preservation solution for kidneys. in HTK tryptophan serves as a membrane stabilizer and antioxidant, ketoglutarate acts as a substrate for anaerobic metabolism during preservation and histidine serves as a pH-buffering component." [https://www.sciencedirect.com/topics/medicine-and-dentistry/histidine-tryptophan-ketoglutarate]
synonym: "Custodiol HTK" NARROW []
synonym: "Histidine-tryptophan-ketoglutarate" EXACT []
synonym: "HTK" EXACT []
xref: PMID:36982476
is_a: XCO:0000315 ! buffer solution
created_by: slaulederkind
creation_date: 2024-12-09T16:25:11Z

[Term]
id: XCO:0001481
name: ex vivo ischemic liver condition
def: "This is any condition in which the main influencing factor is ischemia of an ex vivo liver, a liver that has been removed from an organism, but not oxygenated by perfusion or other means." [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "ex vivo ischemia condition" BROAD []
is_a: XCO:0001478 ! controlled ex vivo liver condition
created_by: slaulederkind
creation_date: 2024-12-09T16:54:14Z

[Term]
id: XCO:0001482
name: controlled, oxygenated ex vivo liver perfusion
def: "This is any condition in which the main influencing factor is perfusion (recirculated or single pass) of isolated liver with some oxygenated, physiological buffer (consisting of controlled solute composition and specific flow rate) through the hepatic portal vein." [ISBN-13:978-1455756438, PMID:36982476]
synonym: "HOPE" NARROW []
synonym: "hypothermic, oxygenated ex vivo liver perfusion" NARROW []
is_a: XCO:0001479 ! controlled ex vivo liver perfusion
created_by: slaulederkind
creation_date: 2024-12-09T17:16:29Z

[Term]
id: XCO:0001483
name: controlled in situ liver condition
def: "This is any condition in which the main influencing factor is the experimental manipulation of the internal or external environment of the liver, for example through perfusion, increased or decreased blood flow, etc. without removal from the body." [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
xref: PMID:36982476
is_a: XCO:0000166 ! controlled in situ organ condition
created_by: slaulederkind
creation_date: 2024-12-10T17:01:47Z

[Term]
id: XCO:0001484
name: in situ ischemic liver condition
def: "This is any condition in which the main influencing factor is ischemia of an in situ liver, a liver that remains in the organism at normal body temperature, but not oxygenated by natural circulation, perfusion, or other means." [ISBN-13:978-1455756438, PMID:36982476]
is_a: XCO:0001483 ! controlled in situ liver condition
created_by: slaulederkind
creation_date: 2024-12-10T17:15:02Z

[Term]
id: XCO:0001485
name: L4/L5 spinous process resection
def: "This is any condition in which the main influencing factor is L4/L5 spinous process resection, an experimental procedure done to induce lumbar spine mechanical instability (LSI) in laboratory animals. The process involves removing the spinous processes along with the supraspinous and interspinous ligaments from lumbar vertebrae L4 and L5." [https://www.merriam-webster.com/, PMID:38982049]
synonym: "surgical removal of L4/L5 spinous processes" EXACT []
relationship: part_of XCO:0001043 ! laminectomy
created_by: slaulederkind
creation_date: 2024-12-12T14:31:41Z

[Term]
id: XCO:0001486
name: L4/L5 spinous process resection sham procedure
def: "This is any condition in which the main influencing factor is L4/L5 spinous process sham resection, which follows the same surgical process through the posterior paravertebral muscle and other soft tissue detachment from the L4-L5 vertebrae, but no spinous process resection occurs." [https://www.merriam-webster.com/, PMID:38982049]
synonym: "L4/L5 spinous process resection sham surgery" EXACT []
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001485 ! L4/L5 spinous process resection
created_by: slaulederkind
creation_date: 2024-12-12T14:50:06Z

[Term]
id: XCO:0001487
name: kainic acid
def: "This is any condition in which the main influencing factor is kainic acid, a dicarboxylic acid, a pyrrolidinecarboxylic acid, a L-proline derivative and a non-proteinogenic L-alpha-amino acid. It has a role as an antinematodal drug and an excitatory amino acid agonist. Like many excitatory amino acid agonists it can cause neurotoxicity. Kainic acid is used to cause neurotoxicity and seizures in laboratory animals." [CID:10255]
synonym: "(3S,4R)-3-(carboxymethyl)-4-(prop-1-en-2-yl)-L-proline" EXACT []
synonym: "Digenic acid" EXACT []
synonym: "digenin" RELATED []
synonym: "kainate" EXACT []
xref: CHEBI:31746
xref: MESH:D007608
is_a: XCO:0000119 ! amino acid
is_a: XCO:0000886 ! epilepsy-inducing chemical
created_by: slaulederkind
creation_date: 2024-12-16T12:09:47Z

[Term]
id: XCO:0001488
name: myclobutanil
def: "This is any condition in which the main influencing factor is myclobutanil, a widely-used agricultural triazole fungicide. Myclobutanil may cause developmental toxicity and male reproductive toxicity." [CID:6336, PMID:32268158]
synonym: "rac-2-(4-chlorophenyl)-2-(1H-1,2,4-triazol-1-ylmethyl)hexanenitrile" EXACT []
xref: CHEBI:75281
is_a: XCO:0001489 ! antifungal agent
created_by: slaulederkind
creation_date: 2024-12-16T13:27:39Z

[Term]
id: XCO:0001489
name: antifungal agent
def: "This is any condition in which the main influencing factor is an antifungal agent, a substance or other entity that kills or slows the growth of fungi." [https://www.merriam-webster.com/]
synonym: "antifungal" EXACT []
synonym: "fungicidal agent" NARROW []
synonym: "fungistatic agent" NARROW []
is_a: XCO:0000482 ! antimicrobial agent
created_by: slaulederkind
creation_date: 2024-12-16T13:34:36Z

[Term]
id: XCO:0001490
name: lysergic acid diethylamide
def: "This is any condition in which the main influencing factor is lysergic acid diethylamide, a semisynthetic derivative of ergot (Claviceps purpurea) that has complex effects on both peripheral and central nervous system serotonergic receptors. Lysergic acid diethylamide is a potent hallucinogen." [MESH:D008238]
synonym: "(8R)-9,10-didehydro-N,N-diethyl-6-methylergoline-8-carboxamide" EXACT []
synonym: "Delysid" NARROW []
synonym: "D-Lsd" EXACT []
synonym: "D-Lysergic acid diethylamide" EXACT []
synonym: "LAD" EXACT []
synonym: "LSD" EXACT []
synonym: "LSD-25" EXACT []
synonym: "LSD tartrate" NARROW []
synonym: "Lysergide" EXACT []
xref: CHEBI:6605
xref: CID:5761
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0001122 ! antianxiety agent
created_by: slaulederkind
creation_date: 2024-12-16T14:01:14Z

[Term]
id: XCO:0001491
name: calycosin
def: "This is any condition in which the main influencing factor is calycosin, a 7-hydroxyisoflavone that functions as an antioxidant." [CID:5280448]
synonym: "3',7-dihydroxy-4'-methoxyisoflavone" EXACT []
synonym: "7,3'-dihydroxy-4'-methoxyisoflavone" EXACT []
synonym: "7-hydroxy-3-(3-hydroxy-4-methoxyphenyl)-4H-chromen-4-one" EXACT []
xref: CHEBI:17793
xref: MESH:C121707
is_a: XCO:0000271 ! antioxidant
created_by: slaulederkind
creation_date: 2024-12-16T14:24:34Z

[Term]
id: XCO:0001492
name: 17alpha-ethynylestradiol
def: "This is any condition in which the main influencing factor is 17alpha-ethynylestradiol, a semisynthetic alkylated estradiol with a 17-alpha-ethinyl substitution. It has high estrogenic potency when administered orally, and is often used as the estrogenic component in combination with progestogen in oral contraceptives." [CID:5991, MESH:D004997]
synonym: "17alpha-ethynylestra-1,3,5(10)-triene-3,17beta-diol" EXACT []
synonym: "ethinyl estradiol" EXACT []
synonym: "ethynylestradiol" EXACT []
xref: CHEBI:4903
is_a: XCO:0000092 ! 17 beta-estradiol
created_by: slaulederkind
creation_date: 2024-12-17T14:47:20Z

[Term]
id: XCO:0001493
name: multigenerational maternal exposure to 17alpha-ethynylestradiol
def: "This is any condition in which the main influencing factor is any maternal exposure to 17alpha-ethynylestradiol that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) 17alpha-ethynylestradiol use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to 17alpha-ethynylestra-1,3,5(10)-triene-3,17beta-diol" EXACT []
synonym: "multigenerational maternal exposure to ethinyl estradiol" EXACT []
synonym: "multigenerational maternal exposure to ethynylestradiol" EXACT []
xref: PMID:33296240
is_a: XCO:0001492 ! 17alpha-ethynylestradiol
created_by: slaulederkind
creation_date: 2024-12-17T16:05:28Z

[Term]
id: XCO:0001494
name: multigenerational maternal exposure to bisphenol A
def: "This is any condition in which the main influencing factor is any maternal exposure to bisphenol A that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) bisphenol A use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "multigenerational maternal exposure to BPA" EXACT []
xref: PMID:33296240
is_a: XCO:0000397 ! bisphenol A
created_by: slaulederkind
creation_date: 2024-12-17T16:05:44Z

[Term]
id: XCO:0001495
name: multigenerational maternal exposure to sodium carboxymethylcellulose
def: "This is any condition in which the main influencing factor is any maternal exposure to sodium carboxymethylcellulose that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) sodium carboxymethylcellulose use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "multigenerational maternal exposure to carboxymethylcellulose sodium" EXACT []
synonym: "multigenerational maternal exposure to carboxymethylcellulose sodium salt" EXACT []
synonym: "multigenerational maternal exposure to carmellose sodium" EXACT []
synonym: "multigenerational maternal exposure to CMC-Na" EXACT []
xref: CHEBI:85146
xref: CID:6328154
xref: MESH:D002266
is_a: XCO:0001282 ! sodium carboxymethylcellulose
created_by: slaulederkind
creation_date: 2024-12-17T16:05:51Z

[Term]
id: XCO:0001496
name: gestational maternal exposure to 17alpha-ethynylestradiol
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to 17alpha-ethynylestradiol. This is a condition typically studied to determine the effect of maternal (F0) 17alpha-ethynylestradiol use/exposure on the F1 offspring" [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "gestational maternal exposure to 17alpha-ethynylestra-1,3,5(10)-triene-3,17beta-diol" EXACT []
synonym: "gestational maternal exposure to ethinyl estradiol" EXACT []
synonym: "gestational maternal exposure to ethynylestradiol" EXACT []
xref: PMID:33296240
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001493 ! multigenerational maternal exposure to 17alpha-ethynylestradiol
created_by: slaulederkind
creation_date: 2024-12-17T16:20:57Z

[Term]
id: XCO:0001497
name: gestational maternal exposure to bisphenol A
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to bisphenol A. This is a condition typically studied to determine the effect of maternal (F0) bisphenol A use/exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "gestational maternal exposure to BPA" EXACT []
xref: PMID:33296240
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001494 ! multigenerational maternal exposure to bisphenol A
created_by: slaulederkind
creation_date: 2024-12-17T16:21:42Z

[Term]
id: XCO:0001498
name: gestational maternal exposure to sodium carboxymethylcellulose
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to sodium carboxymethylcellulose. This is a condition typically studied to determine the effect of maternal (F0) sodium carboxymethylcellulose use/exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "gestational maternal exposure to carboxymethylcellulose sodium" EXACT []
synonym: "gestational maternal exposure to carboxymethylcellulose sodium salt" EXACT []
synonym: "gestational maternal exposure to carmellose sodium" EXACT []
synonym: "gestational maternal exposure to CMC-Na" EXACT []
xref: CHEBI:85146
xref: CID:6328154
xref: MESH:D002266
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001495 ! multigenerational maternal exposure to sodium carboxymethylcellulose
created_by: slaulederkind
creation_date: 2024-12-17T16:22:14Z

[Term]
id: XCO:0001499
name: inferior vena cava ligation
def: "This is any condition in which the main influencing factor is surgical narrowing of the lumen of the inferior vena cava by suture ligation, typically done caudal of the renal veins for establishing a model of deep vein thrombosis (DVT). Typically, side branches of the IVC caudal to the renal veins are fully ligated in this DVT model." [PMID:37664678]
synonym: "IVC ligation" EXACT []
is_a: XCO:0000596 ! blood vessel constriction
created_by: slaulederkind
creation_date: 2024-12-19T14:01:43Z

[Term]
id: XCO:0001500
name: inferior vena cava ligation sham procedure
def: "This is any condition in which the main influencing factor is an inferior vena cava ligation sham procedure, which follows the same surgical process as an inferior vena cava ligation without blocking the inferior vena cava or any other veins." [PMID:37664678]
synonym: "IVC ligation sham procedure" EXACT []
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001499 ! inferior vena cava ligation
created_by: slaulederkind
creation_date: 2024-12-19T14:33:27Z

[Term]
id: XCO:0001501
name: phosphate ion
def: "This is any condition in which the main influencing factor is phosphate ion ([PO4]3−), a molecular species derived from phosphoric acid by the removal of three protons." [https://en.wikipedia.org/wiki/Phosphate#\:~\:text=The%20phosphate%20ion%20has%20a\,4.]
synonym: "[PO 4]3−" EXACT []
synonym: "orthophosphate ion" EXACT []
xref: PMID:26739890
is_a: XCO:0000149 ! ion/salt
created_by: slaulederkind
creation_date: 2024-12-19T15:23:32Z

[Term]
id: XCO:0001502
name: controlled phosphate content diet
def: "This is any condition in which the main influencing factor is a controlled phosphate content diet, which is a regimen of solid food in which the amount of phosphate consumed is controlled." [https://www.merriam-webster.com/, ISBN-13:978-1455756438]
synonym: "controlled [PO 4]3− content diet" EXACT []
synonym: "controlled orthophosphate content diet" EXACT []
xref: PMID:26739890
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0001501 ! phosphate ion
created_by: slaulederkind
creation_date: 2024-12-19T16:26:39Z

[Term]
id: XCO:0001503
name: alfacalcidol
def: "This is any condition in which the main influencing factor is alfacalcidol, a member of the class of D3 vitamins that is calciol in which the hydrogen at the 1alpha position is replaced by a hydroxy group. It is an active metabolite of cholecalciferol, which performs important functions in regulation of the calcium balance and the bone metabolism." []
synonym: "(1S,3R,5Z,7E)-9,10-secocholesta-5,7,10-triene-1,3-diol" EXACT []
synonym: "1alpha-hydroxycholecalciferol" EXACT []
synonym: "1alpha-hydroxy-vitamin D3" EXACT []
synonym: "1alpha-hydroxyvitamin D3" EXACT []
synonym: "1-Hydroxycholecalciferol" EXACT []
synonym: "alphacalcidol" EXACT []
xref: CID:5282181
xref: MESH:C008088
is_a: XCO:0000545 ! vitamin D3
created_by: slaulederkind
creation_date: 2024-12-19T16:43:49Z

[Term]
id: XCO:0001504
name: metal pellet implantation in muscle
def: "This is any condition in which the main influencing factor is the surgical implantation of some type of metal pellet in muscle. This procedure is used to study the effect of various metals in laboratory models of shrapnel wounds." [PMID:33017228]
synonym: "metal fragment implantation in muscle" RELATED []
is_a: XCO:0000027 ! surgical implantation
created_by: slaulederkind
creation_date: 2024-12-20T10:38:24Z

[Term]
id: XCO:0001505
name: tantalum pellet implantation in muscle
def: "This is any condition in which the main influencing factor is the surgical implantation of tantalum pellet(s) in muscle. Tantalum implantation serves as a control for other metal implantation because tantalum has great biocompatibility in implants, devices, and stents, and is largely thought to be inert both in vitro and in vivo." [PMID:33017228]
synonym: "control metal pellet implantation in muscle" BROAD []
synonym: "Ta pellet implantation in muscle" EXACT []
xref: CHEBI:37222
is_a: XCO:0001504 ! metal pellet implantation in muscle
created_by: slaulederkind
creation_date: 2024-12-20T11:01:28Z

[Term]
id: XCO:0001506
name: nickel pellet implantation in muscle
def: "This is any condition in which the main influencing factor is the surgical implantation of nickel pellet(s) in muscle. Nickel is a hard and ductile transition metal that is used in various metal alloys." [https://en.wikipedia.org/wiki/Nickel]
synonym: "Ni pellet implantation in muscle" EXACT []
xref: CHEBI:33748
xref: PMID:33017228
is_a: XCO:0001504 ! metal pellet implantation in muscle
created_by: slaulederkind
creation_date: 2024-12-20T11:21:49Z

[Term]
id: XCO:0001507
name: cobalt pellet implantation in muscle
def: "This is any condition in which the main influencing factor is the surgical implantation of cobalt pellet(s) in muscle. Cobalt is a hard, brittle transition metal used in metal alloys, batteries, and in colorants." [https://en.wikipedia.org/wiki/Cobalt]
synonym: "Co pellet implantation in muscle" EXACT []
xref: CHEBI:33888
xref: PMID:33017228
is_a: XCO:0001504 ! metal pellet implantation in muscle
created_by: slaulederkind
creation_date: 2024-12-20T12:12:11Z

[Term]
id: XCO:0001508
name: lead pellet implantation in muscle
def: "This is any condition in which the main influencing factor is the surgical implantation of lead pellet(s) in muscle. Lead is a soft, malleable, dense post-transition metal that has been used in many different man-made products." [https://en.wikipedia.org/wiki/Lead]
synonym: "Pb pellet implantation in muscle" EXACT []
xref: CHEBI:33585
xref: PMID:33017228
is_a: XCO:0001504 ! metal pellet implantation in muscle
created_by: slaulederkind
creation_date: 2024-12-20T12:28:37Z

[Term]
id: XCO:0001509
name: depleted uranium pellet implantation in muscle
def: "This is any condition in which the main influencing factor is the surgical implantation of depleted uranium pellet(s) in muscle. Depleted uranium is uranium with a lower content of the fissile isotope 235U than natural uranium. Both depleted uranium and uranium are extremely dense metals." [https://en.wikipedia.org/wiki/Depleted_uranium]
synonym: "DU pellet implantation in muscle" EXACT []
xref: CHEBI:33499
xref: PMID:33017228
is_a: XCO:0001504 ! metal pellet implantation in muscle
created_by: slaulederkind
creation_date: 2024-12-20T12:38:09Z

[Term]
id: XCO:0001510
name: transfer of negative control siRNA
def: "This is any condition in which the main influencing factor is transfer of negative control siRNA (small interfering RNA) delivered by transfection or transduction (transfer by virus). Negative control siRNA is an siRNA with no significant sequence similarity to eukaryotic gene sequences. Transfection may be accomplished with chemical, physical, or nonviral biological methods." [ISBN-13:978-1455756438]
synonym: "Not4Curation" RELATED []
xref: PMID:33976969
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulederkind
creation_date: 2024-12-30T13:38:49Z

[Term]
id: XCO:0001511
name: transfer of rat Oprm-1 shRNA using an adenovirus vector
def: "This is any condition in which the main influencing factor is transfer of rat Oprm-1 (opioid receptor, mu 1) shRNA. Oprm-1 is the mu opioid receptor (MOR). The mu opioid receptor is the principal target of endogenous opioid peptides and opioid analgesic agents such as beta-endorphin and enkephalins." [ISBN-13:978-1455756438, RGD:737513]
synonym: "transduction of rat Oprm-1 shRNA using an adenoviral vector" EXACT []
synonym: "transduction of rat Oprm-1 shRNA using an adenovirus vector" EXACT []
synonym: "transfer of rat MOR shRNA using an adeno-associated viral (AAV) vector" EXACT []
synonym: "transfer of rat MOR shRNA using an adenovirus vector" EXACT []
synonym: "transfer of rat mu opioid receptor shRNA using an adenoviral vector" EXACT []
synonym: "transfer of rat mu opioid receptor shRNA using an adenovirus vector" EXACT []
synonym: "transfer of rat Oprm-1 short hairpin RNA using an adenovirus vector" EXACT []
synonym: "transfer of rat Oprm-1 shRNA using an adeno-associated viral (AAV) vector" EXACT []
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulederkind
creation_date: 2024-12-30T13:55:56Z

[Term]
id: XCO:0001512
name: transfer of negative control shRNA using an adenovirus vector
def: "This is any condition in which the main influencing factor is transfer of negative control shRNA (short hairpin RNA) delivered with an adenovirus vector. Negative control shRNA is an shRNA with no significant sequence similarity to eukaryotic gene sequences and may be a scrambled version of the experimental shRNA used." [ISBN-13:978-1455756438, PMID:32388931]
synonym: "transduction of negative control shRNA using an adenoviral vector" EXACT []
synonym: "transduction of negative control shRNA using an adenovirus vector" EXACT []
synonym: "transfer of negative control short hairpin RNA using an adenovirus vector" EXACT []
synonym: "transfer of negative control shRNA using an adeno-associated viral (AAV) vector" EXACT []
synonym: "transfer of negative control shRNA using an adenoviral vector" EXACT []
synonym: "transfer of negative control shRNA using an adenovirus vector" EXACT []
is_a: XCO:0000233 ! ribonucleic acid
created_by: slaulederkind
creation_date: 2024-12-30T14:19:40Z

[Term]
id: XCO:0001513
name: methylazoxymethanol acetate
def: "This is any condition in which the main influencing factor is methylazoxymethanol acetate, a neurotoxin which reduces DNA synthesis. Methylazoxymethanol acetate is used in making animal models of neurological diseases including schizophrenia and epilepsy. It may also be carcinogenic." [https://en.wikipedia.org/wiki/Methylazoxymethanol_acetate]
synonym: "[(Z)-methyl-ONN-azoxy]methyl acetate" EXACT []
synonym: "MAM" EXACT []
xref: CID:5363199
xref: MESH:D008746
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000496 ! neurotoxin
created_by: slaulederkind
creation_date: 2024-12-30T14:52:28Z

[Term]
id: XCO:0001514
name: multigenerational maternal exposure to methylazoxymethanol acetate
def: "This is any condition in which the main influencing factor is any maternal exposure to methylazoxymethanol acetate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) methylazoxymethanol acetate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to [(Z)-methyl-ONN-azoxy]methyl acetate" EXACT []
synonym: "multigenerational maternal exposure to MAM" EXACT []
xref: PMID:32497066
is_a: XCO:0001513 ! methylazoxymethanol acetate
created_by: slaulederkind
creation_date: 2024-12-31T12:16:49Z

[Term]
id: XCO:0001515
name: gestational maternal exposure to methylazoxymethanol acetate
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to methylazoxymethanol acetate. This is a condition typically studied to determine the effect of maternal (F0) methylazoxymethanol acetate use/exposure on the F1 offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "gestational maternal exposure to [(Z)-methyl-ONN-azoxy]methyl acetate" EXACT []
synonym: "gestational maternal exposure to MAM" EXACT []
xref: PMID:32497066
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001514 ! multigenerational maternal exposure to methylazoxymethanol acetate
created_by: slaulederkind
creation_date: 2024-12-31T12:20:59Z

[Term]
id: XCO:0001516
name: multigenerational maternal exposure to poly I:C
def: "This is any condition in which the main influencing factor is any maternal exposure to poly I:C that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) poly I:C use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to dsRNA poly(I:C)" EXACT []
synonym: "multigenerational maternal exposure to poly(I:C)" EXACT []
synonym: "multigenerational maternal exposure to Poly(I:C) dsRNA" EXACT []
synonym: "multigenerational maternal exposure to polyinosinic-polycytidylic acid" EXACT []
xref: PMID:32497066
is_a: XCO:0000235 ! poly I:C
created_by: slaulederkind
creation_date: 2024-12-31T12:35:05Z

[Term]
id: XCO:0001517
name: gestational maternal exposure to poly I:C
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to poly I:C. This is a condition typically studied to determine the effect of maternal (F0) poly I:C use/exposure on the F1 offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "gestational maternal exposure dsRNA poly(I:C)" EXACT []
synonym: "gestational maternal exposure poly(I:C)" EXACT []
synonym: "gestational maternal exposure polyinosinic-polycytidylic acid" EXACT []
synonym: "gestational maternal exposure to Poly(I:C) dsRNA" EXACT []
xref: PMID:32497066
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001516 ! multigenerational maternal exposure to poly I:C
created_by: slaulederkind
creation_date: 2024-12-31T12:50:37Z

[Term]
id: XCO:0001518
name: multigenerational maternal exposure to a controlled protein content diet
def: "This is any condition in which the main influencing factor is maternal exposure to a controlled protein content diet that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) controlled protein content diet on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to controlled protein content diet" EXACT []
xref: PMID:32497066
is_a: XCO:0000030 ! controlled protein content diet
created_by: slaulederkind
creation_date: 2024-12-31T13:04:46Z

[Term]
id: XCO:0001519
name: gestational maternal exposure to a controlled protein content diet
def: "This is any condition in which the main influencing factor is gestational maternal exposure to a controlled protein content diet. This is a condition typically studied to determine the effect of a maternal (F0) controlled protein content diet on the F1 offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "gestational maternal exposure to controlled protein content diet" EXACT []
synonym: "PMID:32497066" EXACT []
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001518 ! multigenerational maternal exposure to a controlled protein content diet
created_by: slaulederkind
creation_date: 2024-12-31T13:10:28Z

[Term]
id: XCO:0001520
name: multigenerational maternal exposure to controlled air oxygen content
def: "This is any condition in which the main influencing factor is any maternal exposure to controlled air oxygen content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to measured air oxygen content" EXACT []
xref: PMID:32639867
is_a: XCO:0001525 ! multigenerational parental exposure to controlled air oxygen content
created_by: slaulederkind
creation_date: 2025-01-03T15:02:26Z

[Term]
id: XCO:0001521
name: pregestational maternal exposure to controlled air oxygen content
def: "This is any condition in which the main influencing factor is any pregestational maternal exposure to controlled air oxygen content. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure on the F1 offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "maternal exposure to controlled air oxygen content prior to a pregnancy" EXACT []
synonym: "maternal exposure to measured air oxygen content prior to a pregnancy" EXACT []
xref: PMID:32639867
relationship: part_of XCO:0001520 ! multigenerational maternal exposure to controlled air oxygen content
created_by: slaulederkind
creation_date: 2025-01-03T15:08:23Z

[Term]
id: XCO:0001522
name: gestational maternal exposure to controlled air oxygen content
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to controlled air oxygen content. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure on the F1 offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "maternal exposure to controlled air oxygen content during pregnancy" EXACT []
xref: PMID:32639867
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001520 ! multigenerational maternal exposure to controlled air oxygen content
created_by: slaulederkind
creation_date: 2025-01-03T15:14:51Z

[Term]
id: XCO:0001523
name: maternal exposure to controlled air oxygen content during nursing
def: "This is any condition in which the main influencing factor is any maternal exposure to controlled air oxygen content during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) controlled air oxygen content exposure during the postnatal, preweaning period on the F1 offspring ." [https://www.merriam-webster.com, PMID:25839742]
synonym: "maternal exposure to controlled air oxygen content during nursing of offspring" EXACT []
xref: PMID:32639867
relationship: part_of XCO:0001520 ! multigenerational maternal exposure to controlled air oxygen content
created_by: slaulederkind
creation_date: 2025-01-03T15:27:49Z

[Term]
id: XCO:0001524
name: multigenerational paternal exposure to controlled air oxygen content
def: "This is any condition in which the main influencing factor is any paternal exposure to controlled air oxygen content that has multigenerational effects. This is a condition typically studied to determine the effect of paternal (F0) controlled air oxygen content exposure on the F1 offspring. The paternal exposure may be any time before conception of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational paternal exposure to measured air oxygen content" EXACT []
synonym: "pre-copulatory paternal exposure to controlled air oxygen content" EXACT []
synonym: "precopulatory paternal exposure to controlled air oxygen content" EXACT []
xref: PMID:32639867
is_a: XCO:0001525 ! multigenerational parental exposure to controlled air oxygen content
created_by: slaulederkind
creation_date: 2025-01-03T15:40:17Z

[Term]
id: XCO:0001525
name: multigenerational parental exposure to controlled air oxygen content
def: "This is any condition in which the main influencing factor is any parental exposure to controlled air oxygen content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal/paternal (F0) controlled air oxygen content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. Paternal exposure to controlled air oxygen content may occur anytime before successful copulation." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational paternal exposure to measured air oxygen content" EXACT []
synonym: "Not4Curation" RELATED []
xref: PMID:32639867
is_a: XCO:0000010 ! controlled air oxygen content
created_by: slaulederkind
creation_date: 2025-01-03T15:52:55Z

[Term]
id: XCO:0001526
name: multigenerational maternal exposure to streptozotocin
def: "This is any condition in which the main influencing factor is any maternal exposure to streptozotocin that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) streptozotocin exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "multigenerational maternal exposure to streptozocin" EXACT []
synonym: "multigenerational maternal exposure to STZ" EXACT []
xref: PMID:32595139
is_a: XCO:0000241 ! streptozotocin
created_by: slaulederkind
creation_date: 2025-01-06T12:10:27Z

[Term]
id: XCO:0001527
name: gestational maternal exposure to streptozotocin
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to streptozotocin. This is a condition typically studied to determine the effect of maternal (F0) streptozotocin exposure on the F1 offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "gestational maternal exposure to streptozocin" EXACT []
synonym: "gestational maternal exposure to STZ" EXACT []
xref: PMID:32595139
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001526 ! multigenerational maternal exposure to streptozotocin
created_by: slaulederkind
creation_date: 2025-01-06T12:26:31Z

[Term]
id: XCO:0001528
name: multigenerational maternal exposure to citrate buffer
def: "This is any condition in which the main influencing factor is any maternal exposure to citrate buffer that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) citrate buffer exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring. Citrate buffer is a combination of sodium citrate dihydrate and citric acid in water to form a solution with a pH range of 3.0 to 6.2." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to sodium citrate buffer" EXACT []
xref: PMID:32595139
is_a: XCO:0001464 ! citrate buffer
created_by: slaulederkind
creation_date: 2025-01-06T12:42:24Z

[Term]
id: XCO:0001529
name: gestational maternal exposure to citrate buffer
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to citrate buffer. This is a condition typically studied to determine the effect of maternal (F0) citrate buffer exposure on the F1 offspring. This is typically a control condition for gestational maternal exposure to some chemical agent." [https://www.merriam-webster.com, PMID:25839742]
synonym: "gestational maternal exposure to sodium citrate buffer" EXACT []
xref: PMID:32595139
is_a: XCO:0000101 ! vehicle control condition
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001528 ! multigenerational maternal exposure to citrate buffer
created_by: slaulederkind
creation_date: 2025-01-06T12:57:18Z

[Term]
id: XCO:0001530
name: multigenerational maternal exposure to hyperglycemia
def: "This is any condition in which the main influencing factor is any maternal exposure to hyperglycemia (blood glucose level > 180 mg/dl) that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) hyperglycemia exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to high blood glucose" EXACT []
synonym: "multigenerational maternal exposure to high blood sugar" EXACT []
xref: PMID:32595139
relationship: has_component XCO:0000275 ! glucose
created_by: slaulederkind
creation_date: 2025-01-06T13:15:35Z

[Term]
id: XCO:0001531
name: gestational maternal exposure to hyperglycemia
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to hyperglycemia (blood glucose level > 180 mg/dl). This is a condition typically studied to determine the effect of maternal (F0) hyperglycemia exposure on the F1 offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "gestational maternal exposure to high blood glucose" EXACT []
synonym: "gestational maternal exposure to high blood sugar" EXACT []
xref: PMID:32595139
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001530 ! multigenerational maternal exposure to hyperglycemia
created_by: slaulederkind
creation_date: 2025-01-06T13:36:01Z

[Term]
id: XCO:0001532
name: Masquelet surgery
def: "This is any condition in which the main influencing factor is use of the Masquelet surgical technique, a surgical procedure used to reconstruct bone defects, particularly those that are large or infected. This technique involves placement of a polymethyl methacrylate (PMMA) cement spacer in a bone defect to allow growth of a vascularized membrane that promotes bone regeneration. A second stage in the method involves removing the spacer after membrane growth and replacing it with bone graft." [PMID:_21543068]
synonym: "Masquelet induced-membrane technique" EXACT []
synonym: "Masquelet technique" EXACT []
synonym: "Masquelet treatment" EXACT []
relationship: has_component XCO:0001394 ! osteotomy
created_by: slaulederkind
creation_date: 2025-01-31T12:58:10Z

[Term]
id: XCO:0001533
name: sciatic nerve ablation
def: "This is any condition in which the main influencing factor is sciatic nerve ablation, surgical removal of some part of the sciatic nerve." [https://www.merriam-webster.com]
synonym: "surgical removal of part of the sciatic nerve" EXACT []
xref: PMID:33008419
relationship: has_component XCO:0000375 ! sciatic nerve axotomy
created_by: slaulederkind
creation_date: 2025-02-04T13:32:24Z

[Term]
id: XCO:0001534
name: peripheral nerve allograft
def: "This is any condition in which the main influencing factor is a peripheral nerve allograft, a non-self peripheral nerve transplantation, typically without histocompatibility matching between donor and host. Commonly, a portion of a donor nerve replaces the damaged portion of the host nerve and involves neurorrhaphy (re-apposing the cut ends with epineurial microsutures)." [PMID:35227261]
synonym: "peripheral nerve transplant" EXACT []
xref: PMID:33008419
is_a: XCO:0000027 ! surgical implantation
relationship: has_component XCO:0001373 ! surgical nerve transection
created_by: slaulederkind
creation_date: 2025-02-04T14:44:35Z

[Term]
id: XCO:0001535
name: PEG-fusion protocol
def: "This is any condition in which the main influencing factor is the PEG-fusion protocol, a peripheral nerve allograft procedure involving sequential administration of four pharmaceutical agents and neurorrhaphy (microsutures through the epi- or perineurium)." [PMID:_33008419]
synonym: "PEG-fusion" EXACT []
synonym: "PEG-fusion allograft protocol" EXACT []
xref: PMID:30586569
is_a: XCO:0001534 ! peripheral nerve allograft
created_by: slaulederkind
creation_date: 2025-02-04T15:22:05Z

[Term]
id: XCO:0001536
name: gene transfer of the mouse Vdr gene using a lentivirus vector
def: "This is a condition in which the mouse Vdr (vitamin D receptor) gene has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to induce synthesis of Vdr in the recipient cell or organism." [https://www.merriam-webster.com, PMID:32771696]
synonym: "gene transfer of mouse Vdr using a lentivirus vector" EXACT []
synonym: "gene transfer of the mouse Vdr gene using a lentiviral vector" EXACT []
synonym: "gene transfer of the mouse vitamin D receptor gene using a lentivirus vector" EXACT []
synonym: "transduction of the mouse Vdr gene using a lentiviral vector" EXACT []
synonym: "transduction of the mouse Vdr gene using a lentivirus vector" EXACT []
synonym: "transduction of the mouse vitamin D receptor gene using a lentivirus vector" EXACT []
xref: RGD:11484
is_a: XCO:0000982 ! gene transfer using a lentivirus vector
created_by: slaulederkind
creation_date: 2025-02-07T11:08:43Z

[Term]
id: XCO:0001537
name: transfer of shRNA using a lentivirus vector
def: "This is any condition in which the main influencing factor is shRNA (short hairpin ribonucleic acid). shRNA is a synthetic RNA molecule that can silence genes in cells. It's a key technology for targeted gene silencing. shRNA is delivered to cells using plasmids, viral vectors, or bacterial vectors" [https://en.wikipedia.org/wiki/Short_hairpin_RNA, PMID:23027054]
synonym: "Not4Curation" RELATED []
synonym: "transfer of short hairpin ribonucleic acid using a lentivirus vector" EXACT []
synonym: "transfer of short hairpin RNA using a lentivirus vector" EXACT []
synonym: "transfer of shRNA using a lentiviral vector" EXACT []
synonym: "transfer of small hairpin RNA using a lentivirus vector" EXACT []
xref: PMID:22365779
relationship: has_component XCO:0000233 ! ribonucleic acid
created_by: slaulederkind
creation_date: 2025-02-07T12:13:40Z

[Term]
id: XCO:0001538
name: transfer of rat Vdr shRNA using a lentivirus vector
def: "This is a condition in which rat Vdr shRNA (vitamin D (1,25-dihydroxyvitamin D3) receptor-specific short hairpin RNA) has been (transiently or stably) transferred into a cell or organism using a lentivirus carrier in order to reduce synthesis of Vdr in the recipient cell or organism." [https://en.wikipedia.org/wiki/Short_hairpin_RNA, PMID:33258480]
synonym: "ransfer of rat vitamin D (1,25-dihydroxyvitamin D3) receptor shRNA using a lentivirus vector" EXACT []
synonym: "transduction of rat Vdr shRNA using a lentiviral vector" EXACT []
synonym: "transduction of rat Vdr shRNA using a lentivirus vector" EXACT []
synonym: "transfer of rat Vdr shRNA using a lentiviral vector" EXACT []
xref: PMID:23027054
is_a: XCO:0001537 ! transfer of shRNA using a lentivirus vector
created_by: slaulederkind
creation_date: 2025-02-07T13:25:10Z

[Term]
id: XCO:0001539
name: sham gene transfer using an empty lentivirus vector
def: "This is a condition in which an empty lentivirus vector (transiently or stably) has been transferred into a cell or organism. This condition is used as a control for a lentivirus transfer of a specific gene." [https://en.wikipedia.org/wiki/Transduction_(genetics), PMID:28927539]
synonym: "sham gene transfer using an empty lentiviral vector" EXACT []
synonym: "sham transduction using an empty lentiviral vector" EXACT []
synonym: "sham transduction using an empty lentivirus vector" EXACT []
xref: PMID:32771696
is_a: XCO:0000099 ! control condition
is_a: XCO:0000982 ! gene transfer using a lentivirus vector
created_by: slaulederkind
creation_date: 2025-02-07T13:46:11Z

[Term]
id: XCO:0001540
name: skeletal muscle ablation
def: "This is any condition in which the main influencing factor is skeletal muscle ablation, which is surgical removal of all or part of one or more skeletal muscles. It is an experimental procedure used in laboratory animals to observe and determine what compensation measures are brought to bear in the remaining musculature." [https://www.merriam-webster.com, PMID:39069823]
synonym: "surgical removal of skeletal muscle" EXACT []
xref: PMID:33486778
is_a: XCO:0000026 ! surgical removal
created_by: slaulederkind
creation_date: 2025-02-10T17:06:28Z

[Term]
id: XCO:0001541
name: unilateral ablation of the gastrocnemius and soleus muscles
def: "This is any condition in which the main influencing factor is unilateral, surgical removal of the gastrocnemius (distal two-thirds) and soleus muscles. This synergist ablation is performed in experimental animals to cause functional overload in the plantaris muscle." [https://www.merriam-webster.com, PMID:39069823]
synonym: "synergist ablation model" EXACT []
synonym: "unilateral, surgical removal of the gastrocnemius and soleus muscles" EXACT []
xref: PMID:33486778
is_a: XCO:0001540 ! skeletal muscle ablation
created_by: slaulederkind
creation_date: 2025-02-10T17:22:57Z

[Term]
id: XCO:0001542
name: oxytocin
def: "This is any condition in which the main influencing factor is oxytocin, a peptide hormone (CYIQNCPLG) that is released from the posterior pituitary gland as a uterine-contracting and milk-ejecting hormone acting on smooth muscle cells. Oxytocin is also a neurotransmitter in the brain." [CHEBI:7872, MESH:D010121]
synonym: "Pitocin" EXACT []
xref: PMID:38327784
is_a: XCO:0000228 ! peptide hormone
created_by: slaulederkind
creation_date: 2025-02-11T10:44:06Z

[Term]
id: XCO:0001543
name: multigenerational maternal exposure to oxytocin
def: "This is any condition in which the main influencing factor is any maternal exposure to oxytocin that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxytocin use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
xref: PMID:38327784
is_a: XCO:0001542 ! oxytocin
created_by: slaulederkind
creation_date: 2025-02-11T14:06:50Z

[Term]
id: XCO:0001544
name: transgenerational maternal exposure to oxytocin
def: "This is any condition in which the main influencing factor is any maternal exposure to oxytocin that has transgenerational effects. This is a condition typically studied to determine the effect of maternal (F0) oxytocin use/exposure on the F2/F3 offspring by direct effects on the F1/F2 generations in utero or during nursing, or by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of F1 offspring to affect the F2 generation. The maternal exposure may be any time after gestational development of germline cells in the F1 generation up to the time of weaning of F1 offspring to affect the F3 generation." [https://www.merriam-webster.com, PMID:25839742]
xref: PMID:38327784
is_a: XCO:0001542 ! oxytocin
created_by: slaulederkind
creation_date: 2025-02-11T14:13:59Z

[Term]
id: XCO:0001545
name: gestational maternal exposure to oxytocin
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to oxytocin. This is a condition typically studied to determine the effect of maternal (F0) oxytocin use/exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
xref: PMID:38327784
is_a: XCO:0000420 ! controlled in utero environment
is_a: XCO:0001543 ! multigenerational maternal exposure to oxytocin
is_a: XCO:0001544 ! transgenerational maternal exposure to oxytocin
created_by: slaulederkind
creation_date: 2025-02-11T14:18:41Z

[Term]
id: XCO:0001546
name: tramadol hydrochloride
def: "This is any condition in which the main influencing factor is tramadol hydrochloride, a racemate consisting of equal amounts of (R,R)- and (S,S)-tramadol hydrochloride. Tramadol hydrochloride is a centrally acting synthetic opioid analgesic, used to treat moderately severe pain. Tramadol hydrochloride has a role as a delta-opioid receptor agonist, a kappa-opioid receptor agonist, a mu-opioid receptor agonist, an adrenergic uptake inhibitor, an antitussive, a capsaicin receptor antagonist, a muscarinic antagonist, a nicotinic antagonist, a NMDA receptor antagonist, a serotonergic antagonist and a serotonin uptake inhibitor." [CHEBI:32250, CID:63013]
synonym: "rac-(1R,2R)-2-[(dimethylamino)methyl]-1-(3-methoxyphenyl)cyclohexanol hydrochloride" EXACT []
synonym: "racemic tramadol hydrochloride" EXACT []
synonym: "tramadol HCl" EXACT []
xref: CAS:36282-47-0
xref: PMID:33486778
is_a: XCO:0000336 ! adrenergic antagonist
is_a: XCO:0000947 ! NMDA receptor antagonist
is_a: XCO:0001329 ! opioid analgesic
created_by: slaulederkind
creation_date: 2025-02-11T14:44:47Z

[Term]
id: XCO:0001547
name: controlled tramadol hydrochloride content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of tramadol hydrochloride, a synthetic opioid analgesic, consumed by a subject." [CHEBI:32250, https://www.merriam-webster.com]
synonym: "controlled racemic tramadol hydrochloride content drinking water" EXACT []
synonym: "controlled tramadol HCl content drinking water" EXACT []
xref: PMID:33486778
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001546 ! tramadol hydrochloride
created_by: slaulederkind
creation_date: 2025-02-11T15:05:33Z

[Term]
id: XCO:0001548
name: manganese(II) chloride tetrahydrate
def: "This is any condition in which the main influencing factor is manganese(II) chloride tetrahydrate, the tetrahydrate form of manganese(II) chloride. Manganese(II) chloride tetrahydrate has a role as a nutraceutical and a MRI contrast agent. Upon administration, manganese may act as an adjuvant and induce both humoral and cellular immune responses." [CID:643989]
synonym: "Cl2H8MnO4" EXACT []
synonym: "dichloromanganese--water (1/4)" EXACT []
synonym: "manganese(2+) chloride tetrahydrate" EXACT []
synonym: "manganese chloride" EXACT []
synonym: "manganese dichloride tetrahydrate" EXACT []
xref: CAS:13446-34-9
xref: CHEBI:86368
xref: PMID:33666854
is_a: XCO:0001549 ! inorganic chloride
created_by: slaulederkind
creation_date: 2025-02-25T14:03:32Z

[Term]
id: XCO:0001549
name: inorganic chloride
def: "This is any condition in which the main influencing factor is inorganic chloride. Chlorine anion (Cl−) is an essential electrolyte located in all body fluids and responsible for maintaining acid/base balance, transmitting nerve impulses, and regulating liquid flow in and out of cells. Chloride compounds contain chlorine atoms bonded to metals like sodium (NaCl), calcium (CaCl2), or magnesium (MgCl2)." [https://chemicaltankerknowledgebase.com/chloride, https://en.wikipedia.org/wiki/Chloride]
synonym: "inorganic chlorides" EXACT []
synonym: "inorganic chloride salt" EXACT []
synonym: "inorganic chloride salts" EXACT []
xref: CHEBI:36093
is_a: XCO:0000149 ! ion/salt
created_by: slaulederkind
creation_date: 2025-02-25T14:19:38Z

[Term]
id: XCO:0001550
name: cellulose
def: "This is any condition whose main influencing factor is cellulose, a polysaccharide consisting of a linear chain of several hundred to many thousands of β(1→4) linked D-glucose units, occurs naturally in such fibrous products as cotton and kapok, and is the raw material of many manufactured goods (such as paper, rayon, and cellophane)." [https://en.wikipedia.org/wiki/Cellulose, https://www.merriam-webster.com/dictionary/cellulose]
synonym: "(C6H10O5)n" EXACT []
xref: MESH:D002482
xref: PMID:33602020
is_a: XCO:0000173 ! polysaccharide
created_by: slaulederkind
creation_date: 2025-02-25T15:03:01Z

[Term]
id: XCO:0001551
name: cellulose nanocrystal
def: "This is any condition in which the main influencing factor is cellulose nanocrystals, formed by acid hydrolysis of cellulose. The family of nanocellulosic materials include microfibrilated cellulose, cellulose nanofibers, and cellulose nanocrystals. Cellulose nanocrystals are rod-shaped particles of 100 to 1000 nanometers in length." [https://en.wikipedia.org/wiki/Nanocellulose, PMID:33602020]
synonym: "CNC" EXACT []
synonym: "nanocrystalline cellulose" EXACT []
synonym: "NCC" EXACT []
is_a: XCO:0000338 ! chemical nanoparticle
is_a: XCO:0001550 ! cellulose
created_by: slaulederkind
creation_date: 2025-02-25T16:04:23Z

[Term]
id: XCO:0001552
name: liquid diet
def: "This is any condition in which the main influencing factor is a liquid diet, a diet consisting of only liquids to provide essential nutrients and hydration. A liquid diet may include any food type able to be delivered easily through a drinking straw." [https://www.merriam-webster.com, https://www.webmd.com/diet/liquid-diets]
synonym: "non-solid diet" EXACT []
xref: PMID:37537282
is_a: XCO:0000020 ! drink
created_by: slaulederkind
creation_date: 2025-03-06T13:26:18Z

[Term]
id: XCO:0001553
name: Lieber-DeCarli control liquid diet
def: "This is any condition in which the main influencing factor is Lieber-DeCarli control liquid diet, a liquid diet whose calories are 50% carbohydrate, 35% fat, and 15% protein." [https://www.bio-serv.com/pdf/F1259.pdf, https://www.merriam-webster.com]
synonym: "Bio-Serv F1259" EXACT []
synonym: "Lieber-DeCarli '82 control liquid diet" EXACT []
xref: PMID:37537282
is_a: XCO:0001552 ! liquid diet
relationship: has_component XCO:0000021 ! water
created_by: slaulederkind
creation_date: 2025-03-06T13:39:33Z

[Term]
id: XCO:0001554
name: Lieber-DeCarli ethanol liquid diet
def: "This is any condition in which the main influencing factor is Lieber-DeCarli ethanol liquid diet, a liquid diet whose calories are 35% ethanol, 35% non-alcoholic carbohydrate, 35% fat, and 15% protein. The basic formula makes the ethanol content to be about 8% by volume." [https://www.bio-serv.com/pdf/F1258.pdf, https://www.merriam-webster.com]
synonym: "Bio-Serv F1258" EXACT []
synonym: "Lieber-DeCarli '82 ethanol liquid diet" EXACT []
xref: PMID:37537282
is_a: XCO:0001552 ! liquid diet
relationship: has_component XCO:0000325 ! ethanol
created_by: slaulederkind
creation_date: 2025-03-06T14:25:45Z

[Term]
id: XCO:0001555
name: controlled air ethanol content
def: "This is any condition in which the main influencing factor is controlled air ethanol content surrounding an organism or breathed by the organism as part of the experiment." [PMID:34573170]
synonym: "chronic intermittent ethanol" RELATED []
synonym: "chronic intermittent ethanol vapor exposure" NARROW []
synonym: "chronic intermittent ethanol vapor inhalation" NARROW []
synonym: "CIE" RELATED []
synonym: "controlled air ethanol vapor content" EXACT []
xref: GEO:GSE159136
xref: PMID:28363981
is_a: XCO:0000009 ! controlled air content
created_by: slaulederkind
creation_date: 2025-03-20T12:36:33Z

[Term]
id: XCO:0001556
name: acadesine
def: "This is any condition in which the main influencing factor is acadesine, a purine nucleoside analogue and activator of AMP-activated protein kinase. Acadesine is used for the treatment of acute lymphoblastic leukemia and is reported to have cardioprotective effects." [CHEBI:28498]
synonym: "5-Amino-1-beta-D-ribofuranosyl-1H-imidazole-4-carboxamide" EXACT []
synonym: "5-Aminoimidazole-4-carboxamide 1-beta-D-ribofuranoside" EXACT []
synonym: "AICAR" EXACT []
synonym: "AICA ribofuranoside" EXACT []
synonym: "AICA-riboside" EXACT []
xref: CID:46780289
xref: MESH:C011651
is_a: XCO:0000392 ! nucleoside/nucleotide
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000694 ! enzyme activator
created_by: slaulederkind
creation_date: 2025-03-20T13:31:59Z

[Term]
id: XCO:0001557
name: ventral trunk of subdiaphragmatic vagus nerve direct electrical stimulation
def: "This is any condition in which the main influencing factor is direct electrical stimulation of the ventral trunk of the subdiaphragmatic vagus nerve. The electrical stimulation is delivered by some sort of bioelectronic implant. The vagus nerve (the tenth cranial nerve), is a mixed nerve that carries both sensory and motor information. The vagus nerve is the longest nerve in the human body as it originates in the brainstem and travels down the neck and into the thorax and abdomen." [PMID:30725856]
synonym: "sdVNS" EXACT []
synonym: "subdiaphragmatic vagus nerve stimulation" EXACT []
synonym: "tenth cranial nerve direct electrical stimulation" BROAD []
synonym: "vagal nerve direct electrical stimulation" BROAD []
synonym: "vagus nerve direct electrical stimulation" BROAD []
xref: GEO:GSE189615
xref: PMID:37746712
is_a: XCO:0000521 ! direct electrical nerve stimulation
created_by: slaulederkind
creation_date: 2025-03-20T18:27:29Z

[Term]
id: XCO:0001558
name: ventral trunk of subdiaphragmatic vagus nerve direct electrical stimulation sham procedure
def: "This is any condition in which the main influencing factor is ventral trunk of subdiaphragmatic vagus nerve direct electrical stimulation sham procedure. This procedure involves all the surgical maneuvers and implantations minus the electrode leads." [PMID:37746712]
synonym: "sdVNS sham" EXACT []
synonym: "subdiaphragmatic vagus nerve stimulation sham" EXACT []
synonym: "tenth cranial nerve direct electrical stimulation sham" EXACT []
synonym: "vagal nerve direct electrical stimulation sham" EXACT []
synonym: "vagus nerve direct electrical stimulation sham" EXACT []
xref: PMID:30725856
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001557 ! ventral trunk of subdiaphragmatic vagus nerve direct electrical stimulation
created_by: slaulederkind
creation_date: 2025-03-21T11:51:23Z

[Term]
id: XCO:0001559
name: per- and polyfluoroalkyl substances
def: "This is any condition in which the main influencing factor is a per- or polyfluoroalkyl substance. These are organofluorine compounds that have multiple fluorine atoms attached to an alkyl chain (perfluoroalkyl compounds have carbon chain atoms that are completely fluorinated and polyfluoroalkyl compounds have at least one of the carbon atoms in the alkyl chain not fully fluorinated)." [CHEBI:172397, CHEBI:172406]
synonym: "forever chemicals" EXACT []
synonym: "PFAS" EXACT []
synonym: "PFASs" EXACT []
xref: GEO:GSE262750
xref: PMID:38963985
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2025-03-21T14:08:22Z

[Term]
id: XCO:0001560
name: perfluorohexane sulfonate
def: "This is any condition in which the main influencing factor is perfluorohexane sulfonate, the conjugate base of perfluorohexanesulfonic acid." [https://en.wikipedia.org/wiki/Conjugate_(acid-base_theory), https://en.wikipedia.org/wiki/Perfluorohexanesulfonic_acid]
synonym: "perfluorohexanesulfonate" EXACT []
synonym: "PFHxS" RELATED []
synonym: "potassium perfluorohexanesulfonate" NARROW []
xref: CID:23678874
is_a: XCO:0001559 ! per- and polyfluoroalkyl substances
created_by: slaulederkind
creation_date: 2025-03-21T14:35:38Z

[Term]
id: XCO:0001561
name: 6-propyl-2-thiouracil
def: "This is any condition in which the main influencing factor is 6-propyl-2-thiouracil (propylthiouracil), a drug used to treat Graves' disease and hyperthyroidism. Propylthiouracil is a thyroid hormone antagonist, a nitric oxide synthase inhibitor, an antioxidant, and an antidote to paracetamol poisoning." [CID:657298, https://www.mayoclinic.org/drugs-supplements/propylthiouracil-oral-route/description/drg-20072978]
synonym: "6-n-propylthiouracil" EXACT []
synonym: "6-propyl-2-sulfanylidene-2,3-dihydropyrimidin-4(1H)-one" EXACT []
synonym: "propylthiouracil" EXACT []
synonym: "PTU" EXACT []
xref: CHEBI:8502
xref: MESH:D011441
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2025-03-21T14:53:57Z

[Term]
id: XCO:0001562
name: protamine sulfate
def: "This is any condition in which the main influencing factor is protamine sulfate, an anti-heparin drug used to reverse the anti-coagulant effects of heparin. Protamine sulfate effects the reversal heparin activity predominantly via the formation of an inactive complex between the anionic heparin and its own cationic state." [https://en.wikipedia.org/wiki/Protamine_sulfate, https://go.drugbank.com/drugs/DB09141]
synonym: "1-[3-(Hydroxymethyl)-1,4-dioxo-2,3,6,7,8,8a-hexahydropyrrolo[1,2-a]pyrazin-7-yl]-3-(1-phenylethyl)urea" EXACT []
xref: CAS:9009-65-8
xref: CID:76429668
xref: PMID:39252992
is_a: XCO:0000120 ! inhibitor
created_by: slaulederkind
creation_date: 2025-03-24T15:37:04Z

[Term]
id: XCO:0001563
name: zymosan
def: "This is any condition in which the main influencing factor is zymosan, a protein-carbohydrate complex derived from yeast cell walls. Zymosan induces experimental sterile inflammation and activates macrophages by binding to TLR2 and Dectin-1 receptors. Joint injection of zymosan induces arthritis in experimental animals to create a model of chronic proliferative arthritis." [https://en.wikipedia.org/wiki/Zymosan, PMID:911357]
xref: MESH:D015054
xref: PMID:39252992
is_a: XCO:0000261 ! arthritis inducing chemical
relationship: has_component XCO:0000173 ! polysaccharide
created_by: slaulederkind
creation_date: 2025-03-24T16:24:53Z

[Term]
id: XCO:0001564
name: multigenerational maternal exposure to perfluorohexane sulfonate
def: "This is any condition in which the main influencing factor is any maternal exposure to perfluorohexane sulfonate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) perfluorohexane sulfonate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to perfluorohexanesulfonate" EXACT []
synonym: "multigenerational maternal exposure to potassium perfluorohexanesulfonate" NARROW []
xref: CID:23678874
xref: GEO:GSE262750
xref: PMID:38963985
is_a: XCO:0001560 ! perfluorohexane sulfonate
created_by: slaulederkind
creation_date: 2025-03-25T11:21:44Z

[Term]
id: XCO:0001565
name: gestational maternal exposure to perfluorohexane sulfonate
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to perfluorohexane sulfonate. This is a condition typically studied to determine the effect of maternal (F0) perfluorohexane sulfonate use/exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "gestational maternal exposure to perfluorohexanesulfonate" EXACT []
synonym: "gestational maternal exposure to potassium perfluorohexanesulfonate" NARROW []
xref: CID:23678874
xref: GEO:GSE262750
xref: PMID:38963985
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001564 ! multigenerational maternal exposure to perfluorohexane sulfonate
created_by: slaulederkind
creation_date: 2025-03-25T11:27:51Z

[Term]
id: XCO:0001566
name: maternal exposure to perfluorohexane sulfonate during nursing
def: "This is any condition in which the main influencing factor is any maternal exposure to perfluorohexane sulfonate during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) perfluorohexane sulfonate use/exposure during the postnatal, preweaning period on the F1 offspring." [https://www.merriam-webster.com]
synonym: "maternal exposure to perfluorohexanesulfonate" EXACT []
synonym: "maternal exposure to potassium perfluorohexanesulfonate" NARROW []
xref: CID:23678874
xref: GEO:GSE262750
xref: PMID:38963985
relationship: part_of XCO:0001564 ! multigenerational maternal exposure to perfluorohexane sulfonate
created_by: slaulederkind
creation_date: 2025-03-25T12:49:32Z

[Term]
id: XCO:0001567
name: multigenerational maternal exposure to 6-propyl-2-thiouracil
def: "This is any condition in which the main influencing factor is any maternal exposure to 6-propyl-2-thiouracil that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) 6-propyl-2-thiouracil use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to propylthiouracil" EXACT []
synonym: "multigenerational maternal exposure to PTU" EXACT []
xref: CHEBI:8502
xref: CID:657298
xref: GEO:GSE262750
xref: MESH:D011441
xref: PMID:38963985
is_a: XCO:0001561 ! 6-propyl-2-thiouracil
created_by: slaulederkind
creation_date: 2025-03-25T13:05:17Z

[Term]
id: XCO:0001568
name: gestational maternal exposure to 6-propyl-2-thiouracil
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to 6-propyl-2-thiouracil. This is a condition typically studied to determine the effect of maternal (F0) 6-propyl-2-thiouracil use/exposure on the F1 offspring." [CID:657298, https://www.merriam-webster.com/]
synonym: "gestational maternal exposure to propylthiouracil" EXACT []
synonym: "gestational maternal exposure to PTU" EXACT []
xref: CHEBI:8502
xref: GEO:GSE262750
xref: MESH:D011441
xref: PMID:38963985
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001567 ! multigenerational maternal exposure to 6-propyl-2-thiouracil
created_by: slaulederkind
creation_date: 2025-03-25T13:11:27Z

[Term]
id: XCO:0001569
name: maternal exposure to 6-propyl-2-thiouracil during nursing
def: "This is any condition in which the main influencing factor is any maternal exposure to 6-propyl-2-thiouracil during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) 6-propyl-2-thiouracil use/exposure during the postnatal, preweaning period on the F1 offspring." [CID:657298, https://www.merriam-webster.com/]
synonym: "maternal exposure to propylthiouracil during nursing" EXACT []
synonym: "maternal exposure to PTU during nursing" EXACT []
xref: CHEBI:8502
xref: GEO:GSE262750
xref: MESH:D011441
xref: PMID:38963985
relationship: part_of XCO:0001567 ! multigenerational maternal exposure to 6-propyl-2-thiouracil
created_by: slaulederkind
creation_date: 2025-03-25T13:26:20Z

[Term]
id: XCO:0001570
name: multigenerational maternal exposure to controlled air E-cigarette aerosol content
def: "This is any condition in which the main influencing factor is any maternal exposure to controlled air E-cigarette/nicotine aerosol content that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) controlled air E-cigarette/nicotine (~2.4%) aerosol content exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal chronic intermittent e-cigarette exposure" EXACT []
synonym: "multigenerational maternal CIEC exposure" EXACT []
synonym: "multigenerational maternal exposure to controlled air BluPlus e-cig aerosol content" NARROW []
synonym: "multigenerational maternal exposure to controlled air e-cig aerosol content" EXACT []
synonym: "multigenerational maternal exposure to controlled air E-cigarette nicotine aerosol content" EXACT []
xref: GEO:GSE278792
xref: PMID:39414906
relationship: has_component XCO:0001049 ! nicotine
created_by: slaulederkind
creation_date: 2025-03-27T11:27:19Z

[Term]
id: XCO:0001571
name: gestational maternal exposure to controlled air E-cigarette aerosol content
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to controlled air E-cigarette/nicotine aerosol content. This is a condition typically studied to determine the effect of maternal (F0) controlled air E-cigarette/nicotine (~2.4%) content exposure on the F1 offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "gestational maternal chronic intermittent e-cigarette exposure" EXACT []
synonym: "gestational maternal CIEC exposure" EXACT []
synonym: "gestational maternal exposure to controlled air BluPlus e-cig aerosol content" NARROW []
synonym: "gestational maternal exposure to controlled air E-cigarette nicotine aerosol content" EXACT []
synonym: "maternal exposure to controlled air E-cigarette aerosol content during pregnancy" EXACT []
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001570 ! multigenerational maternal exposure to controlled air E-cigarette aerosol content
created_by: slaulederkind
creation_date: 2025-03-27T12:19:09Z

[Term]
id: XCO:0001572
name: 2,2',5,5'-tetrachlorobiphenyl
def: "This is any condition in which the main influencing factor is 2,2',5,5'-tetrachlorobiphenyl, a tetrachlorobiphenyl that is biphenyl in which the hydrogens at the 2 and 5 position of each benzene ring are replaced by chlorines." [CHEBI:34206, MESH:C009407]
synonym: "1,1'-Biphenyl, 2,2',5,5'-tetrachloro-" EXACT []
synonym: "2,2',5,5'-tetrachloro-1,1'-biphenyl" EXACT []
synonym: "PCB-52" EXACT []
synonym: "PCB52" EXACT []
xref: CID:37248
xref: GEO:GSE246555
xref: MESH:C009407
xref: PMID:39369937
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2025-03-31T13:04:18Z

[Term]
id: XCO:0001573
name: subthalamic nucleus stimulation via implanted electrode
def: "This is any condition in which the main influencing factor is the alteration of nerve activity through targeted delivery of an electrical stimulus directly to the subthalamic nucleus. This is done with implanted electrode(s)." [http://braininfo.rprc.washington.edu/Default.aspx, PMID:28470693]
synonym: "brain stimulation via implanted electrode" BROAD []
synonym: "STN stimulation via implanted electrode" EXACT []
xref: PMID:39481497
is_a: XCO:0000027 ! surgical implantation
is_a: XCO:0000520 ! neuromodulation
created_by: slaulederkind
creation_date: 2025-04-03T16:28:04Z

[Term]
id: XCO:0001574
name: subthalamic nucleus implanted electrode sham procedure
def: "This is any condition in which the main influencing factor is an subthalamic nucleus implanted electrode sham procedure, which follows the same surgical process as a subthalamic nucleus implanted electrode procedure, but no electrical stimulus is delivered." [http://braininfo.rprc.washington.edu/Default.aspx, PMID:39481497]
synonym: "STN implanted electrode sham procedure" EXACT []
xref: PMID:28470693
is_a: XCO:0000367 ! surgical device implantation sham procedure
relationship: part_of XCO:0001573 ! subthalamic nucleus stimulation via implanted electrode
created_by: slaulederkind
creation_date: 2025-04-03T17:05:06Z

[Term]
id: XCO:0001575
name: gene transfer using an adeno-associated virus vector
def: "This is any condition in which the main influencing factor is a gene transfer performed using an adeno-associated virus as the carrier of the genetic material. An adeno-associated virus is a small, non-enveloped, single-stranded DNA virus that is replication-deficient, i.e. it needs a helper virus to replicate. AAV is a promising vector for gene therapy due to its ability to infect both dividing and non-dividing cells, its low immunogenicity, and its ability to mediate long-term expression without integrating into the host genome." [https://www.bio-techne.com/resources/blogs/how-adenovirus-and-adeno-associated-virus-work-as-gene-therapy-vectors, https://www.vectorbiolabs.com/adenovirus-vs-aav/]
synonym: "gene transduction using AAV vector" EXACT []
synonym: "gene transduction using an adeno-associated virus vector" EXACT []
synonym: "gene transfer using AAV vector" EXACT []
xref: PMID:39481497
is_a: XCO:0000528 ! gene transfer
created_by: slaulederkind
creation_date: 2025-04-03T17:48:26Z

[Term]
id: XCO:0001576
name: gene transfer of the human A53T α-synuclein gene using an AAV1/2 hybrid virus vector
def: "This is any condition in which the main influencing factor is gene transfer of the human A53T α-synuclein gene using an AAV1/2 hybrid virus vector. A53T α-synuclein is a mutant form of the human synuclein alpha (SNCA) gene." [https://www.bio-techne.com/resources/blogs/how-adenovirus-and-adeno-associated-virus-work-as-gene-therapy-vectors, PMID:_28143577]
synonym: "gene transduction of the human A53T α-synuclein gene using an AAV1/2 hybrid virus vector" EXACT []
synonym: "gene transfer of the human A53T SNCA gene using an AAV1/2 hybrid virus vector" EXACT []
xref: PMID:39481497
is_a: XCO:0001575 ! gene transfer using an adeno-associated virus vector
created_by: slaulederkind
creation_date: 2025-04-03T18:08:36Z

[Term]
id: XCO:0001577
name: sham gene transfer using an empty AAV1/2 hybrid virus vector
def: "This is any condition in which the main influencing factor is an empty AAV1/2 hybrid virus vector that has been transferred into a cell or organism. This condition is used as a control for a AAV1/2 hybrid virus transfer of a specific gene." [https://www.vectorbiolabs.com/adenovirus-vs-aav/, PMID:28143577]
synonym: "sham gene transfer using an AAV1/2 hybrid virus empty vector" EXACT []
synonym: "sham gene transfer using an AAV1/2 hybrid virus EV" EXACT []
xref: PMID:39481497
is_a: XCO:0000099 ! control condition
is_a: XCO:0001575 ! gene transfer using an adeno-associated virus vector
created_by: slaulederkind
creation_date: 2025-04-03T18:26:16Z

[Term]
id: XCO:0001578
name: choline‐sufficient, amino acid‐defined diet
def: "This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet. A CSAA diet is often used as a control diet in studies investigating the effects of choline deficiency on liver health, particularly in models of non-alcoholic fatty liver disease (NAFLD)." [PMID:36062292]
synonym: "CSAA diet" EXACT []
xref: PMID:39562169
xref: PMID:40029260
is_a: XCO:0000014 ! controlled content diet
is_a: XCO:0000099 ! control condition
created_by: slaulederkind
creation_date: 2025-04-04T18:03:47Z

[Term]
id: XCO:0001579
name: controlled resveratrol content, CSAA diet
def: "This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet with controlled resveratrol content." [https://www.merriam-webster.com, PMID:39562169]
synonym: "controlled resveratrol content, choline‐sufficient, amino acid‐defined diet" EXACT []
xref: PMID:40029260
is_a: XCO:0001578 ! choline‐sufficient, amino acid‐defined diet
relationship: has_component XCO:0000856 ! resveratrol
created_by: slaulederkind
creation_date: 2025-04-04T18:15:53Z

[Term]
id: XCO:0001580
name: pterostilbene
def: "This is any condition in which the main influencing factor is pterostilbene, a polyphenol which is an antioxidant, antineoplastic agent, and anti-inflammatory agent." [CID:5281727]
synonym: "4-[(E)-2-(3,5-dimethoxyphenyl)ethenyl]phenol" EXACT []
xref: CHEBI:8630
xref: MESH:C107773
xref: PMID:39562169
xref: PMID:40029260
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulederkind
creation_date: 2025-04-04T18:42:28Z

[Term]
id: XCO:0001581
name: controlled pterostilbene content, CSAA diet
def: "This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet with controlled pterostilbene content." [https://www.merriam-webster.com/, PMID:39562169]
synonym: "controlled pterostilbene content, choline‐sufficient, amino acid‐defined diet" EXACT []
xref: PMID:40029260
is_a: XCO:0001578 ! choline‐sufficient, amino acid‐defined diet
relationship: has_component XCO:0001580 ! pterostilbene
created_by: slaulederkind
creation_date: 2025-04-15T17:11:17Z

[Term]
id: XCO:0001582
name: chlorogenic acid
def: "This is any condition in which the main influencing factor is chlorogenic acid, a cinnamate ester obtained by formal condensation of the carboxy group of trans-caffeic acid with the 3-hydroxy group of quinic acid. It is an investigational drug for its anti-inflammatory, anti-cancer, anti-diabetic, and other medicinal properties." [CID:1794427, PMID:29080460]
synonym: "(1S,3R,4R,5R)-3-{[(2E)-3-(3,4-Dihydroxyphenyl)prop-2-enoyl]oxy}-1,4,5-trihydroxycyclohexane-1-carboxylic acid" EXACT []
synonym: "3-CQA" EXACT []
synonym: "CGA" EXACT []
xref: CHEBI:16112
xref: MESH:D002726
xref: PMID:39562169
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000511 ! ester
created_by: slaulederkind
creation_date: 2025-04-17T13:06:34Z

[Term]
id: XCO:0001583
name: controlled chlorogenic acid content, CSAA diet
def: "This is any condition in which the main influencing factor is a choline‐sufficient, amino acid‐defined (CSAA) diet with controlled chlorogenic acid content." [CID:1794427, https://www.merriam-webster.com/]
synonym: "controlled 3-CQA content, CSAA diet" EXACT []
synonym: "controlled CGA content, CSAA diet" EXACT []
xref: CHEBI:16112
xref: MESH:D002726
xref: PMID:39562169
is_a: XCO:0001578 ! choline‐sufficient, amino acid‐defined diet
relationship: has_component XCO:0001582 ! chlorogenic acid
created_by: slaulederkind
creation_date: 2025-04-17T13:25:39Z

[Term]
id: XCO:0001584
name: multigenerational maternal exposure to dimethyl sulfoxide
def: "This is any condition in which the main influencing factor is any maternal exposure to dimethyl sulfoxide that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) dimethyl sulfoxide use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "multigenerational maternal exposure to DMSO" EXACT []
xref: PMID:39652430
is_a: XCO:0000755 ! dimethyl sulfoxide
created_by: slaulederkind
creation_date: 2025-04-17T18:43:58Z

[Term]
id: XCO:0001585
name: gestational maternal exposure to dimethyl sulfoxide
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to dimethyl sulfoxide. This is a condition typically studied to determine the effect of maternal (F0) dimethyl sulfoxide use/exposure on the F1 offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "gestational maternal exposure to DMSO" EXACT []
xref: PMID:39652430
is_a: XCO:0000101 ! vehicle control condition
is_a: XCO:0000420 ! controlled in utero environment
is_a: XCO:0001584 ! multigenerational maternal exposure to dimethyl sulfoxide
created_by: slaulederkind
creation_date: 2025-04-18T10:55:22Z

[Term]
id: XCO:0001586
name: 2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester
def: "This is any condition in which the main influencing factor is 2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester, an indolyl carboxylic acid." [CHEBI:93059]
synonym: "2-(1H-Indol-3-ylcarbonyl)-4-thiazolecarboxylic acid methyl ester" EXACT []
synonym: "ITE" EXACT []
synonym: "methyl 2-(1H-indol-3-ylcarbonyl)-1,3-thiazole-4-carboxylate" EXACT []
synonym: "methyl 2-(1H-indole-3-carbonyl)-1,3-thiazole-4-carboxylate" EXACT []
xref: CHEBI:93059
is_a: XCO:0000511 ! ester
created_by: slaulederkind
creation_date: 2025-04-18T11:08:38Z

[Term]
id: XCO:0001587
name: multigenerational maternal exposure to ITE
def: "This is any condition in which the main influencing factor is any maternal exposure to ITE (2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester) that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) ITE use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "multigenerational maternal exposure to 2-(1H-Indol-3-ylcarbonyl)-4-thiazolecarboxylic acid methyl ester" EXACT []
synonym: "multigenerational maternal exposure to 2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester" EXACT []
synonym: "multigenerational maternal exposure to methyl 2-(1H-indol-3-ylcarbonyl)-1,3-thiazole-4-carboxylate" EXACT []
synonym: "multigenerational maternal exposure to methyl 2-(1H-indole-3-carbonyl)-1,3-thiazole-4-carboxylate" EXACT []
xref: PMID:39652430
is_a: XCO:0001586 ! 2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester
created_by: slaulederkind
creation_date: 2025-04-18T11:53:22Z

[Term]
id: XCO:0001588
name: gestational maternal exposure to ITE
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to ITE (2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester). This is a condition typically studied to determine the effect of maternal (F0) ITE use/exposure on the F1 offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "gestational maternal exposure to 2-(1H-indol-3-ylcarbonyl)-1,3-thiazole-4-carboxylate" EXACT []
synonym: "gestational maternal exposure to 2-(1H-Indol-3-ylcarbonyl)-4-thiazolecarboxylic acid methyl ester" EXACT []
synonym: "gestational maternal exposure to 2-(1H-indole-3-carbonyl)-1,3-thiazole-4-carboxylate" EXACT []
synonym: "gestational maternal exposure to 2-[1H-indol-3-yl(oxo)methyl]-4-thiazolecarboxylic acid methyl ester" EXACT []
xref: PMID:39652430
is_a: XCO:0000420 ! controlled in utero environment
is_a: XCO:0001587 ! multigenerational maternal exposure to ITE
created_by: slaulederkind
creation_date: 2025-04-18T12:15:35Z

[Term]
id: XCO:0001589
name: lung ischemia/reperfusion
def: "This is any condition in which the main influencing factor is lung ischemia/reperfusion, an experimental surgical procedure which involves clamping/releasing of the pulmonary hilum on one side of the lungs. Blood vessels, nerves, and bronchi pass through the hilum to all the lobes of the lungs." [https://www.merriam-webster.com/, PMID:39655220]
synonym: "I-post-C" RELATED []
synonym: "LIRI" EXACT []
is_a: XCO:0000874 ! controlled in situ lung condition
created_by: slaulederkind
creation_date: 2025-04-18T13:52:23Z

[Term]
id: XCO:0001590
name: lung ischemia/reperfusion sham procedure
def: "This is any condition in which the main influencing factor is a lung ischemia/reperfusion sham procedure, which follows the same surgical process as an lung ischemia/reperfusion procedure without blocking the pulmonary hilum." [https://www.merriam-webster.com/, PMID:39655220]
synonym: "I-post-C sham procedure" RELATED []
synonym: "LIRI sham procedure" EXACT []
is_a: XCO:0000100 ! sham surgical control condition
relationship: part_of XCO:0001589 ! lung ischemia/reperfusion
created_by: slaulederkind
creation_date: 2025-04-18T14:15:30Z

[Term]
id: XCO:0001591
name: experimental T10/T11 spinal cord transection/scar resection
def: "This is any condition in which the main influencing factor is scar resection after healing of an experimental transection of the rat spinal cord at the vertebral level of thoracic 10/11 (T10/11). This procedure involves laminectomy of the tenth vertebra and complete transection of the isolated section of spinal cord. This procedure is followed by resection of the center (~1 mm) of the scar tissue formed (by ~ day 42) in the gap created by the transection." [https://www.merriam-webster.com/, PMID:39733145]
synonym: "experimental SCI scar resection" EXACT []
synonym: "experimental spinal cord injury scar resection" EXACT []
synonym: "experimental SSCI scar resection" EXACT []
synonym: "experimental suprasacral spinal cord injury scar resection" EXACT []
relationship: has_component XCO:0001376 ! experimental spinal cord transection at T10/T11
created_by: slaulederkind
creation_date: 2025-04-24T11:05:37Z

[Term]
id: XCO:0001592
name: porcine dECM hydrogel implantation
def: "This is any condition in which the main influencing factor is implantation of a porcine, decellularized, extracellular matrix (dECM) hydrogel scaffold, a tissue scaffold made of decellularized, extracellular matrix from porcine kidney. dECM hydrogel has been utilized for experimental nerve regeneration, spinal cord injury repair, and resected kidney defect repair." []
created_by: slaulederkind
creation_date: 2025-04-24T11:35:37Z

[Term]
id: XCO:0001593
name: human iPS cell-derived hNS/PCs
def: "This is any condition in which the main influencing factor is an injection or infusion of human neural stem/progenitor cells (hNS/PCs) derived from human induced pluripotent stem cells." [https://www.merriam-webster.com/, PMID:39733145]
comment: neural stem progenitor cell
synonym: "human induced pluripotent stem cell-derived hNS/PCs" EXACT []
synonym: "human induced pluripotent stem cell-derived neural stem/progenitor cells" EXACT []
synonym: "human iPS cell-derived neural stem/progenitor cells" EXACT []
is_a: XCO:0001032 ! human neural progenitor cells
created_by: slaulederkind
creation_date: 2025-04-24T12:22:39Z

[Term]
id: XCO:0001594
name: aluminium hydroxide
def: "This is any condition in which the main influencing factor is aluminium hydroxide, an antacid used for the symptomatic relief of heartburn. Aluminium hydroxide is also used in other applications: as an antiperspirant, as an emulsifier, in dentifrices, as an adjuvant in bacterins and vaccines, in water purification, etc." [https://go.drugbank.com/drugs/DB06723, MESH:D000536]
synonym: "Al(OH)3" EXACT []
synonym: "aluminium(III) hydroxide" EXACT []
synonym: "trihydroxidoaluminium" EXACT []
xref: CHEBI:33130
xref: PMID:34367159
is_a: XCO:0000342 ! chemical with specified structure
created_by: slaulederkind
creation_date: 2025-04-25T14:00:53Z

[Term]
id: XCO:0001595
name: Mengovirus
def: "This is any condition in which the main influencing factor is Mengovirus, a single-stranded RNA virus that belongs to the genus Cardiovirus. The Mengovirus infects vertebrates and is able to suppress the host's immune response by reducing the expression of Nuclear Factor kappa B." [https://en.wikipedia.org/wiki/Mengovirus]
synonym: "Columbia SK virus" EXACT []
synonym: "Mengo virus" EXACT []
synonym: "mouse Elberfield virus" EXACT []
synonym: "vMC0  (attenuated)" NARROW []
xref: PMID:34367159
is_a: XCO:0000237 ! viral pathogen
created_by: slaulederkind
creation_date: 2025-04-25T15:24:02Z

[Term]
id: XCO:0001596
name: OM-85
def: "This is any condition in which the main influencing factor is OM-85, an immunostimulanting combination of molecules extracted from the walls of bacteria that commonly cause respiratory infections. OM-85 can enhance immunity by promoting the maturation of dendritic cells in the gastrointestinal Peyer's patches, which in turn strengthens immune defenses in the lung." [https://en.wikipedia.org/wiki/OM-85#, PMID:35985019]
synonym: "Broncho-Vaxom" NARROW []
synonym: "OM85" EXACT []
xref: PMID:34367159
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000761 ! biologics and probiotics
created_by: slaulederkind
creation_date: 2025-04-25T15:59:11Z

[Term]
id: XCO:0001597
name: multigenerational maternal exposure to valproate
def: "This is any condition in which the main influencing factor is any maternal exposure to valproate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) valproate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to 2-propylpentanoate" EXACT []
synonym: "multigenerational maternal exposure to VPA" EXACT []
xref: CHEBI:60654
xref: PMID:33712455
is_a: XCO:0001258 ! valproate
created_by: slaulederkind
creation_date: 2025-04-25T17:20:59Z

[Term]
id: XCO:0001598
name: gestational maternal exposure to valproate
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to valproate. This is a condition typically studied to determine the effect of maternal (F0) valproate use/exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "gestational maternal exposure to 2-propylpentanoate" EXACT []
synonym: "gestational maternal exposure to VPA" EXACT []
synonym: "maternal exposure to 2-propylpentanoate during pregnancy" EXACT []
synonym: "maternal exposure to valproate during pregnancy" EXACT []
synonym: "maternal exposure to VPA during pregnancy" EXACT []
xref: CHEBI:60654
xref: PMID:33712455
is_a: XCO:0001597 ! multigenerational maternal exposure to valproate
created_by: slaulederkind
creation_date: 2025-04-25T17:24:58Z

[Term]
id: XCO:0001599
name: TAK-418
def: "This is any condition in which the main influencing factor is TAK-418, a selective, orally active lysine demethylase 1A (KDM1A) enzyme inhibitor. TAK-418 is used to treat autism symptoms in animal models of neurodevelopmental disorders ." [CHEBI:230499]
synonym: "LVM0PK6IHG" EXACT []
xref: CAS:1818252-53-7
xref: CID:118432651
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2025-04-25T17:42:11Z

[Term]
id: XCO:0001600
name: citrate salt
def: "This is any condition in which the main influencing factor is citrate salt, a salt of citric acid." [CHEBI:50744]
synonym: "citrate" EXACT []
synonym: "citrate(3-)" EXACT []
synonym: "citrates" EXACT []
synonym: "citrate salts" EXACT []
xref: CID:31348
is_a: XCO:0000149 ! ion/salt
created_by: slaulederkind
creation_date: 2025-04-25T18:11:42Z

[Term]
id: XCO:0001601
name: JNK-IN-5A
def: "This is any condition in which the main influencing factor is JNK-IN-5A, an inhibitor of JNK2 (MAPK9/mitogen-activated protein kinase 9), JNK3 (MAPK10/mitogen-activated protein kinase 10) and other mitogen-activated protein kinases." [https://www.rndsystems.com/products/tcs-jnk-5a_2827]
synonym: "JNK Inhibitor IX" EXACT []
synonym: "N-(3-cyano-4,5,6,7-tetrahydro-1-benzothiophen-2-yl)-1-naphthalenecarboxamide" EXACT []
synonym: "TCS JNK 5a" EXACT []
xref: CHEBI:91453
xref: CID:766949
xref: PMID:39932177
is_a: XCO:0000505 ! anti-inflammatory agent
is_a: XCO:0000715 ! mitogen-activated protein kinase inhibitor
created_by: slaulederkind
creation_date: 2025-04-29T16:57:43Z

[Term]
id: XCO:0001602
name: dehydration
def: "This is any condition in which the main influencing factor is dehydration, which occurs when a subject's body loses more fluids than it takes in, leading to a state where it doesn't have enough water and other fluids to function properly. In experimental animals dehydration may be used as a kidney stressor." [https://www.kidney.org/news-stories/can-dehydration-affect-your-kidneys, https://www.mayoclinic.org/diseases-conditions/dehydration/symptoms-causes/syc-20354086]
synonym: "lack of hydration" EXACT []
xref: MP:0001429
xref: PMID:35910780
is_a: XCO:0000021 ! water
created_by: slaulederkind
creation_date: 2025-05-01T10:58:22Z

[Term]
id: XCO:0001603
name: icariin
def: "This is any condition in which the main influencing factor is icariin, a flavonoid compound found in plants of the genus Epimedium. Icarin is the major flavonoid responsible for the pharmacological actions of Epimedii Herb, used in traditional Chinese medicine." [https://en.wikipedia.org/wiki/Icariin, PMID:35910780]
synonym: "3-[(6-deoxy-alpha-L-mannopyranosyl)oxy]-5-hydroxy-2-(4-methoxyphenyl)-8-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-7-yl beta-D-glucopyranoside" EXACT []
synonym: "7-(β-D-Glucopyranosyloxy)-5-hydroxy-4′-methoxy-8-(3-methylbut-2-en-1-yl)-3-(α-L-rhamnopyranosyloxy)flavone" EXACT []
xref: CHEBI:78420
xref: CID:5318997
xref: MESH:C056599
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulederkind
creation_date: 2025-05-01T11:19:57Z

[Term]
id: XCO:0001604
name: multigenerational maternal exposure to controlled fat content diet
def: "This is any condition in which the main influencing factor is any maternal exposure to controlled fat content diet that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) controlled fat content diet on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
is_a: XCO:0000025 ! controlled fat content diet
created_by: slaulederkind
creation_date: 2025-05-01T12:49:21Z

[Term]
id: XCO:0001605
name: pregestational maternal exposure to controlled fat content diet
def: "This is any condition in which the main influencing factor is any pregestational maternal exposure to a controlled fat content diet. This is a condition typically studied to determine the effect of a maternal (F0) controlled fat content diet on the F1 offspring." [https://www.merriam-webster.com, PMID:29972240]
synonym: "maternal exposure to a controlled fat content diet prior to a pregnancy" EXACT []
relationship: part_of XCO:0001604 ! multigenerational maternal exposure to controlled fat content diet
created_by: slaulederkind
creation_date: 2025-05-01T13:03:12Z

[Term]
id: XCO:0001606
name: maternal exposure to controlled fat content diet during nursing
def: "This is any condition in which the main influencing factor is any maternal exposure to a controlled fat content diet during nursing of offspring. This is a condition typically studied to determine the effect of a maternal (F0) controlled fat content diet exposure during the postnatal, preweaning period on the F1 offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "maternal exposure to a controlled fat content diet during nursing of offspring" EXACT []
xref: PMID:29972240
relationship: part_of XCO:0001604 ! multigenerational maternal exposure to controlled fat content diet
created_by: slaulederkind
creation_date: 2025-05-01T13:38:20Z

[Term]
id: XCO:0001607
name: gestational maternal exposure to controlled fat content diet
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to a controlled fat content diet. This is a condition typically studied to determine the effect of a maternal (F0) controlled fat content diet on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "maternal exposure to a controlled fat content diet during pregnancy" EXACT []
xref: PMID:29972240
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001604 ! multigenerational maternal exposure to controlled fat content diet
created_by: slaulederkind
creation_date: 2025-05-01T13:48:42Z

[Term]
id: XCO:0001608
name: multigenerational maternal exposure to standard rat chow diet
def: "This is any condition in which the main influencing factor is any maternal exposure to a standard rat chow diet that has multigenerational effects. This is a condition typically studied to determine the effect of a maternal (F0) standard rat chow diet on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com]
synonym: "multigenerational maternal exposure to control diet" BROAD []
synonym: "multigenerational maternal exposure to standard rat diet" EXACT []
xref: PMID:29972240
is_a: XCO:0000016 ! standard rat chow
created_by: slaulederkind
creation_date: 2025-05-01T14:35:31Z

[Term]
id: XCO:0001609
name: gestational maternal exposure to standard rat chow diet
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to standard rat chow. This is a condition typically studied to determine the effect of maternal (F0) standard rat chow diet on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "maternal exposure to a standard rat chow diet during pregnancy" EXACT []
xref: PMID:29972240
is_a: XCO:0000420 ! controlled in utero environment
relationship: part_of XCO:0001608 ! multigenerational maternal exposure to standard rat chow diet
created_by: slaulederkind
creation_date: 2025-05-01T14:47:45Z

[Term]
id: XCO:0001610
name: maternal exposure to standard rat chow diet during nursing
def: "This is any condition in which the main influencing factor is any maternal exposure to standard rat chow diet during nursing of offspring. This is a condition typically studied to determine the effect of maternal (F0) standard rat chow diet exposure during the postnatal, preweaning period on the F1 offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "maternal exposure to a standard rat chow diet during nursing of offspring" EXACT []
xref: PMID:29972240
relationship: part_of XCO:0001608 ! multigenerational maternal exposure to standard rat chow diet
created_by: slaulederkind
creation_date: 2025-05-01T14:57:58Z

[Term]
id: XCO:0001611
name: pregestational maternal exposure to standard rat chow diet
def: "This is any condition in which the main influencing factor is any pregestational maternal exposure to a standard rat chow diet. This is a condition typically studied to determine the effect of a maternal (F0) standard rat chow diet on the F1 offspring." [https://www.merriam-webster.com]
synonym: "pregestational maternal exposure to control diet" BROAD []
synonym: "pregestational maternal exposure to standard rat chow" EXACT []
xref: PMID:29972240
relationship: part_of XCO:0001608 ! multigenerational maternal exposure to standard rat chow diet
created_by: slaulederkind
creation_date: 2025-05-01T15:05:39Z

[Term]
id: XCO:0001612
name: cinacalcet
def: "This is any condition in which the main influencing factor is cinacalcet, a secondary amino compound that is a member of the naphthalenes and the trifluoromethyl)benzenes. Cinacalcet is a calcium sensing receptor (CASR) agonist and a P450 inhibitor." [CID:156419]
synonym: "N-[(1R)-1-(1-naphthyl)ethyl]-3-[3-(trifluoromethyl)phenyl]propan-1-amine" EXACT []
xref: CHEBI:48390
xref: MESH:D000069449
is_a: XCO:0000135 ! receptor agonist
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2025-05-02T12:04:03Z

[Term]
id: XCO:0001613
name: recombinant alteplase
def: "This is any condition in which the main influencing factor is recombinant alteplase, a biosynthetic form of human tissue-type plasminogen activator (t-PA). Alteplase is an anticoagulant which converts plasminogen to plasmin (fibrinolysin)." [https://en.wikipedia.org/wiki/Alteplase, MESH:D010959]
synonym: "Actilyse" NARROW []
synonym: "Activase" NARROW []
synonym: "recombinant plasminogen activator, tissue type" EXACT []
synonym: "recombinant PLAT" EXACT []
synonym: "recombinant t-PA" EXACT []
synonym: "rt-PA" EXACT []
synonym: "tissue-type plasminogen activator" EXACT []
xref: DrugBank:DB00009
is_a: XCO:0000176 ! enzyme
is_a: XCO:0000694 ! enzyme activator
is_a: XCO:0001090 ! anticoagulant
created_by: slaulederkind
creation_date: 2025-05-05T13:56:45Z

[Term]
id: XCO:0001614
name: urokinase-loaded nano-patrols
def: "This is any condition in which the main influencing factor is urokinase-loaded nano-patrols, which are mesoporous polydopamine nanoparticles which have been loaded with human urokinase and coated with three different single-stranded DNAs to function as thrombin aptamers, pore sealers, and release biomarkers. These specialized nanoparticles are used for regulating therapeutic urokinase dose based on the in vivo thrombolysis resistance of thrombi." [PMID:39823346]
synonym: "uPA-loaded mesoporous polydopamine nanoparticles" NARROW []
synonym: "uPA-loaded nano-patrols" EXACT []
synonym: "uPA-loaded pDA nanoparticles" NARROW []
synonym: "urokinase-loaded mesoporous polydopamine nanoparticles" EXACT []
xref: CHEBI:50803
xref: PMID:34078604
is_a: XCO:0001090 ! anticoagulant
relationship: has_component XCO:0000176 ! enzyme
relationship: has_component XCO:0000338 ! chemical nanoparticle
created_by: slaulederkind
creation_date: 2025-05-05T16:09:21Z

[Term]
id: XCO:0001615
name: aluminum hydroxide
def: "This is any condition in which the main influencing factor is aluminium hydroxide, an inorganic salt used as an antacid. Aluminium hydroxide is a basic compound that acts by neutralizing hydrochloric acid in gastric secretions." [CID:10176082]
synonym: "Al(OH)3" EXACT []
synonym: "aluminium(3+) hydroxide" EXACT []
synonym: "aluminium(III) hydroxide" EXACT []
synonym: "aluminium hydroxide" EXACT []
synonym: "aluminum hydrate" EXACT []
synonym: "hydrated alumina" EXACT []
synonym: "trihydroxidoaluminium" EXACT []
xref: CHEBI:33130
xref: MESH:D000536
is_a: XCO:0000149 ! ion/salt
created_by: slaulederkind
creation_date: 2025-05-06T14:54:56Z

[Term]
id: XCO:0001616
name: partial body near-infrared laser irradiation
def: "This is any condition in which the main influencing factor is partial body near-infrared laser irradiation, which is exposure to laser-emitted, electromagnetic radiation with wavelengths ranging from 750 to 2500 nm. Near-infrared electromagnetic radiation may be used analytically or as part of a therapeutic process." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "partial body NIR laser irradiation" EXACT []
xref: PMID:39823346
is_a: XCO:0000046 ! infrared radiation exposure
is_a: XCO:0000804 ! laser therapy
created_by: slaulederkind
creation_date: 2025-05-08T15:10:09Z

[Term]
id: XCO:0001617
name: partial body near-infrared II laser irradiation
def: "This is any condition in which the main influencing factor is partial body near-infrared II laser irradiation, which is exposure to laser-emitted, electromagnetic radiation with wavelengths ranging from 1000 to 1700 nm. Near-infrared II electromagnetic radiation may be used analytically or as part of a therapeutic process." [PMID:32083067, PMID:37596326]
synonym: "partial body NIR 2 laser irradiation" EXACT []
synonym: "partial body NIR-II laser irradiation" EXACT []
xref: PMID:39823346
is_a: XCO:0001616 ! partial body near-infrared laser irradiation
created_by: slaulederkind
creation_date: 2025-05-08T15:19:05Z

[Term]
id: XCO:0001618
name: filtered air
def: "This is any condition in which the main influencing factor is filtered air, which is air cleared of particulate matter or other pollutants. This is a control condition for the study of various air pollutants." [GSE:242155, https://www.merriam-webster.com/]
synonym: "cleaned air" EXACT []
synonym: "cleared air" EXACT []
is_a: XCO:0000009 ! controlled air content
is_a: XCO:0000099 ! control condition
created_by: slaulederkind
creation_date: 2025-05-09T17:05:17Z

[Term]
id: XCO:0001619
name: controlled air diesel exhaust particle content
def: "This is any condition in which the main influencing factor is diesel exhaust particles, a component of ambient air pollution. The level of diesel exhaust particles in the air surrounding an organism or breathed by an organism is determined by environmental conditions, work conditions, or controlled as part of an experiment." [GSE:242155, https://www.merriam-webster.com/]
synonym: "controlled air DEP content" EXACT []
synonym: "controlled air diesel particle content" EXACT []
synonym: "controlled air diesel particulate matter content" EXACT []
synonym: "controlled air DPM content" EXACT []
is_a: XCO:0000009 ! controlled air content
created_by: slaulederkind
creation_date: 2025-05-09T17:22:30Z

[Term]
id: XCO:0001620
name: Yuanhu Zhitong Prescription
def: "This is any condition in which the main influencing factor is Yuanhu Zhitong Prescription, a traditional Chinese medicine (TCM) formula used for pain relief. The main ingredients of Yuanhu Zhitong Prescription are Radix angelicae dahuricae (white angelica root) and Rhizoma corydalis (gold thread rhizome)." [PMID:_23762151]
synonym: "YHP" EXACT []
synonym: "Yuan Hu Zhi tong" EXACT []
synonym: "Yuanhuzhitong preparation" EXACT []
synonym: "YZP" EXACT []
xref: PMID:38729540
is_a: XCO:0000106 ! anesthetic/analgesic
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2025-05-13T16:03:29Z

[Term]
id: XCO:0001621
name: Corydalis yanhusuo
def: "This is any condition in which the main influencing factor is Corydalis yanhusuo, a plant species in the genus Corydalis. The tuber of Corydalis yanhusuo, frequently mislabeled as the root, is an important therapeutic agent for pain relief in traditional Chinese medicine (TCM)." [https://en.wikipedia.org/wiki/Corydalis_yanhusuo, PMID:_34946576]
synonym: "Asian corydalis" EXACT []
synonym: "corydalis" EXACT []
synonym: "Corydalis yanhusuo extract" EXACT []
synonym: "Corydalis yanhusuo, rhizoma" EXACT []
synonym: "CYH" EXACT []
synonym: "YH" EXACT []
synonym: "YHS" EXACT []
synonym: "Yuanhu" EXACT []
xref: PMID:38729540
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2025-05-13T16:34:00Z

[Term]
id: XCO:0001622
name: Angelica dahurica
def: "This is any condition in which the main influencing factor is Angelica dahurica, whose root is a well-known traditional Chinese medicine (TCM). Angelica dahurica and Corydalis yanhusuo are the main ingredients of Yuanhu Zhitong Prescription" [https://en.wikipedia.org/wiki/Angelica_dahurica, PMID:35847034]
synonym: "A. dahurica" EXACT []
synonym: "AD" EXACT []
synonym: "Angelica dahurica root" EXACT []
synonym: "Baizhi" EXACT []
synonym: "bai zhi" EXACT []
synonym: "BZ" EXACT []
synonym: "Chinese angelica" EXACT []
synonym: "Dahurian angelica" EXACT []
synonym: "garden angelica" EXACT []
synonym: "root of the Holy Ghost" EXACT []
synonym: "wild angelica" EXACT []
xref: PMID:38729540
is_a: XCO:0001623 ! Traditional Chinese Medicine
created_by: slaulederkind
creation_date: 2025-05-13T16:56:53Z

[Term]
id: XCO:0001623
name: Traditional Chinese Medicine
def: "This is any condition in which the main influencing factor is Traditional Chinese Medicine (TCM), a medical system that has been used for thousands of years to prevent, diagnose, and treat disease. Traditional Chinese medicine includes acupuncture, diet, herbal therapy, meditation, physical exercise, and massage." [https://en.wikipedia.org/wiki/Traditional_Chinese_medicine, https://www.cancer.gov/publications/dictionaries/cancer-terms]
synonym: "Not4Curation" RELATED []
synonym: "Oriental medicine" EXACT []
synonym: "TCM" EXACT []
xref: PMID:38729540
is_a: XCO:0000850 ! therapeutic agent
created_by: slaulederkind
creation_date: 2025-05-13T17:11:41Z

[Term]
id: XCO:0001624
name: RG2833
def: "This is any condition in which the main influencing factor is RG2833, a brain-penetrant histone deacetylase 1/3 (HDAC1/3) inhibitor. It is being investigated as a potential therapeutic agent for cancer, neurological disorders, and other conditions." [PMCID:PMC9164640]
synonym: "N-(6-(2-Aminophenylamino)-6-oxohexyl)-4-methylbenzamide" EXACT []
synonym: "RG-2833" EXACT []
synonym: "RGFP 109" EXACT []
xref: CID:56654642
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2025-05-22T15:53:06Z

[Term]
id: XCO:0001625
name: controlled RG2833 content diet
def: "This is any condition in which the main influencing factor is a diet made up of standard chow and a specified amount of RG2833, a brain-penetrant histone deacetylase 1/3 (HDAC1/3) inhibitor." [PMCID:PMC9164640]
synonym: "controlled N-(6-(2-Aminophenylamino)-6-oxohexyl)-4-methylbenzamide content diet" EXACT []
synonym: "controlled RG-2833 content diet" EXACT []
synonym: "controlled RGFP 109 content diet" EXACT []
xref: CID:56654642
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0001624 ! RG2833
created_by: slaulederkind
creation_date: 2025-05-22T16:15:07Z

[Term]
id: XCO:0001626
name: pioglitazone
def: "This is any condition in which the main influencing factor is pioglitazone, a member of the class of thiazolidenediones that is an insulin-sensitizing drug, a pantothenate kinase inhibitor, a cardioprotective agent, a PPARgamma agonist, an antidepressant, and a hypoglycemic agent." [CID:4829]
synonym: "5-{4-[2-(5-ethylpyridin-2-yl)ethoxy]benzyl}-1,3-thiazolidine-2,4-dione" EXACT []
synonym: "Actos" EXACT []
synonym: "Pioglitazone Hydrochloride" RELATED []
xref: CHEBI:8228
xref: MESH:D000077205
xref: PMID:38188512
is_a: XCO:0000407 ! hypoglycemic agent
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000561 ! antidepressant
is_a: XCO:0001196 ! ethers
created_by: slaulederkind
creation_date: 2025-05-27T10:27:52Z

[Term]
id: XCO:0001627
name: polysorbate 20
def: "This is any condition in which the main influencing factor is polysorbate 20, a nonionic surfactant and detergent widely used in various applications, including biochemical and life science research, food production, and personal care products. Polysorbate 20 is a polymer composed of PEG-ylated sorbitan, where the total number of poly(ethylene glycol) units is 20 (w + x + y + z = 20) and a single terminal is capped by a dodecanoyl group." [https://en.wikipedia.org/wiki/Polysorbate_20, https://www.sigmaaldrich.com]
synonym: "Kolliphor PS 20" EXACT []
synonym: "polyoxyethylene (20) sorbitan monolaurate" EXACT []
synonym: "Tween 20" EXACT []
xref: CHEBI:53424
xref: CID:443314
is_a: XCO:0001167 ! polysorbate
created_by: slaulederkind
creation_date: 2025-05-29T11:48:58Z

[Term]
id: XCO:0001628
name: sham gene transfer using an empty adenovirus vector
def: "This is a condition in which an empty adenovirus vector (transiently or stably) has been transferred into a cell or organism. This condition is used as a control for an adenovirus transfer of a specific gene." [https://en.wikipedia.org/wiki/Transduction_(genetics), https://www.cancer.gov/publications/dictionaries/cancer-terms/def/adenovirus-vector]
synonym: "sham gene transfer using an adenovirus empty vector" EXACT []
synonym: "sham gene transfer using an adenovirus EV" EXACT []
xref: GEO:GSE249368
xref: PMID:39938686
is_a: XCO:0000099 ! control condition
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulederkind
creation_date: 2025-05-29T12:59:16Z

[Term]
id: XCO:0001629
name: TRULI
def: "This is any condition in which the main influencing factor is TRULI, a potent and ATP-competitive inhibitor of Lats1 (large tumor suppressor kinase 1) and Lats2 (large tumor suppressor kinase 2) kinases. TRULI promotes Yap-dependent proliferation in postmitotic mammalian tissues by inhibiting phosphorylation of YES1-associated transcriptional regulator (YAP1)." [https://www.bertin-bioreagent.com/lats-in-1/, https://www.medchemexpress.com/truli.html]
synonym: "Lats-IN-1" EXACT []
synonym: "LATS Inhibitor 1" EXACT []
synonym: "N-[(2E)-3-Benzyl-1,3-thiazol-2(3H)-ylidene]-1H-pyrrolo[2,3-b]pyridine-3-carboxamide" EXACT []
synonym: "N-[3-(phenylmethyl)-2(3H)-thiazolylidene]-1H-pyrrolo[2,3-b]pyridine-3-carboxamide" EXACT []
xref: CAS:1424635-83-5
xref: GEO:GSE249368
xref: PMID:39938686
is_a: XCO:0000089 ! neoplasm-inducing chemical
is_a: XCO:0000970 ! protein kinase inhibitor
created_by: slaulederkind
creation_date: 2025-05-29T14:35:10Z

[Term]
id: XCO:0001630
name: desferrioxamine B
def: "This is any condition in which the main influencing factor is desferrioxamine B, a natural product native to Streptomyces pilosus that has a role as an iron chelator, a siderophore, a ferroptosis inhibitor and a bacterial metabolite." [CID:2973]
synonym: "deferoxamine" EXACT []
synonym: "Deferrioxamine B" EXACT []
synonym: "desferrioxamine" EXACT []
synonym: "DFO" EXACT []
synonym: "N'-{5-[acetyl(hydroxy)amino]pentyl}-N-(5-{4-[(5-aminopentyl)(hydroxy)amino]-4-oxobutanamido}pentyl)-N-hydroxybutanediamide" EXACT []
xref: CHEBI:4356
xref: MESH:D003676
xref: PMID:39872995
is_a: XCO:0000120 ! inhibitor
is_a: XCO:0001631 ! chelator
created_by: slaulederkind
creation_date: 2025-06-02T12:28:06Z

[Term]
id: XCO:0001631
name: chelator
def: "This is any condition in which the main influencing factor is a chelator, an organic chemical that bonds with and removes free metal ions from solutions. The complex between a metal ion and a chelator is water-soluble and not easily dissociated." [https://www.sciencedirect.com/topics/medicine-and-dentistry/chelating-agent]
synonym: "chelating agent" EXACT []
synonym: "metal chelating Agent" EXACT []
synonym: "metal chelator" EXACT []
xref: CHEBI:38161
xref: PMID:39872995
is_a: XCO:0000341 ! chemical with specified function
created_by: slaulederkind
creation_date: 2025-06-02T12:43:24Z

[Term]
id: XCO:0001632
name: SCH 23390
def: "This is any condition in which the main influencing factor is SCH 23390, a selective dopamine receptor D1 (DRD1) antagonist." [MESH:C534628]
synonym: "(R)-2,3,4,5-Tetrahydro-8-chloro-3-methyl-5-phenyl-1H-3-benzazepin-7-ol" EXACT []
synonym: "8-chloro-3-methyl-5-phenyl-2,3,4,5-tetrahydro-1H-3-benzazepin-7-ol" EXACT []
synonym: "SCH-23390" EXACT []
synonym: "SCH23390" EXACT []
xref: CHEBI:73297
xref: CID:3036864
xref: PMID:40141377
is_a: XCO:0000160 ! receptor antagonist
created_by: slaulederkind
creation_date: 2025-06-02T13:10:11Z

[Term]
id: XCO:0001633
name: gene transfer of the Gja1 gene using an adenovirus vector
def: "This is any condition in which the main influencing factor is the gap junction protein, alpha 1 gene (Gja1) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [PMID:39938686]
synonym: "gene transfer of the connexin 43 gene using an adenovirus vector" EXACT []
synonym: "gene transfer of the Cx43 gene using an adenovirus vector" EXACT []
synonym: "gene transfer of the gap junction protein, alpha 1 gene using an adenoviral vector" EXACT []
synonym: "gene transfer of the gap junction protein, alpha 1 gene using an adenovirus vector" EXACT []
synonym: "gene transfer of the Gja1 gene using an adenoviral vector" EXACT []
synonym: "gene transfer of the wild type Gja1 gene using an adenovirus vector" EXACT []
synonym: "gene transfer of the wild-type Gja1 gene using an adenovirus vector" EXACT []
synonym: "transduction of Gja1 using an adenoviral vector" EXACT []
synonym: "transduction of Gja1 using an adenovirus vector" EXACT []
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulederkind
creation_date: 2025-06-02T13:57:31Z

[Term]
id: XCO:0001634
name: gene transfer of the Gja1 gene S282A variant using an adenovirus vector
def: "This is any condition in which the main influencing factor is the S282A variant of the gap junction protein, alpha 1 gene (Gja1) which has been (transiently or stably) transferred into a cell or organism using an adenovirus carrier in order to induce synthesis of that gene's product in the recipient cell or organism." [PMID:39938686]
synonym: "gene transfer of the connexin 43 gene S282A variant using an adenovirus vector" EXACT []
synonym: "gene transfer of the Cx43 gene S282A variant using an adenovirus vector" EXACT []
synonym: "gene transfer of the gap junction protein, alpha 1 gene S282A variant using an adenoviral vector" EXACT []
synonym: "gene transfer of the gap junction protein, alpha 1 gene S282A variant using an adenovirus vector" EXACT []
synonym: "gene transfer of the Gja1 gene S282A variant using an adenoviral vector" EXACT []
synonym: "gene transfer of the wild type Gja1 gene S282A variant using an adenovirus vector" EXACT []
synonym: "gene transfer of the wild-type Gja1 S282A variant gene using an adenovirus vector" EXACT []
synonym: "transduction of Gja1 S282A variant using an adenoviral vector" EXACT []
synonym: "transduction of Gja1 S282A variant using an adenovirus vector" EXACT []
is_a: XCO:0000529 ! gene transfer using an adenovirus vector
created_by: slaulederkind
creation_date: 2025-06-02T14:18:51Z

[Term]
id: XCO:0001635
name: ginsenoside C-K
def: "This is any condition in which the main influencing factor is ginsenoside C-K, a ginsenoside found in Panax species that has a role as a plant metabolite, an antineoplastic agent, a hepatoprotective agent, an anti-allergic agent and an anti-inflammatory agent. Ginsenoside C-K is also a beta-D-glucoside, a 12beta-hydroxy steroid, a tetracyclic triterpenoid, a 3beta-hydroxy steroid and a 3beta-hydroxy-4,4-dimethylsteroid." [CID:9852086]
synonym: "3beta,12beta)-3,12-dihydroxydammar-24-en-20-yl beta-D-glucopyranoside" EXACT []
synonym: "ginsenoside CK" EXACT []
synonym: "ginsenoside compound K" EXACT []
synonym: "Ginsenoside K" EXACT []
xref: CHEBI:77146
xref: MESH:C112772
is_a: XCO:0000091 ! steroid
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulederkind
creation_date: 2025-06-03T14:55:21Z

[Term]
id: XCO:0001636
name: multigenerational maternal exposure to corn oil
def: "This is any condition in which the main influencing factor is any maternal exposure to corn oil that has multigenerational effects. This is a condition typically studied to determine the effect of maternal corn oil use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com/, PMID:25839742]
synonym: "multigenerational maternal exposure to maize oil" EXACT []
is_a: XCO:0000829 ! corn oil
created_by: slaulederkind
creation_date: 2025-06-03T15:15:14Z

[Term]
id: XCO:0001637
name: gestational maternal exposure to corn oil
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to corn oil. This is a condition typically studied to determine the effect of maternal (F0) corn oil exposure on the F1 offspring. This is typically a control condition for gestational maternal exposure to some chemical agent." [https://www.merriam-webster.com, PMID:25839742]
synonym: "gestational maternal exposure to maize oil" EXACT []
synonym: "maternal exposure to corn oil during pregnancy" EXACT []
synonym: "maternal exposure to maize oil during pregnancy" EXACT []
is_a: XCO:0000101 ! vehicle control condition
is_a: XCO:0000420 ! controlled in utero environment
is_a: XCO:0001636 ! multigenerational maternal exposure to corn oil
created_by: slaulederkind
creation_date: 2025-06-03T15:59:35Z

[Term]
id: XCO:0001638
name: dipentyl phthalate
def: "This is any condition in which the main influencing factor is dipentyl phthalate, a phthalate ester that is the dipentyl ester of benzene-1,2-dicarboxylic acid. Dipentyl phthalate is a phthalate ester, a diester, and a male reproductive toxicant." [CID:8561]
synonym: "amyl phthalate" EXACT []
synonym: "diamyl phthalate" EXACT []
synonym: "di-n-amyl phthalate" EXACT []
synonym: "di-n-pentyl phthalate" EXACT []
synonym: "dipentyl benzene-1,2-dicarboxylate" EXACT []
xref: CHEBI:34680
xref: MESH:C034171
is_a: XCO:0000239 ! toxic substance
is_a: XCO:0000511 ! ester
created_by: slaulederkind
creation_date: 2025-06-03T16:14:31Z

[Term]
id: XCO:0001639
name: multigenerational maternal exposure to dipentyl phthalate
def: "This is any condition in which the main influencing factor is any maternal exposure to dipentyl phthalate that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) dipentyl phthalate use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com, PMID:25839742]
synonym: "multigenerational maternal exposure to diamyl phthalate" EXACT []
synonym: "multigenerational maternal exposure to di-n-pentyl phthalate" EXACT []
synonym: "multigenerational maternal exposure to dipentyl benzene-1,2-dicarboxylate" EXACT []
xref: CHEBI:34680
is_a: XCO:0001638 ! dipentyl phthalate
created_by: slaulederkind
creation_date: 2025-06-03T16:33:28Z

[Term]
id: XCO:0001640
name: gestational maternal exposure to dipentyl phthalate
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to dipentyl phthalate. This is a condition typically studied to determine the effect of maternal (F0) dipentyl phthalate use/exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "gestational maternal exposure to diamyl phthalate" EXACT []
synonym: "gestational maternal exposure to di-n-pentyl phthalate" EXACT []
synonym: "gestational maternal exposure to dipentyl benzene-1,2-dicarboxylate" EXACT []
synonym: "maternal exposure to dipentyl phthalate during pregnancy" EXACT []
xref: CHEBI:34680
is_a: XCO:0000420 ! controlled in utero environment
is_a: XCO:0001639 ! multigenerational maternal exposure to dipentyl phthalate
created_by: slaulederkind
creation_date: 2025-06-03T16:43:59Z

[Term]
id: XCO:0001641
name: 2,2′,5,5′-tetrachlorobiphenyl-4-ol
def: "This is any condition in which the main influencing factor is 2,2′,5,5′-tetrachlorobiphenyl-4-ol, a metabolite of the polychlorinated biphenyl (PCB) compound PCB52. 2,2′,5,5′-tetrachlorobiphenyl-4-ol is formed when the human body metabolizes PCB52" [PMID:36804509]
synonym: "(1,1'-Biphenyl)-4-ol, 2,2',5,5'-tetrachloro" EXACT []
synonym: "2,2',5,5'-Tetrachloro-4-biphenylol" EXACT []
synonym: "4-Hydroxy-2,2',5,5'-tetrachlorobiphenyl" EXACT []
synonym: "4-OH-PCB52" EXACT []
synonym: "4–52" EXACT []
xref: CID:39971
is_a: XCO:0001572 ! 2,2',5,5'-tetrachlorobiphenyl
created_by: slaulederkind
creation_date: 2025-06-05T10:00:30Z

[Term]
id: XCO:0001642
name: polymeric implant sham procedure
def: "This is any condition in which the main influencing factor is an empty or vehicle-loaded polymeric implant, used as a study control for drugs or chemicals delivered by polymeric implant. Implants are cylindrical or other shaped devices, which are injected or implanted into the subcutaneous tissue with a large bore needle." [https://www.sciencedirect.com/topics/materials-science/polymeric-implant]
synonym: "polymeric implant sham surgery" EXACT []
xref: PMID:40097135
is_a: XCO:0000100 ! sham surgical control condition
created_by: slaulederkind
creation_date: 2025-06-05T10:41:50Z

[Term]
id: XCO:0001643
name: beta-aminopropionitrile
def: "This is any condition in which the main influencing factor is beta-aminopropionitrile, an organic compound with both amine and nitrile functional groups. Beta-aminopropionitrile is an antineoplastic agent, an antirheumatic drug, and an inhibitor of lysyl oxidase, an enzyme involved in collagen and elastin cross-linking." []
synonym: "2-cyanoethylamine" EXACT []
synonym: "3-aminopropanenitrile" EXACT []
synonym: "3-aminopropionitrile" EXACT []
synonym: "aminopropionitrile" EXACT []
synonym: "BAPN" EXACT []
xref: CHEBI:27413
xref: MESH:D000629
xref: PMID:38326494
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000523 ! enzyme inhibitor
created_by: slaulederkind
creation_date: 2025-06-05T12:04:28Z

[Term]
id: XCO:0001644
name: controlled beta-aminopropionitrile content diet
def: "This is any condition in which the main influencing factor is a solid diet in which the amount of beta-aminopropionitrile is maintained at a specified level." [https://www.merriam-webster.com/]
synonym: "controlled  3-aminopropanenitrile content diet" EXACT []
synonym: "controlled aminopropionitrile content diet" EXACT []
synonym: "controlled BAPN content diet" EXACT []
xref: CHEBI:27413
xref: MESH:D000629
xref: PMID:38326494
is_a: XCO:0000014 ! controlled content diet
relationship: has_component XCO:0001643 ! beta-aminopropionitrile
created_by: slaulederkind
creation_date: 2025-06-05T12:34:17Z

[Term]
id: XCO:0001645
name: pterygopalatine artery occlusion
def: "This is any condition in which the main influencing factor is pterygopalatine artery occlusion, an experimental surgical procedure which restricts the amount of cranial blood flowing through the left, right, or both pterygopalatine artery(ies). This procedure is used as part of a more extensive procedure to study intracranial aneurysms in laboratory rats." [PMID:38326494]
synonym: "maxillary artery occlusion" BROAD []
synonym: "pterygomaxillary artery occlusion" EXACT []
synonym: "pterygopalatine artery occlusion" EXACT []
is_a: XCO:0000347 ! blood vessel occlusion
created_by: slaulederkind
creation_date: 2025-06-05T13:04:48Z

[Term]
id: XCO:0001646
name: gene transfer of the rat Ctnnd2 gene using an adeno-associated virus vector
def: "This is any condition in which the main influencing factor is gene transfer of the rat Ctnnd2 (catenin delta 2) gene using an adeno-associated virus vector. Gene transfer into a cell or organism using an adeno-associated virus vector is performed to induce synthesis of the carried gene's product in the recipient cell or organism." [PMID:39965128]
synonym: "AAV‐Ctnnd2" EXACT []
synonym: "gene transfer of pAAV‐CMV‐rCTNND2‐P2A‐EGFP‐tWPA" NARROW []
synonym: "gene transfer of the rat catenin delta 2 gene using adeno-associated virus vector" EXACT []
synonym: "gene transfer of the rat Ctnnd2 gene using an AAV vector" EXACT []
is_a: XCO:0001575 ! gene transfer using an adeno-associated virus vector
created_by: slaulederkind
creation_date: 2025-06-06T11:32:30Z

[Term]
id: XCO:0001647
name: sham gene transfer using an empty adeno-associated virus vector
def: "This is any condition in which the main influencing factor is an empty adeno-associated virus vector that has been transferred into a cell or organism. This condition is used as a control for a adeno-associated virus transfer of a specific gene. The empty vector is identical to the experimental adeno-associated virus except for the specific gene being tested." [PMID:39965128]
synonym: "AAV‐EGFP" NARROW []
synonym: "gene transfer of an empty AAV vector" EXACT []
synonym: "sham gene transfer using an empty AAV vector" EXACT []
is_a: XCO:0000099 ! control condition
is_a: XCO:0001575 ! gene transfer using an adeno-associated virus vector
created_by: slaulederkind
creation_date: 2025-06-06T11:53:36Z

[Term]
id: XCO:0001648
name: human iPSC-derived exosomes
def: "This is any condition in which the main influencing factor is human iPSC-derived exosomes. iPSCs (induced pluripotent stem cells) are generated by reprogramming adult somatic cells (typically skin or blood cells) back into an embryonic-like pluripotent state. Exosomes are nano-sized biovesicles released into surrounding body fluids upon fusion of multivesicular bodies and the plasma membrane." [https://www.criver.com/products-services/cell-sourcing/human-stem-cells/ipsc, PMID:30815248]
synonym: "human induced pluripotent stem cell-derived exosomes" EXACT []
synonym: "human iPSC-derived exosomes" EXACT []
synonym: "human iPSC-Exos" EXACT []
xref: PMID:40214483
is_a: XCO:0001369 ! exosomes
created_by: slaulederkind
creation_date: 2025-06-09T13:04:10Z

[Term]
id: XCO:0001649
name: leucine
def: "This is any condition in which the main influencing factor is leucine, an essential branched-chain amino acid that consists of glycine in which one of the hydrogens attached to the alpha-carbon is substituted by an isobutyl group. Leucine is important for hemoglobin formation and may be used by skeletal muscle during exercise to generate energy." [CHEBI:25017, MESH:D007930]
synonym: "2-Amino-4-methylpentanoic acid" EXACT []
synonym: "D-leucine" NARROW []
synonym: "L" EXACT []
synonym: "Leu" EXACT []
synonym: "L-leucine" NARROW []
xref: CID:6106
xref: PMID:37196349
is_a: XCO:0000119 ! amino acid
created_by: slaulederkind
creation_date: 2025-06-09T13:47:01Z

[Term]
id: XCO:0001650
name: controlled leucine content drinking water
def: "This is any condition in which the main influencing factor is a drink made up of water and a specified amount of leucine consumed by an organism as part of an experiment. Leucine is a branched-chain amino acid that consists of glycine in which one of the hydrogens attached to the alpha-carbon is substituted by an isobutyl group." [CHEBI:25017]
synonym: "controlled 2-Amino-4-methylpentanoic acid content drinking water" EXACT []
synonym: "controlled Leu content drinking water" EXACT []
xref: PMID:37196349
is_a: XCO:0000163 ! controlled content drinking water
relationship: has_component XCO:0001649 ! leucine
created_by: slaulederkind
creation_date: 2025-06-09T14:07:07Z

[Term]
id: XCO:0001651
name: specific pathogen-free diet
def: "This is any condition in which the main influencing factor is a specific-pathogen-free diet, a diet formulated and provided to animals that are maintained in an SPF (specific-pathogen-free) environment, meaning they are free of certain identified pathogens. SPF diets are typically designed to be sterile and free of pathogens, and they often include ingredients like autoclaved standard chow pellets and sterilized water." [PMID:34864461, PMID:39920864]
synonym: "specific pathogen free diet" EXACT []
synonym: "specific-pathogen-free diet" EXACT []
synonym: "SPF diet" EXACT []
is_a: XCO:0000019 ! solid diet
created_by: slaulederkind
creation_date: 2025-06-09T14:39:21Z

[Term]
id: XCO:0001652
name: SPF rat breed and growth diet
def: "This is any condition in which the main influencing factor is a specific-pathogen-free rat breed and growth diet, an SPF diet with 200 g/kg crude protein and 3.44 kcal/g energy content." [PMID:37196349]
synonym: "specific-pathogen-free rat breed and growth diet" EXACT []
xref: https://en.keaoxieli.com/
is_a: XCO:0001651 ! specific pathogen-free diet
created_by: slaulederkind
creation_date: 2025-06-09T15:02:12Z

[Term]
id: XCO:0001653
name: SPF rat maintenance diet
def: "This is any condition in which the main influencing factor is a specific-pathogen-free rat maintenance diet, an SPF diet with 180 g/kg crude protein and 3.40 kcal/g energy content." [PMID:37196349]
synonym: "specific-pathogen-free rat maintenance diet" EXACT []
xref: https://en.keaoxieli.com/
is_a: XCO:0001651 ! specific pathogen-free diet
created_by: slaulederkind
creation_date: 2025-06-09T15:25:50Z

[Term]
id: XCO:0001654
name: suckling
def: "This is any condition in which the main influencing factor is suckling, that act of feeding on or being fed by milk directly from a mother's breast/mammary glands." [https://www.merriam-webster.com/]
synonym: "breastfeeding" EXACT []
synonym: "nursing" EXACT []
xref: PMID:37196349
relationship: has_component XCO:0000415 ! maternal milk
created_by: slaulederkind
creation_date: 2025-06-09T16:09:35Z

[Term]
id: XCO:0001655
name: multigenerational maternal exposure to sucrose
def: "This is any condition in which the main influencing factor is any maternal exposure to sucrose that has multigenerational effects. This is a condition typically studied to determine the effect of maternal (F0) sucrose use/exposure on the F1 offspring, but can also affect the F2 generation by direct effects on the germline of the gestating or preweaning F1 offspring. The maternal exposure may be any time before pregnancy (pregestational) up to the time of weaning of offspring." [https://www.merriam-webster.com/, PMID:25839742]
xref: CHEBI:17992
xref: PMID:40097492
is_a: XCO:0000432 ! sucrose
created_by: slaulederkind
creation_date: 2025-06-09T17:05:18Z

[Term]
id: XCO:0001656
name: gestational maternal exposure to sucrose
def: "This is any condition in which the main influencing factor is any gestational maternal exposure to sucrose. This is a condition typically studied to determine the effect of maternal (F0) sucrose exposure on the F1 offspring." [https://www.merriam-webster.com/, ISBN-13:9780781733908]
synonym: "maternal exposure to sucrose during pregnancy" EXACT []
is_a: XCO:0000420 ! controlled in utero environment
is_a: XCO:0001655 ! multigenerational maternal exposure to sucrose
created_by: slaulederkind
creation_date: 2025-06-09T17:12:14Z

[Term]
id: XCO:0001657
name: gene transfer of the mouse-jellyfish EGFPL10A fusion gene using an adeno-associated virus vector
def: "This is any condition in which the main influencing factor is gene transfer of the mouse-jellyfish EGFPL10A (flourescent protein/ribosomal protein) fusion gene using an adeno-associated virus vector. This expression of this vector is double floxed for use with Cre transgenic animals. This vector is used as part a viral TRAP (translating ribosome affinity purification) system to access translating mRNAs." [https://www.addgene.org/98747/, PMID:28423326]
synonym: "gene transduction of AAV-FLEX-EGFPL10a" EXACT []
synonym: "gene transduction of EF1a-AAV5-FLEX-GFPL10a" EXACT []
synonym: "gene transfer of AAV-FLEX-EGFPL10a" EXACT []
synonym: "gene transfer of EF1a-AAV5-FLEX-GFPL10a" EXACT []
synonym: "gene transfer of the mouse-jellyfish EGFPL10A fusion gene using an adeno-associated viral vector" EXACT []
is_a: XCO:0001575 ! gene transfer using an adeno-associated virus vector
created_by: slaulederkind
creation_date: 2025-06-10T13:20:37Z

[Term]
id: XCO:0001658
name: cocaine hydrochloride
def: "This is any condition in which the main influencing factor is the hydrochloride salt of cocaine, which is used clinically as a local anesthetic and vasoconstrictor. Cocaine's local anesthetic effects come from it's binding to and blocking of the voltage-gated sodium channels in the neuronal cell membrane. Cocaine also has powerful central nervous system effects similar to the amphetamines and is a drug of abuse." [CID:656832]
synonym: "(1R,2R,3S,5S)-3-(benzoyloxy)-2-(methoxycarbonyl)-8-methyl-8-azoniabicyclo[3.2.1]octane chloride" EXACT []
synonym: "cocaine HCl" EXACT []
xref: CHEBI:613010
xref: MESH:D003042
xref: PMID:33159041
is_a: XCO:0001017 ! cocaine
created_by: slaulederkind
creation_date: 2025-06-12T12:56:32Z

[Term]
id: XCO:0001659
name: Urolithin A
def: "This is any condition in which the main influencing factor is Urolithin A, a coumarin that has various biological effects. Research on Urolithin A has found effects on diverse biological activities, encompassing anti-inflammatory, antioxidant, anti-tumor, and anti-aging properties." [CID:5488186, PMID:37892516]
synonym: "3,8-dihydroxybenzo[c]chromen-6-one" EXACT []
synonym: "UA" EXACT []
synonym: "Uro A" EXACT []
synonym: "Uro-A" EXACT []
xref: CHEBI:168442
xref: MESH:C026423
xref: PMID:40034121
is_a: XCO:0000271 ! antioxidant
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000505 ! anti-inflammatory agent
created_by: slaulederkind
creation_date: 2025-06-12T13:27:13Z

[Term]
id: XCO:0001660
name: C75
def: "This is any condition in which the main influencing factor is C75, a fatty acid synthase (FASN) inhibitor and an activator of carnitine palmitoyl-transferase-1 (CPT1A). C75 has shown potential therapeutic effects in several cancer models." [CHEBI:189865, https://www.selleckchem.com/products/c-75.html]
synonym: "4-Methylene-2-octyl-5-oxotetrahydrofuran-3-carboxylic acid" EXACT []
synonym: "rac-(2R,3S)-4-methylidene-2-octyl-5-oxotetrahydrofuran-3-carboxylic acid" EXACT []
xref: PMID:39877365
is_a: XCO:0000435 ! antineoplastic agent
is_a: XCO:0000523 ! enzyme inhibitor
is_a: XCO:0000694 ! enzyme activator
created_by: slaulederkind
creation_date: 2025-06-12T14:13:12Z

[Term]
id: XCO:0001661
name: rabeprazole
def: "A sulfoxide that has formula C18H21N3O3S." [CHEBI:8768, https://www.merriam-webster.com/]
synonym: "2-({[4-(3-methoxypropoxy)-3-methylpyridin-2-yl]methyl}sulfinyl)-1H-benzimidazole" EXACT []
xref: MESH:D064750
xref: PMID:40239879
is_a: XCO:0000577 ! proton pump inhibitor
created_by: slaulederkind
creation_date: 2025-06-13T13:38:50Z

[Typedef]
id: has_component
name: has_component
xref: RO:0002211
created_by: JSmith
creation_date: 2014-03-07T11:34:22Z

[Typedef]
id: has_part
name: has_part
xref: BFO:0000051
is_transitive: true
created_by: JSmith
creation_date: 2014-03-07T11:32:23Z

[Typedef]
id: part_of
name: part_of
xref: BFO:0000050
is_transitive: true